4. Cūḷachakkapañheti mūlapaṇṇāse cūḷataṇhāsaṅkhayasutte (ma. ni. 1.390 ādayo).
4. Cūḷachakkapañhe (in the question of the Lesser Sixes) refers to the Cūḷataṇhāsaṅkhaya Sutta in the Mūlapaṇṇāsa.
4. Cūḷachakkapañhe (trong câu hỏi Cūḷachakka) tức là trong kinh Cūḷataṇhāsaṅkhaya (Tiểu Đoạn Tận Ái) thuộc Mūlapaṇṇāsa (Trung Bộ I, trang 390 v.v…).
Mahāsakkapañhepīti mahātaṇhāsaṅkhayasuttepi (ma. ni. 1.396 ādayo).
Mahāsakkapañhepī (and in the question of the Greater Sakkas) refers to the Mahātaṇhāsaṅkhaya Sutta.
Mahāsakkapañhepī (và trong câu hỏi Mahāsakka) tức là trong kinh Mahātaṇhāsaṅkhaya (Đại Đoạn Tận Ái) (Trung Bộ I, trang 396 v.v…).
Etanti ‘‘ye te samaṇabrāhmaṇā’’tiādisuttapadaṃ.
Eta (this) refers to the Sutta passage "those ascetics and brahmins," and so forth.
Etaṃ (điều này) tức là đoạn kinh “ye te samaṇabrāhmaṇā” (những sa môn, bà la môn đó) v.v….
Taṇhā sammadeva khīyati etthāti taṇhāsaṅkhayo, asaṅkhatā dhātūti āha ‘‘taṇhāsaṅkhaye nibbāne’’ti.
That in which craving is utterly destroyed is taṇhāsaṅkhayo (destruction of craving), the unconditioned element, so it is said, " taṇhāsaṅkhaye nibbāne" (in Nibbāna, the destruction of craving).
Tham ái được đoạn tận hoàn toàn ở đây là taṇhāsaṅkhayo (sự đoạn tận tham ái), tức là pháp vô vi (asaṅkhata dhātu), nên (chú giải) nói “taṇhāsaṅkhaye nibbāne” (trong Niết Bàn là sự đoạn tận tham ái).
Antaṃ atikkantaniṭṭhāti antarahitaniṭṭhā.
Antaṃ atikkantaniṭṭhā (the end, surpassed completion) means a hidden completion.
Antaṃ atikkantaniṭṭhā (sự kết thúc vượt qua giới hạn) tức là sự kết thúc đã biến mất.
Tenāha ‘‘satataniṭṭhā’’ti.
Therefore, it is said, " satataniṭṭhā" (constant completion).
Do đó (chú giải) nói “satataniṭṭhā” (sự kết thúc vĩnh viễn).
Sesapadesūti ‘‘accantayogakkhemino’’tiādīsu.
Sesapadesū (in the remaining passages) refers to "supremely secure from bondage," and so forth.
Sesapadesū (trong các cụm từ còn lại) tức là trong “accantayogakkhemino” (vô thượng an ổn khỏi các ách phược) v.v….
5. Samādhīti appanāsamādhi, upacārasamādhi vā.
5. Samādhī (concentration) means absorption concentration or access concentration.
5. Samādhi (định) là appanāsamādhi (định an chỉ) hoặc upacārasamādhi (định cận hành).
Kammaṭṭhānanti samādhipādakaṃ vipassanākammaṭṭhānaṃ.
Kammaṭṭhāna (meditation subject) means a vipassanā kammaṭṭhāna that leads to concentration.
Kammaṭṭhānaṃ (đề mục thiền định) là đề mục thiền quán (vipassanākammaṭṭhāna) làm nền tảng cho định.
‘‘Phātiṃ gamissatī’’ti pāṭho.
The reading is "phātiṃ gamissatī" (will grow).
Pāṭho (bản văn) là “Phātiṃ gamissatī” (sẽ đạt được sự tăng trưởng).
Patthetīti ‘‘aho vata me īdisaṃ rūpaṃ bhaveyyā’’ti.
Patthetī (wishes) means "Oh, may I have such a form!"
Patthetī (mong cầu) tức là “mong sao tôi có được sắc tướng như vậy”.
Abhivadatīti taṇhādiṭṭhivasena abhinivesaṃ vadati.
Abhivadatī (expresses) means expresses attachment by way of craving and views.
Abhivadatī (nói lên) tức là nói lên sự chấp thủ do tham ái và tà kiến.
Tenāha ‘‘tāya abhinandanāyā’’tiādi.
Therefore, it is said, " tāya abhinandanāyā" (by that delight), and so forth.
Do đó (chú giải) nói “tāya abhinandanāyā” (do sự hoan hỷ đó) v.v….
‘‘Aho piyaṃ iṭṭha’’nti vacībhede asatipi tathā lobhuppāde sati abhivadatiyeva nāma.
Even without uttering words like "Oh, dear and agreeable!", when such greed arises, one indeed expresses it.
Dù không có sự khác biệt trong lời nói “Aho piyaṃ iṭṭhaṃ” (Ôi, thật đáng yêu, đáng thích), nhưng khi có sự khởi sinh của lòng tham như vậy thì đó chính là nói lên.
Tenāha ‘‘vācaṃ abhindanto’’ti.
Therefore, it is said, " vācaṃ abhindanto" (not breaking speech).
Do đó (chú giải) nói “vācaṃ abhindanto” (không làm gián đoạn lời nói).
‘‘Mama ida’’nti attano pariṇāmetvā anaññagocaraṃ viya katvā gaṇhanto ajjhosāya tiṭṭhati nāmāti dassento āha ‘‘gilitvāti pariniṭṭhapetvā gaṇhātī’’ti.
Showing that one ajjhosāya tiṭṭhati (dwells clinging) by converting it to oneself as "this is mine" and taking it as if it belongs to no one else, it is said, " gilitvāti pariniṭṭhapetvā gaṇhātī" (having swallowed, having completely settled, one grasps).
Để trình bày rằng khi biến đổi thành của mình “Mama idaṃ” (cái này là của tôi) và nắm giữ như thể nó không thuộc về ai khác, thì đó là ajjhosāya tiṭṭhati (đứng vững trong sự chấp thủ), (chú giải) nói “gilitvāti pariniṭṭhapetvā gaṇhātī” (nuốt chửng tức là nắm giữ một cách chắc chắn).
‘‘Abhinandatī’’tiādayo pubbabhāgavasena vuttā, ‘‘uppajjati nandī’’ti dvārappattavasena.
"Abhinandatī" (delights), and so forth, are stated in terms of the initial stage; "uppajjati nandī" (delight arises) is stated in terms of reaching the door.
“Abhinandatī” (hoan hỷ) v.v… được nói theo khía cạnh phần trước, còn “uppajjati nandī” (khởi sinh sự hỷ lạc) theo khía cạnh đạt đến cửa.
Paṭhamehi padehi anusayo, pacchimena pariyuṭṭhānanti keci ‘‘gahaṇaṭṭhena upādāna’’nti katvā.
Some say that the earlier terms refer to anusaya (underlying tendency), and the latter term to pariyuṭṭhāna (obsession), understanding "upādāna" (clinging) in the sense of grasping.
Một số người nói rằng các cụm từ đầu tiên là tùy miên (anusaya), còn cụm từ cuối cùng là triền cái (pariyuṭṭhāna), dựa trên nghĩa “upādāna (chấp thủ) theo nghĩa nắm giữ”.
Nābhinandati nābhivadatīti ettha heṭṭhā vuttavipariyāyena attho veditabbo.
In " nābhinandati nābhivadatī" (does not delight, does not express), the meaning should be understood as the opposite of what was stated above.
Nābhinandati nābhivadatī (không hoan hỷ, không nói lên) ở đây, ý nghĩa cần được hiểu theo cách ngược lại với những gì đã nói ở trên.
Na ‘‘iṭṭhaṃ kanta’’nti vadatīti ‘‘iṭṭha’’nti na vadati, ‘‘kanta’’nti na vadati.
"He does not say 'agreeable, delightful'" means he does not say "agreeable", he does not say "delightful".
Không nói ‘‘điều mong muốn, điều ưa thích’’ có nghĩa là không nói ‘‘điều mong muốn’’, không nói ‘‘điều ưa thích’’.
Nābhivadatiyeva taṇhāya anupādiyattā.
He does not express it, indeed, because of non-clinging to craving.
Không tán thán vì không chấp thủ ái.
7. Gahaṇena uppannaṃ paritassananti khandhapañcake ‘‘ahaṃ mamā’’ti gahaṇena uppannaṃ taṇhāparitassanaṃ diṭṭhiparitassanañca.
7. The distress arisen through grasping means the distress of craving and the distress of wrong view that has arisen in the five aggregates through grasping, thinking "I am, mine".
7. Sự lo âu sinh khởi do chấp thủ là sự lo âu do ái và sự lo âu do kiến sinh khởi do chấp thủ “ta, của ta” trong năm uẩn.
Aparitassananti paritassanābhāvaṃ, paritassanapaṭipakkhaṃ vā.
Non-distress means the absence of distress, or the opposite of distress.
Không lo âu là sự không có lo âu, hoặc là đối nghịch với lo âu.
Ahu vata metaṃ balayobbanādi.
Alas, that was mine refers to strength, youth, and so on.
Điều này đã từng là của tôi là sức mạnh, tuổi trẻ, v.v.
Kammaviññāṇanti vipariṇāmārammaṇaṃ taṇhādiṭṭhisahagataṃ viññāṇaṃ tadanuvatti ca.
Kamma-consciousness means consciousness associated with craving and wrong views, which has transformation as its object, and also that which follows it.
Thức nghiệp là thức có đối tượng biến đổi, đi kèm với ái và kiến, và sự tùy thuận theo đó.
Anuparivatti nāma taṃ ārammaṇaṃ katvā pavatti.
Following upon means proceeding with that as the object.
Tùy thuận theo có nghĩa là lấy đối tượng đó làm sở duyên mà diễn tiến.
Tenāha ‘‘vipariṇāmārammaṇacittato’’ti.
Therefore, it is said "from the mind with transformation as its object".
Vì thế nói ‘‘từ tâm có đối tượng biến đổi’’.
Akusaladhammasamuppādāti taṇhāya aññākusaladhammasamuppādā.
Through the arising of unwholesome phenomena means through the arising of other unwholesome phenomena besides craving.
Sự sinh khởi của các pháp bất thiện là sự sinh khởi của các pháp bất thiện khác ngoài ái.
Pariyādiyitvāti khepetvā, tassa pavattituṃ okāsaṃ adatvā.
Having completely removed means having eliminated, not giving it a chance to proceed.
Trừ bỏ là làm cho tiêu tan, không cho nó cơ hội diễn tiến.
Sauttāsoti taṇhādiṭṭhivasena sauttāso.
With fear means with fear due to craving and wrong view.
Cùng với sự sợ hãi là cùng với sự sợ hãi do ái và kiến.
Gaṇhitvāti taṇhādiṭṭhiggāhehi gahetvā tesañceva vasena paritassako.
Having seized means having been seized by the graspers of craving and wrong view, and in dependence on them, he is distressed.
Chấp thủ là bị các chấp thủ ái và kiến nắm giữ, và do đó lo âu.
Rūpabhedānuparivatti cittaṃ na hoti.
The mind does not follow the alteration of form.
Tâm không tùy thuận theo sự biến hoại của sắc.
Vaṭṭatīti sabbākārena vattuṃ yuttanti attho.
It is fitting means it is appropriate to say in every way.
Phù hợp có nghĩa là phù hợp để nói theo mọi cách.
22. Upādānānaṃ ārammaṇabhūtā khandhā upādānakkhandhā.
22. The aggregates that are the objects of clinging are the aggregates of clinging.
22. Các uẩn là đối tượng của sự chấp thủ được gọi là các uẩn chấp thủ.
Parihārabhāriyaṭṭhenāti parihārassa bhāriyabhāvena garutarabhāvena.
By reason of the burden of maintenance means by reason of the heavy, weighty nature of maintenance.
Theo nghĩa nặng nề của sự mang vác có nghĩa là theo nghĩa nặng nề, rất nặng nề của sự mang vác.
Vuttameva atthaṃ pākaṭaṃ kātuṃ ‘‘etesañhī’’tiādimāha.
To clarify the meaning already stated, he says "For these..." and so on.
Để làm rõ ý nghĩa đã nói, ngài nói ‘‘etesañhī’’ (vì những điều này), v.v.
Tattha yasmā etāni ṭhānagamanādīni rūpārūpadhammānaṃ paṅgulajaccandhānaṃ viya aññamaññūpassayavasena ijjhanti, na paccekaṃ, tasmā ‘‘etesa’’nti avisesavacanaṃ kataṃ.
Here, since these actions of standing, going, etc., succeed in dependence on one another, like the lame and the born-blind, and not individually, therefore the unspecified term "for these" is used.
Ở đây, vì những điều này như đi đứng, v.v. của các pháp sắc và vô sắc thành tựu nhờ sự nương tựa lẫn nhau, như người què và người mù bẩm sinh, chứ không phải riêng lẻ, nên đã dùng từ ‘‘etesaṃ’’ (những điều này) không phân biệt.
Puggalanti khandhasantānaṃ vadati.
Person refers to the continuum of aggregates.
Cá nhân nói về dòng tương tục của các uẩn.
Khandhasantāno hi avicchedena pavattamāno yāva parinibbānā khandhabhāraṃ vahanto viya loke khāyati tabbinimuttassa sattassa abhāvato.
For the continuum of aggregates, continuing without interruption until final Nibbāna, appears in the world as if carrying the burden of aggregates, there being no being distinct from it.
Dòng tương tục của các uẩn, khi diễn tiến không gián đoạn cho đến khi nhập Niết-bàn, dường như mang gánh nặng của các uẩn trên thế gian, vì không có hữu tình nào khác ngoài điều đó.
Tenāha ‘‘puggalo’’tiādi.
Therefore, he said "person" and so on.
Vì thế nói ‘‘puggalo’’ (cá nhân), v.v.
Bhārahāroti jātoti bhārahāro nāma jāto.
Born as a burden-bearer means he is born as a burden-bearer.
Người mang gánh nặng đã sinh khởi có nghĩa là người mang gánh nặng đã sinh khởi.
Punabbhavakaraṇaṃ punabbhavo, taṃ phalaṃ arahati, tattha niyuttāti vā ponobhavikā.
That which causes rebirth is rebirth; it is worthy of that fruit, or it is dedicated to it, hence leading to renewed existence.
Sự tạo tác tái sinh là tái sinh, nó xứng đáng với quả đó, hoặc được chỉ định vào đó, nên gọi là ponobhavikā (dẫn đến tái sinh).
Tabbhāvasahagataṃ yathā ‘‘sanidassanā dhammā’’ti, na saṃsaṭṭhasahagataṃ, nāpi ārammaṇasahagataṃ.
Accompanied by that state as in "phenomena with manifestation," not accompanied by commingling, nor accompanied by an object.
Cùng với trạng thái đó giống như “các pháp hữu sắc tướng”, không phải cùng với sự hòa trộn, cũng không phải cùng với đối tượng.
‘‘Tatra tatrā’’ti yaṃ yaṃ uppattiṭṭhānaṃ, rūpādiārammaṇaṃ vā patvā tatratatrābhinandinī.
"In this and that" means in whatever realm of rebirth, or having reached a sense object such as form, it delights therein.
‘‘Tatra tatrā’’ (ở chỗ này chỗ kia) có nghĩa là khi đạt đến bất kỳ nơi sinh nào, hoặc đối tượng sắc, v.v. thì hoan hỷ ở chỗ đó chỗ đó.
Tenāha ‘‘upapattiṭṭhāne vā’’tiādi.
Therefore, it is said "in a realm of rebirth or..." and so on.
Vì thế nói ‘‘upapattiṭṭhāne vā’’ (hoặc ở nơi sinh), v.v.
Pañcakāmaguṇikoti pañcakāmaguṇārammaṇo.
Possessing five sense pleasures means having the five sense pleasures as its object.
Có năm dục lạc là có đối tượng năm dục lạc.
Rūpārūpūpapattibhave rāgo rūpārūpabhavarāgo.
Lust for existence in the realms of form and formlessness is lust for existence in the form and formless realms.
Sự tham ái trong các cõi sinh sắc và vô sắc là tham ái cõi sắc và vô sắc.
Jhānanikanti jhānasaṅkhāte kammabhave rāgo.
Delight in jhāna is lust for the kamma-existence called jhāna.
Sự hoan hỷ thiền định là sự tham ái trong nghiệp hữu gọi là thiền định.
Sassatādiṭṭhīti bhavadiṭṭhi, taṃsahagato rāgo.
Eternalist view is the view of existence; lust associated with that.
Thường kiến là kiến hữu, sự tham ái đi kèm với nó.
Ayanti rāgo bhavataṇhā nāma.
This lust is called bhava-taṇhā (craving for existence).
Sự tham ái này được gọi là hữu ái.
Ucchedadiṭṭhi vibhavadiṭṭhi nāma, taṃsahagato chandarāgo vibhavataṇhā nāma.
Annihilationist view is called vibhava-diṭṭhi (view of non-existence); the desire-lust associated with it is called vibhava-taṇhā (craving for non-existence).
Đoạn kiến được gọi là vô hữu kiến, sự tham ái đi kèm với nó được gọi là vô hữu ái.
Esa puggalo khandhabhāraṃ ādiyati taṇhāvasena paṭisandhiggahaṇato.
This person takes up the burden of aggregates by grasping at rebirth through craving.
Cá nhân này chấp thủ gánh nặng của các uẩn do sự chấp thủ tái sinh theo ái.
‘‘Asesamettha taṇhā virajjati palujjati nirujjhati pahīyatī’’tiādinā sabbapadāni nibbānavaseneva veditabbānīti āha ‘‘sabbaṃ nibbānasseva vevacana’’nti.
"Here, craving entirely fades away, is dispelled, ceases, is abandoned," and so on; all these terms are to be understood in terms of Nibbāna, so he says, "all are synonyms for Nibbāna."
Vì tất cả các từ như “Ở đây, tất cả ái đều ly tham, hoại diệt, đoạn diệt, được đoạn trừ”, v.v. phải được hiểu theo nghĩa Niết-bàn, nên ngài nói “tất cả đều là đồng nghĩa của Niết-bàn”.
31. Aghaṃ vuccati pāpaṃ, aghanimittatāya aghaṃ dukkhaṃ.
31. Agha is said to be evil; agha is suffering due to being the cause of evil.
31. Agha được gọi là ác pháp, agha là khổ do là nhân của khổ.
Idañhi dukkhaṃ nāma visesato pāpahetukaṃ kammaphalasaññitaṃ.
Indeed, this suffering is specifically due to evil, called the fruit of kamma.
Khổ này được gọi là đặc biệt do ác nghiệp, là quả của nghiệp.
Tathā vaṭṭadukkhaṃ avijjātaṇhāmūlakattā.
Similarly, the suffering of saṃsāra, being rooted in ignorance and craving.
Cũng vậy, khổ luân hồi do có vô minh và ái làm gốc.
Aghassa nimittatāya aghaṃ dukkhaṃ.
Agha is suffering by being the cause of evil.
Agha là khổ do là nhân của khổ.
Vaṭṭānusārī mahājano hi dukkhābhibhūto tassa patikāraṃ maññamāno taṃ taṃ karotīti.
For the multitude following the cycle of existence, oppressed by suffering, thinking it to be a remedy for it, they do this and that.
Đại chúng đi theo luân hồi, bị khổ chi phối, nghĩ rằng đó là phương thuốc chữa trị, nên làm điều này điều nọ.
35. Yadi rūpaṃ anusetīti rūpadhamme ārabbha yadi rāgādayo anusayanavasena pavattanti.
35. "If form obsesses" means if lust and other defilements persist in the mode of obsession concerning phenomena of form.
35. Yadi rūpaṃ anusetī (nếu sắc tùy miên) nghĩa là nếu các dục tham, v.v. khởi lên một cách tùy miên liên quan đến pháp sắc.
Tena saṅkhaṃ gacchatīti tena rāgādinā taṃsamaṅgīpuggalo saṅkhātabbataṃ ‘‘ratto duṭṭho’’tiādinā voharitabbataṃ upagacchatīti.
"By that, it attains designation" means that the individual endowed with that attains the state of being designated, the state of being referred to as "lustful, hateful," and so on, by that lust, etc.
Tena saṅkhaṃ gacchatī (do đó được gọi là) nghĩa là người có đầy đủ điều đó được gọi bằng các tên như “tham lam, sân hận”, v.v. do các dục tham đó.
Tenāha ‘‘kāmarāgādīsū’’tiādi.
Therefore, it is said "in sensual lust, etc."
Do đó, (văn bản) nói “kāmarāgādīsu” (trong dục tham, v.v.), v.v.
Abhūtenāti ajātena anusayavasena appavattena.
"By what is non-existent" means by what has not arisen, by what does not operate in the mode of obsession.
Abhūtena (không có thật) nghĩa là không sinh khởi, không khởi lên một cách tùy miên.
Anusayasīsena hettha abhibhavaṃ vadati.
Here, it speaks of overcoming through the head of obsession.
Ở đây, (văn bản) nói về sự chế ngự theo khía cạnh tùy miên.
Yato ‘‘ratto duṭṭho mūḷhoti saṅkhaṃ na gacchatī’’ti vuttaṃ.
As it is said, "He does not attain designation as 'lustful, hateful, deluded'."
Vì đã nói “không được gọi là tham lam, sân hận, si mê”.
Nippariyāyato hi maggavajjhakilesā anusayo.
Without qualification, the defilements to be overcome by the path are obsessions (anusaya).
Thật vậy, phiền não bị loại trừ bởi Đạo là tùy miên.
36. Taṃ anusayitaṃ rūpanti taṃ rāgādinā anusayitaṃ rūpaṃ marantena anusayena anumarati.
36. "That form obsessed by" means that form, obsessed by lust, etc., follows the dying obsession.
36. Taṃ anusayitaṃ rūpaṃ (sắc bị tùy miên đó) nghĩa là sắc bị tùy miên bởi dục tham, v.v. đó chết cùng với tùy miên.
Tena vuttaṃ ‘‘na hī’’tiādi.
Therefore, it is said "not indeed," and so on.
Do đó, đã nói “na hī” (quả thật không), v.v.
Yena anusayena marantena taṃ anumarati.
By which obsession, dying, it follows that.
Yena anusayena (bằng tùy miên nào) mà chết cùng với điều đó.
Tena saṅkhaṃ gacchatīti tathābhūtato tena ‘‘ratto’’tiādivohāraṃ labhati.
"By that, it attains designation" means that from such a state, it receives the designation "lustful," and so on, by that.
Tena saṅkhaṃ gacchatī (do đó được gọi là) nghĩa là từ trạng thái như vậy, người đó nhận được cách gọi “tham lam”, v.v. bởi tùy miên đó.
Yena anusayena kāraṇabhūtena anumīyati, tena.
"By which obsession" as a cause "it is inferred," by that.
Yena anusayena (bằng tùy miên nào) làm nguyên nhân anumīyati (được suy ra), bằng tùy miên đó.
37-38. Ṭhitiyā ṭhitikkhaṇena sahitaṃ ṭhitaṃ.
37-38. "Enduring" is that which is accompanied by the moment of endurance, the ṭhiti moment.
37-38. Ṭhitaṃ (đứng yên) là cùng với sát-na tồn tại.
Ṭhitassa aññathattanti uppādakkhaṇato aññathābhāvo.
"The alteration of that which endures" is its becoming otherwise from the moment of origination.
Ṭhitassa aññathattaṃ (sự thay đổi của cái đang tồn tại) là sự khác biệt so với sát-na sinh khởi.
Paññāyatīti upalabbhati.
"Is discerned" means is found.
Paññāyatī (được nhận biết) nghĩa là được tìm thấy.
Paccayavasena dharamānattā eva jīvamānassa jīvitindriyavasena jarā paññāyati uppādakkhaṇato aññathattappattiyā.
Since it endures due to conditions, "decay of that which is alive" is discerned by means of the faculty of life, through its attaining alteration from the moment of origination.
Vì tồn tại theo duyên, nên jarā paññāyati (sự già được nhận biết) ở jīvamānassa (cái đang sống) theo khía cạnh sinh mạng quyền, do đạt đến sự khác biệt so với sát-na sinh khởi.
Vuttameva atthaṃ pākaṭataraṃ kātuṃ ‘‘ṭhitī’’tiādi vuttaṃ.
The meaning already stated is expressed more clearly by "endurance," and so on.
Để làm rõ nghĩa đã nói, “ṭhitī” (sự tồn tại), v.v. đã được nói.
Jīvi…pe… nāmaṃ.
"Life...and name."
Jīvi…pe… nāmaṃ.
Tathā hi abhidhamme (dha. sa. 19) ‘‘āyu ṭhitī’’ti niddiṭṭhaṃ.
Thus, in the Abhidhamma, it is designated as "life, endurance."
Thật vậy, trong Abhidhamma (Dhs. 19), “āyu ṭhitī” (tuổi thọ, sự tồn tại) đã được chỉ rõ.
Aññathattanti jarāya nāmanti sambandho.
"Alteration" is connected with "the name of decay."
Mối liên hệ là “sự thay đổi là tên của sự già”.
Tīṇi lakkhaṇāni honti saṅkhatasabhāvalakkhaṇato.
"There are three characteristics" from the perspective of the characteristic of conditioned nature.
Có tīṇi lakkhaṇāni honti (ba đặc tính) theo đặc tính của bản chất hữu vi.
Yo koci rūpadhammo vā arūpadhammo vā lokiyo vā lokuttaro vā saṅkhāro.
"Whatever" phenomenon of form or non-form, mundane or supramundane, "is a conditioned phenomenon."
Yo koci (bất cứ) pháp sắc hay pháp vô sắc, thế gian hay xuất thế gian, saṅkhāro (hữu vi).
Saṅkhāro, na lakkhaṇaṃ uppādādisabhāvattā.
"A conditioned phenomenon, not a characteristic" because it has the nature of arising, etc.
Saṅkhāro, na lakkhaṇaṃ (hữu vi, không phải đặc tính) vì bản chất là sinh khởi, v.v.
Lakkhaṇaṃ, na saṅkhāro uppādādirahitattā.
"A characteristic, not a conditioned phenomenon" because it is devoid of arising, etc.
Lakkhaṇaṃ, na saṅkhāro (đặc tính, không phải hữu vi) vì không có sinh khởi, v.v.
Na ca…pe… sakkā saṅkhāradhammattā lakkhaṇassa.
"Neither...is it possible" for a characteristic to be a conditioned phenomenon.
Na ca…pe… sakkā (và không thể…) vì đặc tính là pháp hữu vi.
Nāpi lakkhaṇaṃ vinā saṅkhāro paññāpetuṃ sakkā saṅkhārabhāvena.
"Nor is it possible to describe a conditioned phenomenon without a characteristic" in its conditioned state.
Nāpi lakkhaṇaṃ vinā saṅkhāro (cũng không thể) trình bày hữu vi mà không có đặc tính theo bản chất hữu vi.
Tenāha ‘‘lakkhaṇenā’’tiādi.
Therefore, it is said "by characteristic," and so on.
Do đó, (văn bản) nói “lakkhaṇenā” (bằng đặc tính), v.v.
Idāni yathāvuttamatthaṃ upamāya vibhāvetuṃ ‘‘yathā’’tiādimāha.
Now, to illustrate the aforementioned meaning with an analogy, it begins by saying "just as," and so on.
Bây giờ, để làm rõ nghĩa đã nói bằng ví dụ, (văn bản) nói “yathā” (như), v.v.
Tattha lakkhaṇanti kāḷarattasabalādibhāvalakkhaṇaṃ pākaṭaṃ hoti ‘‘ayaṃ asukassa gāvī’’ti.
There, "characteristic" refers to the clear characteristic of being black, red, variegated, etc., so that it is known, "this is so-and-so's cow."
Ở đó, lakkhaṇaṃ (đặc tính) là đặc tính của màu đen, đỏ, lốm đốm, v.v. được rõ ràng “con bò này là của người kia”.
Evaṃ saṅkhāropi paññāyati sabhāvato upadhārentassa uppādalakkhaṇampi uppādāvatthāti katvā.
"Thus, a conditioned phenomenon is also discerned" by one who observes its nature, even by taking the characteristic of origination as the state of origination.
Evaṃ saṅkhāropi paññāyati (tương tự, hữu vi cũng được nhận biết) đối với người quán sát theo bản chất, ngay cả đặc tính sinh khởi cũng là trạng thái sinh khởi.
Kālasaṅkhātoti uppajjamānakālasaṅkhāto.
"Designated as time" means designated as the time of arising.
Kālasaṅkhāto (được gọi là thời gian) nghĩa là được gọi là thời gian sinh khởi.
Tassa saṅkhārassa.
"Its" conditioned phenomenon's.
Tassa (của hữu vi đó).
Khaṇopīti uppādakkhaṇopi paññāyati.
"Even the moment" means even the moment of origination is discerned.
Khaṇopī (ngay cả sát-na) nghĩa là ngay cả sát-na sinh khởi cũng được nhận biết.
Uppādopīti uppādalakkhaṇopi.
"Even origination" means even the characteristic of origination.
Uppādopī (ngay cả sự sinh khởi) nghĩa là ngay cả đặc tính sinh khởi.
Jarālakkhaṇanti uppannajīraṇalakkhaṇaṃ, taṃ ‘‘ṭhitassa aññathatta’’nti vuttaṃ.
"The characteristic of decay" means the characteristic of being decayed after arising; this is what is called "the alteration of that which endures."
Jarālakkhaṇaṃ (đặc tính già) là đặc tính của sự sinh khởi và hoại diệt, điều đó được gọi là “sự thay đổi của cái đang tồn tại”.
‘‘Bhaṅgakkhaṇe saṅkhāropi taṃlakkhaṇampi kālasaṅkhāto tassa khaṇopi paññāyatī’’ti pāṭho.
The reading is: "At the moment of dissolution, the conditioned phenomenon, its characteristic, its designated time, and its moment are also discerned."
Văn bản là “trong sát-na hoại diệt, hữu vi đó và đặc tính đó và sát-na đó được gọi là thời gian cũng được nhận biết”.
Keci pana ‘‘jarāpī’’ti padampettha pakkhipanti.
However, some insert the word "decay" here as well.
Một số người thêm từ “jarāpī” (ngay cả sự già) vào đây.
Evañca vadanti ‘‘na hi tasmiṃ khaṇe taruṇo hutvā saṅkhāro bhijjati, atha kho jiyyamāno mahallako viya jiṇṇo eva hutvā bhijjatī’’ti, bhaṅgeneva pana jarā abhibhuyyati khaṇassa atiittarabhāvato na sakkā paññāpetuṃ ṭhitiyāti tesaṃ adhippāyo.
And they say: "For a conditioned phenomenon does not break up by being young at that moment, but rather it breaks up as it decays, like an old person, having become decrepit." But their intention is that decay is overcome by dissolution itself, and it is not possible to discern it due to the extremely fleeting nature of the moment of endurance.
Và họ nói như thế này: “Hữu vi không hoại diệt khi còn non trẻ trong sát-na đó, mà nó hoại diệt khi đã già yếu như một người lớn tuổi”, nhưng ý của họ là sự già bị che khuất bởi sự hoại diệt do sát-na quá ngắn ngủi, không thể nhận biết được sự tồn tại.
Tānīti arūpadhammānaṃ tīṇi lakkhaṇāni.
"These" are the three characteristics of non-material phenomena.
Tānī (những điều đó) là ba đặc tính của các pháp vô sắc.
Atthikkhaṇanti arūpadhammavijjamānakkhaṇaṃ, uppādakkhaṇanti adhippāyo.
"The moment of existence" means the moment of the presence of non-material phenomena, which is the moment of origination.
Atthikkhaṇaṃ (sát-na tồn tại) là sát-na hiện hữu của các pháp vô sắc, ý là sát-na sinh khởi.
Sabbadhammānanti sabbesaṃ rūpārūpadhammānaṃ ṭhitiyā na bhavitabbaṃ.
"Of all phenomena" means that all phenomena, both material and non-material, should not have endurance.
Sabbadhammānaṃ (của tất cả các pháp) nghĩa là tất cả các pháp sắc và vô sắc không nên có sự tồn tại.
Tassevāti tassā eva ṭhitiyā.
"Of that very thing" means of that very endurance.
Tassevā (của chính điều đó) nghĩa là của chính sự tồn tại đó.
Tamatthanti jarālakkhaṇassa paññāpetuṃ asakkuṇeyyabhāvaṃ.
"That meaning" means the inability to discern the characteristic of decay.
Tamatthaṃ (nghĩa đó) là sự không thể nhận biết được đặc tính già.
Aññe pana ‘‘santativasena ṭhānaṃ ṭhitī’’ti vadanti, tayidaṃ akāraṇaṃ aṭṭhānaṃ.
Others, however, say, "Endurance is persistence in the mode of continuity," but this is an incorrect and unsuitable statement.
Những người khác nói “sự tồn tại là sự đứng yên theo dòng tương tục”, điều này là vô lý, không đúng chỗ.
Yasmā sutte ‘‘ṭhitassa aññathattaṃ paññāyatī’’ti uppādavayehi nibbisesena ṭhitiyā jotitattā.
"Because in the Sutta," "the alteration of that which endures is discerned" illuminates endurance without distinction from origination and cessation.
Yasmā sutte (vì trong kinh) “ṭhitassa aññathattaṃ paññāyatī” (sự thay đổi của cái đang tồn tại được nhận biết) đã làm rõ sự tồn tại không khác biệt với sinh và diệt.
Yaṃ panettha vattabbaṃ, taṃ heṭṭhā vuttameva.
Whatever is to be said here has already been stated below.
Điều cần nói ở đây đã được nói ở dưới.
Apica yathā dhammassa uppādāvatthāya bhinnā bhaṅgāvatthā icchitā, aññathā uppajjamānameva bhijjatīti āpajjati, evaṃ bhaṅgāvatthāyapi bhinnā bhaṅgābhimukhāvatthā icchitabbā.
Moreover, just as for the arising state of a phenomenon, a distinct dissolving state is desired, otherwise it would lead to the conclusion that it dissolves even as it arises; similarly, even for the dissolving state, a distinct state approaching dissolution should be desired.
Hơn nữa, cũng như trạng thái hoại diệt được mong muốn là khác biệt với trạng thái sinh khởi của pháp, nếu không sẽ dẫn đến việc cái đang sinh khởi lại hoại diệt ngay lập tức, thì trạng thái sắp hoại diệt cũng được mong muốn là khác biệt với trạng thái hoại diệt.
Na hi abhaṅgābhimukho bhijjati.
For what is not approaching dissolution does not dissolve.
Quả thật không có cái gì hoại diệt mà không hướng đến sự hoại diệt.
Na cettha sakkā uppādābhimukhāvatthaṃ parikappetuṃ tadā tassa aladdhattalābhattā.
And here it is not possible to conceive of a state approaching origination, since at that time it has not yet obtained existence.
Và ở đây không thể giả định trạng thái hướng đến sự sinh khởi, vì lúc đó nó chưa đạt được sự hiện hữu.
Ayaṃ visesoti ṭhitikkhaṇo nāma rūpadhammānaṃyeva, na arūpadhammānanti ayaṃ īdiso viseso.
"This distinction" means that the moment of endurance belongs only to material phenomena, not to non-material phenomena; this is such a distinction.
Ayaṃ viseso (đây là sự khác biệt) nghĩa là sát-na tồn tại chỉ thuộc về các pháp sắc, không thuộc về các pháp vô sắc, đây là sự khác biệt như vậy.
Ācariyamati nāma tasseva ācariyassa mati, sā sabbadubbalāti āha ‘‘tasmā’’tiādi.
"The teacher's view" is the view of that teacher himself, which is completely weak, therefore he says, "therefore," and so on.
Ācariyamati (ý kiến của vị thầy) nghĩa là ý kiến của chính vị thầy đó, điều đó là yếu kém nhất, nên (văn bản) nói “tasmā” (do đó), v.v.
39-42. Apāyadukkhe sakalasaṃsāradukkhe ca patituṃ adatvā dhāraṇaṭṭhena dhammo, maggaphalanibbānāni.
39-42. Dhamma means the path, fruition, and Nibbāna, in the sense that it supports one by not allowing one to fall into the suffering of the lower realms and the suffering of the entire round of existence.
39-42. Pháp là điều giữ gìn (người tu tập) không cho rơi vào khổ cảnh và tất cả khổ luân hồi, đó là Đạo, Quả và Nibbāna.
Tadanulomikā cassa pubbabhāgapaṭipadāti āha ‘‘dhammānudhammapaṭipannassā’’tiādi.
And the preliminary practice conducive to it is said, "for one who practices in accordance with the Dhamma."
Và sự thực hành sơ khởi phù hợp với điều đó, nên (văn bản) nói “dhammānudhammapaṭipannassā” (của người thực hành đúng pháp và tùy pháp), v.v.
‘‘Nibbidābahulo’’ti aṭṭhakathāyaṃ paduddhāro kato, pāḷiyaṃ pana ‘‘nibbidābahulaṃ vihareyyā’’ti āgataṃ.
"Abounding in disenchantment" is a textual extraction in the Aṭṭhakathā, but in the Pali Canon, it appears as "should dwell abounding in disenchantment."
“Nibbidābahulo” (nhiều nhàm chán) là một cụm từ được trích dẫn trong Chú giải, nhưng trong Pāḷi thì là “nibbidābahulaṃ vihareyyā” (nên sống với nhiều nhàm chán).
Ukkaṇṭhanabahuloti sabbabhavesu ukkaṇṭhanabahulo.
"Abounding in weariness" means abounding in weariness towards all existences.
Ukkaṇṭhanabahulo (nhiều chán nản) nghĩa là nhiều chán nản đối với tất cả các cõi hữu.
Tīhi pariññāhīti ñātatīraṇappahānapariññāhi.
"By three kinds of full understanding" means by the full understanding of knowing, investigation, and abandonment.
Tīhi pariññāhi (bằng ba sự liễu tri) nghĩa là bằng sự liễu tri nhận biết, liễu tri thẩm sát, liễu tri đoạn trừ.
Parijānātīti tebhūmakadhamme paricchijja jānāti, vipassanaṃ ussukkāpeti.
"He fully understands" means he knows by discerning the phenomena of the three realms; he stimulates insight.
Parijānātī (liễu tri) nghĩa là biết rõ các pháp ba cõi bằng cách phân định, thúc đẩy tuệ quán.
Parimuccati sabbasaṃkilesato ‘‘maggo pavattito parimuccatī’’ti vuttattā.
"He is liberated" from all defilements, as it is said, "the path being established, he is liberated."
Parimuccati (được giải thoát) khỏi tất cả các phiền não, vì đã nói “Đạo được thực hành, được giải thoát”.
Tathāti iminā ito paresu tīsu maggo hotīti dasseti.
"Thus" indicates that the path exists in the next three suttas.
Tathā (như vậy) chỉ ra rằng Đạo có trong ba (kinh) tiếp theo từ đây.
Idhāti imasmiṃ sutte.
"Here" means in this sutta.
Idhā (ở đây) nghĩa là trong kinh này.
Aniyamitāti aggahitā.
"Undetermined" means not specified.
Aniyamitā (không cố định) nghĩa là không được nắm giữ.
Tesu niyamitā ‘‘aniccānupassī’’tiādivacanato.
"Determined in those" because of the statement "contemplating impermanence," and so on.
Tesu niyamitā (được cố định trong những điều đó) vì câu “aniccānupassī” (quán vô thường), v.v.
Sāti anupassanā.
"That" refers to contemplation.
Sā (sự quán sát đó).
Tattha niyamitavasenevāti idaṃ lakkhaṇavacanaṃ yathā ‘‘yadi me byādhayo bhaveyyuṃ, dātabbamidamosadha’’nti.
"Determined in that way" is a characteristic statement, just as in "If I were to have diseases, this medicine should be given."
Tattha niyamitavasenevā (chỉ theo cách cố định ở đó) câu này là một câu chỉ đặc tính, như “nếu tôi có bệnh, đây là thuốc phải dùng”.
Na hi sakkā etissā eva anupassanāya vasena sammasanācāraṃ matthakaṃ pāpetunti.
For it is not possible to bring the practice of comprehension to its culmination solely by means of this contemplation.
Thật vậy, không thể hoàn thành hành vi quán sát chỉ theo sự quán sát này.
43. Dvīhi bhāgehi āpo ettha gatāti dīpo, dīpo viyāti dīpo oghehi anajjhottharanīyatāya.
43. An island (dīpa) is where water goes by two parts (surrounding it), or an island is like an island because it cannot be overwhelmed by floods.
43. Nước đã đến đây bởi hai phần, nên gọi là dīpa (đảo). Giống như một hòn đảo vì không bị lũ lụt nhấn chìm.
Yo paro na hoti, so attā, idha pana dhammo adhippeto.
That which is not other is the self (attā); but here, the Dhamma is intended.
Cái gì không phải người khác, đó là attā (tự ngã), nhưng ở đây ý nói đến Dhamma.
Attā dīpo etesanti attadīpā.
For whom the self is an island, thus attadīpā.
Cái gì có tự ngã là dīpa (hòn đảo) của họ, nên gọi là attadīpā.
Paṭisaraṇattho dīpaṭṭhoti āha – ‘‘attasaraṇāti idaṃ tasseva vevacana’’nti.
Since "dīpa" has the meaning of a refuge, it is said – "attasaraṇā is a synonym for that very meaning".
Nghĩa của dīpa là nơi nương tựa, nên nói: “attasaraṇāti idaṃ tasseva vevacana” (nói ‘attasaraṇa’ là đồng nghĩa với điều đó).
Lokiyalokuttaro dhammo attā nāma ekantanāthabhāvato.
The self (attā) is the mundane and supramundane Dhamma because it is an absolute protector.
Pháp thế gian và siêu thế được gọi là attā vì là nơi nương tựa tuyệt đối.
Paṭhamena padena vutto eva attho dutiyapadena vuccatīti vuttaṃ ‘‘tenevāhā’’tiādi.
Since the meaning expressed by the first term is also expressed by the second term, it is said "that is why he said..." and so on.
Nghĩa đã được nói bằng từ đầu tiên, cũng được nói bằng từ thứ hai, nên nói “tenevāhā” (do đó đã nói) v.v….
Yavati etasmā phalaṃ pasavatīti yoni, kāraṇaṃ.
That from which a result is produced is the yoni, the cause.
Từ điều này mà quả sinh ra, nên gọi là yoni (nguồn gốc), tức là nguyên nhân.
Kiṃ pabhuti uppattiṭṭhānaṃ etesanti kiṃ pabhutikā.
From what do these originate? Thus, kiṃ pabhutikā (of what origin).
Cái gì có sự sinh khởi từ đâu, đó là kiṃ pabhutikā (có nguồn gốc từ đâu).
Pahānadassanatthaṃ āraddhaṃ.
It is begun to show relinquishment.
Được bắt đầu để chỉ ra sự đoạn trừ.
Tenevāha ‘‘pubbe ceva…pe… te pahīyantī’’ti.
Therefore, he said, "previously... these are abandoned".
Do đó đã nói “pubbe ceva…pe… te pahīyantī” (trước đây…v.v… chúng bị đoạn trừ).
Na paritassati taṇhāparittāsassa abhāvato.
Does not tremble due to the absence of the trembling of craving.
Na paritassati (không bị kinh hoàng) vì không có sự kinh hoàng do ái dục.
Vipassanaṅgenāti vipassanāsaṅkhātena kāraṇena.
By the factor of vipassanā means by the cause known as vipassanā.
Vipassanaṅgenāti (bằng chi phần tuệ quán) tức là bằng nguyên nhân được gọi là tuệ quán.
44. Sabhāvatosanto vijjamāno kāyo rūpādidhammasamūhoti sakkāyoti āha – ‘‘sakkāyo dukkha’’nti.
44. The existing body (kāya), which is composed of material and other phenomena, is sakkāya (existing body); therefore, it is said, "sakkāya is suffering".
44. Thân thể tồn tại một cách tự nhiên, tức là tập hợp các pháp sắc v.v…, nên gọi là sakkāyo (thân kiến), do đó đã nói: “sakkāyo dukkha” (thân kiến là khổ).
Diṭṭhi eva samanupassanā, diṭṭhisahitā vā samanupassanā diṭṭhisamanupassanā, diṭṭhimaññanāya saddhiṃ itaramaññanā.
Seeing (diṭṭhi) itself is samanupassanā, or seeing accompanied by views is diṭṭhisamanupassanā, an assumption along with the assumption of views.
Chính kiến chấp là quán sát, hoặc quán sát đi kèm với kiến chấp là diṭṭhisamanupassanā (kiến chấp quán sát), tức là sự chấp thủ khác đi kèm với kiến chấp chấp thủ.
Saha vipassanāya catumaggañāṇaṃ samanupassanā ‘‘catunnaṃ ariyasaccānaṃ sammadeva anurūpato passanā’’ti katvā.
The knowledge of the four paths together with vipassanā is samanupassanā by stating "the correct and appropriate seeing of the Four Noble Truths".
Tứ đạo trí đi kèm với tuệ quán là samanupassanā (quán sát), vì “quan sát đúng đắn bốn Thánh đế một cách tương ứng”.
45. Virāgo nāma maggo, vimuttiphalanti āha – ‘‘maggakkhaṇe virajjati, phalakkhaṇe vimuccatī’’ti.
45. Virāga is the path, vimutti is the fruit; therefore, it is said, "one becomes dispassionate at the moment of the path, and is liberated at the moment of the fruit".
45. Ly tham là đạo, giải thoát là quả, nên nói: “maggakkhaṇe virajjati, phalakkhaṇe vimuccatī” (vào sát-na đạo thì ly tham, vào sát-na quả thì giải thoát).
Aggahetvāti evaṃ nirujjhamānehi āsavehi ‘‘ahaṃ mamā’’ti kañci dhammaṃ anādiyitvā.
Without grasping means without grasping any phenomenon with "I" and "mine" regarding the defilements that are thus ceasing.
Aggahetvā (không chấp thủ) tức là không chấp thủ bất kỳ pháp nào là “tôi” hay “của tôi” đối với các lậu hoặc đang diệt như vậy.
‘‘Cittaṃ virattaṃ, vimuttaṃ hotī’’ti vuttattā phalaṃ gayhati, ‘‘khīṇā jātī’’tiādinā paccavekkhaṇāti āha ‘‘saha phalena paccavekkhaṇadassanattha’’nti.
Since it is said, "the mind becomes dispassionate, liberated," the fruit is taken; by "birth is destroyed," and so on, it is a reviewing; therefore, it is said, "to show the reviewing together with the fruit".
Vì đã nói “tâm ly tham, được giải thoát”, nên quả được chấp nhận, và sự quán xét “sự sinh đã tận” v.v… nên nói “saha phalena paccavekkhaṇadassanattha” (để chỉ ra sự quán xét cùng với quả).
Upari kattabbakiccābhāvena ṭhitaṃ.
Remaining due to the absence of further tasks to be done.
Ṭhitaṃ (đứng vững) vì không còn việc gì phải làm nữa.
Tenāha ‘‘vimuttattā ṭhita’’nti.
Therefore, he said, "remains due to liberation".
Do đó đã nói “vimuttattā ṭhita” (đứng vững vì đã giải thoát).
Yaṃ pattabbaṃ, taṃ aggaphalassa pattabhāvena adhigatattā santuṭṭhaṃ parituṭṭhaṃ.
That which is to be attained, being attained as the supreme fruit, is santuṭṭhaṃ (content), perfectly satisfied.
Cái gì pattabbaṃ (cần đạt được), cái đó santuṭṭhaṃ (hài lòng), tức là hoàn toàn hài lòng vì đã đạt được pattabhāvena (trạng thái đạt được) của quả tối thượng.
46. Pubbantaṃ atītakhandhakoṭṭhāsaṃ.
46. Pubbantaṃ (the past end) refers to the past aggregates.
46. Pubbantaṃ (quá khứ) là phần uẩn quá khứ.
Anugatāti sassatādīni kappetvā gahaṇavasena anugatā.
Anugatā (followed) means followed by assuming eternalism and so on.
Anugatā (đi theo) tức là đi theo bằng cách chấp thủ, tưởng tượng các kiến chấp thường còn v.v….
Aṭṭhārasa diṭṭhiyoti catasso sassatadiṭṭhiyo, catasso ekaccasassatadiṭṭhiyo, catasso antānantikadiṭṭhiyo, catasso amarāvikkhepadiṭṭhiyo, dve adhiccasamuppannadiṭṭhiyoti evaṃ aṭṭhārasa diṭṭhiyo na honti paccayaghātena.
Eighteen views means the four eternalist views, the four semi-eternal views, the four views of finitude and infinitude, the four views of equivocation, and the two views of fortuitous origination; thus, these eighteen views do not exist due to the destruction of their causes.
Aṭṭhārasa diṭṭhiyo (mười tám tà kiến) tức là bốn kiến chấp thường còn, bốn kiến chấp một phần thường còn, bốn kiến chấp hữu biên vô biên, bốn kiến chấp hoài nghi, hai kiến chấp vô nhân sinh – như vậy mười tám kiến chấp không tồn tại do sự đoạn diệt các duyên.
Aparantanti anāgataṃ khandhakoṭṭhāsaṃ sassatādibhāvaṃ kappetvā gahaṇavasena anugatā.
Aparantaṃ (the future end) refers to the future aggregates, followed by assuming eternalism and so on.
Aparantaṃ (vị lai) là phần uẩn vị lai, đi theo bằng cách chấp thủ, tưởng tượng trạng thái thường còn v.v….
Soḷasa saññīvādā, aṭṭha asaññīvādā, aṭṭha nevasaññīnāsaññīvādā, satta ucchedavādā, pañca paramadiṭṭhadhammanibbānavādāti evaṃ catucattālīsa diṭṭhiyo na honti paccayaghātena.
The sixteen views of percipients, the eight views of non-percipients, the eight views of neither-percipients-nor-non-percipients, the seven annihilationist views, and the five views of Nibbāna directly seen in this life; thus, forty-four views do not exist due to the destruction of their causes.
Mười sáu thuyết hữu tưởng, tám thuyết vô tưởng, tám thuyết phi hữu tưởng phi vô tưởng, bảy thuyết đoạn diệt, năm thuyết Niết-bàn hiện tại tối thượng – như vậy bốn mươi bốn tà kiến không tồn tại do sự đoạn diệt các duyên.
Sassata diṭṭhithāmaso ceva sīlabbata diṭṭhiparāmāso ca na hoti paccayaghātena.
Neither the grasping of eternalist views nor the grasping of views concerning rules and observances exists due to the destruction of their causes.
Kiến chấp thường còn và sự chấp thủ kiến chấp giới cấm thủ cũng không tồn tại do sự đoạn diệt các duyên.
Tenāha ‘‘ettāvatā paṭhamamaggo dassito’’ti anavasesadiṭṭhipahānakittanato.
Therefore, he said, "thus the first path is shown" by extolling the complete abandonment of views.
Do đó đã nói “ettāvatā paṭhamamaggo dassito” (đến đây đã chỉ ra sơ đạo) vì đã nói về sự đoạn trừ tất cả các kiến chấp còn sót lại.
Pahīnā vikkhambhitā.
Pahīnā (abandoned) means suppressed.
Pahīnā (đã đoạn trừ) tức là đã trấn áp.
Idaṃ panāti ‘‘rūpasmi’’ntiādi.
This also refers to "in matter" and so on.
Idaṃ panāti (nhưng điều này) tức là “trong sắc” v.v….
Ārammaṇanti kammaviññāṇassa ārammaṇaṃ.
Ārammaṇaṃ (object) is the object of kamma-consciousness.
Ārammaṇaṃ (đối tượng) tức là đối tượng của nghiệp thức.
Mānavasena ca diṭṭhivasena ca ‘‘asmī’’ti gāhe sijjhante taṃsahagatā taṇhāpi taggahitāva hotīti vuttaṃ ‘‘taṇhāmānadiṭṭhivasena asmīti evampissa hotī’’ti.
When the grasping of "I am" succeeds through pride and views, the craving associated with it is also grasped by it; thus, it is said, "through craving, pride, and views, one also thinks 'I am'".
Khi sự chấp thủ “tôi là” thành công bằng cách kiêu mạn và kiến chấp, thì ái dục đi kèm với nó cũng được bao gồm trong đó, nên nói “taṇhāmānadiṭṭhivasena asmīti evampissa hotī” (do đó, bằng cách ái, mạn và kiến chấp, người ấy cũng có ý niệm ‘tôi là’ như vậy).
Gahetvāti ahaṃkāravatthuvasena gahetvā.
Having grasped means having grasped by way of the object of egoism.
Gahetvāti (chấp thủ) tức là chấp thủ theo đối tượng của ngã mạn.
Ayaṃ ahamasmīti ayaṃ cakkhādiko, sukhādiko vā ahamasmi.
Ayaṃ ahamasmi (I am this) means "this eye and so on, or this happiness and so on, I am."
Ayaṃ ahamasmīti (cái này là tôi) tức là cái nhãn v.v… này, hoặc cái lạc v.v… này là tôi.
‘‘Rūpī attā arogo paraṃ maraṇā’’ti evamādigahaṇavasena pavattanato vuttaṃ ‘‘rūpī bhavissantiādīni sabbāni sassatameva bhajantī’’ti.
Since it proceeds by way of grasping such as "the self, possessed of form, is healthy after death," it is said, "all these, such as 'will be possessed of form,' cling to eternalism".
Vì sự chấp thủ như “tự ngã có sắc là vô bệnh sau khi chết” v.v… mà phát sinh, nên nói “rūpī bhavissantiādīni sabbāni sassatameva bhajantī” (tất cả những điều như ‘sẽ có sắc’ v.v… đều thuộc về thường còn).
Vipassanābhinivesato pubbe yathevākārāni pañcindriyāni, atha vipassanābhinivesato paraṃ tenevākārena ṭhitesu cakkhādīsu indriyesu avijjā pahīyati vipassanaṃ vaḍḍhaetvā maggassa uppādanena, atha maggaparamparāya arahattamaggavijjā uppajjati.
Just as the five faculties were before the application of vipassanā, then after the application of vipassanā, ignorance is abandoned in those faculties such as the eye, which remain in the same way, by developing vipassanā and producing the path; then, through the succession of paths, the knowledge of the Arahant path arises.
Trước khi chuyên tâm vào tuệ quán, năm căn như thế nào, atha (sau đó), sau khi chuyên tâm vào tuệ quán, tenevākārena ṭhitesu (khi các căn) nhãn v.v… vẫn giữ nguyên như vậy, avijjā pahīyati (vô minh bị đoạn trừ) bằng cách phát triển tuệ quán để sinh ra đạo, sau đó, theo dòng đạo, arahattamaggavijjā uppajjati (minh của A-la-hán đạo sinh khởi).
Taṇhāmānadiṭṭhiyo kammasambhārabhāvato.
Craving, pride, and views are the components of kamma.
Ái, mạn, kiến chấp là yếu tố của nghiệp.
Kammassa…pe… eko sandhīti hetuphalasandhi.
Of kamma... one connection refers to the connection of cause and effect.
Kammassa…pe… eko sandhī (nghiệp… v.v… một sự nối kết) tức là sự nối kết nhân quả.
Puna eko sandhīti phalahetusandhimāha.
Again, one connection refers to the connection of effect and cause.
Puna eko sandhī (lại một sự nối kết) tức là nói về sự nối kết quả nhân.
Tayo papañcā atīto addhā atītabhavaaddhānaṃ tesaṃ adhippetattā.
The three proliferation-past periods refer to the past periods of existence, as they are intended.
Tayo papañcā atīto addhā (ba hý luận là thời quá khứ) vì ý nói đến thời gian của các kiếp quá khứ.
Anāgatassa paccayo dassito assutavato puthujjanassa vasena.
The cause of the future is shown from the perspective of an uninstructed ordinary person.
Anāgatassa paccayo dassito (duyên của vị lai đã được chỉ ra) theo nghĩa của phàm phu chưa từng nghe pháp.
Sutavato pana ariyasāvakassa vasena vaṭṭassa vūpasamo dassitoti.
However, from the perspective of an instructed noble disciple, the cessation of the cycle of rebirth is shown.
Còn theo nghĩa của Thánh đệ tử đã từng nghe pháp, sự chấm dứt của vòng luân hồi đã được chỉ ra.
48. Tathevāti ārammaṇabhāveneva.
48. In the same way means merely as an object.
48. Tathevāti (cũng vậy) tức là chỉ theo nghĩa đối tượng.
Ārammaṇakaraṇavasena upādānehi upādātabbanti upādāniyaṃ.
That which is to be clung to by way of making it an object of clinging is upādāniyaṃ.
Cái gì cần được chấp thủ bởi các thủ, theo nghĩa làm đối tượng, đó là upādāniyaṃ (đối tượng của chấp thủ).
Idhāpīti upādānakkhandhesupi.
Here also refers to the aggregates of clinging.
Idhāpīti (cũng ở đây) tức là ngay cả trong các thủ uẩn.
Vibhāgatthe gayhamāne aniṭṭhappasaṅgopi siyā, abhidhamme ca rāsaṭṭho eva āgato, ‘‘tadekajjhaṃ abhisaṃyuhitvā’’ti vacanato ‘‘rāsaṭṭhena’’icceva vuttaṃ.
If taken in the sense of division, an undesirable implication might arise, and in Abhidhamma, it is taken in the sense of accumulation; from the saying "having brought together into one," it is stated "in the sense of accumulation".
Nếu chấp thủ theo nghĩa phân chia, thì có thể có sự liên quan đến điều không mong muốn, và trong Vi Diệu Pháp, nghĩa tập hợp đã được trình bày, theo lời “tập hợp tất cả lại thành một”, nên chỉ nói “rāsaṭṭhena” (theo nghĩa tập hợp).
51-52. Navamadasamesūti suttadvayaṃ saheva uddhaṭaṃ, dvīsupi atthavaṇṇanāya sarikkhabhāvato.
51-52. In the ninth and tenth suttas, the two suttas are brought forth together because their explanations of meaning are similar.
51-52. Navamadasamesūti (trong kinh thứ chín và thứ mười) hai kinh đã được trích dẫn cùng lúc, vì sự chú giải nghĩa của cả hai đều tương tự nhau.
Nandanaṭṭhena nandī, rañjanaṭṭhena rāgo.
Nandī (delight) is in the sense of delighting; rāgo (lust) is in the sense of coloring.
Nandī (hỷ) theo nghĩa vui thích, rāgo (tham) theo nghĩa say đắm.
Satipi saddatthato bhede ‘‘imesaṃ atthato ninnānākaraṇatāyā’’ti vatvāpi pahāyakadhammabhedena pana labbhateva bhedamattāti dassetuṃ ‘‘nibbidānupassanāya vā’’tiādi vuttaṃ.
Even though there is a difference in literal meaning, having said "by their non-diversification in meaning," it is indeed possible to obtain a mere difference based on the distinction of states to be abandoned, to show this, "or by the contemplation of disenchantment" and so on was stated.
Mặc dù có sự khác biệt về ý nghĩa ngữ pháp, nhưng để chỉ ra rằng “những điều này không khác biệt về ý nghĩa” và rằng sự khác biệt chỉ có thể đạt được qua sự khác biệt của các pháp cần đoạn trừ, nên đã nói “hoặc bằng quán niệm sự nhàm chán” (nibbidānupassanāya vā) v.v...
Virajjanto rāgaṃ pajahatīti sambandho.
"Being dispassionate, one abandons lust" – this is the connection.
Liên quan đến việc “người ly tham đoạn trừ tham ái.”
Ettāvatāti ‘‘nandikkhayā rāgakkhayo’’ti ettāvatā.
"To this extent" refers to "With the destruction of delight, there is the destruction of lust."
Ettāvatā (đến mức này) có nghĩa là “sự diệt trừ hỷ là sự diệt trừ tham ái” (nandikkhayā rāgakkhayo) đến mức này.
Vipassanaṃ niṭṭhapetvā vipassanākiccassa pariyosānena.
"Having completed vipassanā" means by the conclusion of the vipassanā function.
Vipassanaṃ niṭṭhapetvā (hoàn tất thiền quán) có nghĩa là sự kết thúc của công việc thiền quán.
Rāgakkhayāti vuṭṭhānagāminipariyosānāya vipassanāya rāgassa khepitattā.
"Destruction of lust" is due to lust being extinguished by vipassanā that culminates in emergence.
Rāgakkhayā (sự diệt trừ tham ái) là do tham ái đã được diệt trừ bằng thiền quán dẫn đến sự xuất ly, khi thiền quán đạt đến giai đoạn cuối.
Anantaraṃ uppannena ariyamaggena samucchedavasena nandikkhayoti.
"Destruction of delight" is by way of eradication through the Noble Path that arises immediately thereafter.
Nandikkhayo (sự diệt trừ hỷ) là do Thánh đạo phát sinh ngay sau đó, theo cách đoạn tận.
Tenāha ‘‘idha maggaṃ dassetvā’’ti.
Therefore, it is said, "here, showing the path."
Vì vậy, đã nói “ở đây chỉ ra con đường (magga).”
Anantaraṃ pana uppannena ariyaphalena paṭipassaddhivasena nandirāgakkhayā sabbaṃ saṃkilesato cittaṃ vimuccatīti.
But immediately thereafter, by way of tranquilization through the Noble Fruition that has arisen, "with the destruction of delight and lust, the mind is freed from all defilements."
Nandirāgakkhayā (sự diệt trừ hỷ và tham ái) là do Thánh quả phát sinh ngay sau đó, theo cách an tịnh, nhờ đó tâm được giải thoát khỏi tất cả phiền não.
Tenāha ‘‘phalaṃ dassita’’nti.
Therefore, it is said, "the fruition is shown."
Vì vậy, đã nói “quả (phala) đã được chỉ ra.”
53. Upetīti upayo.
That which approaches is upaya.
53. Upeti (trói buộc) là upayo (sự trói buộc).
Kathamupeti?
How does it approach?
Trói buộc như thế nào?
Taṇhāmānādivasenāti āha ‘‘taṇhāmānadiṭṭhivasenā’’ti.
It is said, "by way of craving, conceit, views, and so on."
Đã nói “theo cách tham ái, ngã mạn v.v...” (taṇhāmānadiṭṭhivasenā).
Kathamidaṃ labbhatīti?
How is this understood?
Điều này được hiểu như thế nào?
‘‘Avimutto’’ti vacanato.
From the statement, "unliberated."
Từ lời nói “chưa được giải thoát” (avimutto).
Taṇhādiṭṭhivasena hi baddho, kiṃ upetīti āha ‘‘pañcakkhandhe’’ti tabbinimuttassa tathā upetassa abhāvato.
Indeed, one is bound by craving and views; what does it approach? It is said, "the five aggregates," because there is no such approaching being apart from them.
Vì bị trói buộc bởi tham ái, tà kiến v.v..., thì trói buộc cái gì? Đã nói “năm uẩn” (pañcakkhandhe) vì không có cái gì khác ngoài chúng được trói buộc như vậy.
Ko panupetīti?
Who, then, approaches?
Vậy ai trói buộc?
Taṃsamaṅgīpuggalo.
The individual endowed with them.
Người có những điều đó.
Taṇhādiṭṭhivasena upagamassa vuttattā viññāṇanti akusalakammaviññāṇamevāti vadanti.
Since the approaching by way of craving and views is stated, they say "consciousness" refers only to unwholesome kamma-consciousness.
Vì đã nói về sự trói buộc theo cách tham ái, tà kiến, nên họ nói rằng thức (viññāṇa) chỉ là thức nghiệp bất thiện.
Javāpetvāti gahitajavaṃ katvā.
"Having made it swift" means having made it take its course.
Javāpetvā (khiến cho nhanh chóng) có nghĩa là tạo ra sự nhanh chóng đã được nắm giữ.
Yathā paṭisandhiṃ ākaḍḍhituṃ samatthaṃ, evaṃ katvā.
Having made it capable of drawing forth rebirth-linking, thus.
Khiến cho có khả năng kéo theo sự tái sinh.
Tenāha ‘‘paṭisandhī’’tiādi.
Therefore, it is said, "rebirth-linking" and so on.
Vì vậy, đã nói “sự tái sinh” (paṭisandhī) v.v...
Aggahaṇe kāraṇaṃ vuttameva ‘‘okaṃ pahāya aniketasārī’’ti gāthāya vissajjane.
"The reason for not grasping has been stated" in the explanation of the verse, "abandoning the abode, wandering homeless."
Lý do không nắm giữ (aggahaṇe kāraṇaṃ) đã được nói trong phần giải thích bài kệ “okaṃ pahāya aniketasārī” (từ bỏ nơi trú ngụ, sống không nhà).
Kammanimittādivasena paṭisandhiyā paccayabhūtaṃ ārammaṇaṃ paṭisandhijanakassa kammassa vasena vocchijjati.
The object that is a condition for rebirth-linking, by way of kamma-sign and so on, is cut off by reason of the kamma that generates rebirth-linking.
Đối tượng (ārammaṇaṃ) là nhân duyên cho sự tái sinh theo cách nghiệp tướng v.v... bị đoạn diệt (vocchijjati) theo nghiệp tạo ra sự tái sinh.
Patiṭṭhā na hoti sarāgakāle viya anupaṭṭhānato.
There is no standing (patiṭṭhā na hoti) because it does not arise, unlike in the time of attachment.
Không có chỗ trú (patiṭṭhā na hoti) vì không hiện hữu như trong thời kỳ còn tham ái.
Appatiṭṭhitaṃ viññāṇaṃ vuttappakārena.
Unsupported (appatiṭṭhitaṃ) consciousness is as stated above.
Thức không có chỗ trú (appatiṭṭhitaṃ viññāṇaṃ) theo cách đã nói.
Anabhisaṅkharitvāti anuppādetvā paccayaghātena.
"Not generating" means not producing, by the destruction of conditions.
Anabhisaṅkharitvā (không tạo tác) có nghĩa là không làm phát sinh do sự diệt trừ nhân duyên.
54. Bījajātānīti jāta-saddo padapūraṇamattanti āha ‘‘bījānī’’ti.
"Seeds" (bījajātāni); the word jāta is merely a filler, so it is said, "seeds."
54. Bījajātāni (các loại hạt giống), từ jāta chỉ là để bổ nghĩa, nên đã nói “các hạt giống” (bījānī).
Vacanti setavacaṃ.
"Wattle" (vaca) means white wattle.
Vaca (hạt giống) là hạt giống mè trắng.
Ajjukanti tacchakaṃ.
"Straight" (ajjukaṃ) means straightener.
Ajjuka (hạt giống) là hạt giống thạch tùng.
Phaṇijjakaṃ tulasi.
"Fennel" (phaṇijjakaṃ) is tulasi.
Phaṇijjakaṃ là cây húng quế.
Abhinnānīti ekadesenapi akhaṇḍitāni.
"Undamaged" (abhinnāni) means not broken even in a single part.
Abhinnānī (không bị hư hại) có nghĩa là không bị sứt mẻ dù chỉ một phần nhỏ.
Bījatthāyāti bījakiccāya.
"For the purpose of seeds" (bījatthāya) means for the function of seeds.
Bījatthāya (cho mục đích hạt giống) có nghĩa là cho công việc của hạt giống.
Na upakappatīti paccayo na hotīti dasseti.
"It does not serve" shows that it is not a condition.
Na upakappatī (không có ích) có nghĩa là không trở thành nhân duyên.
Na pāpitānīti pūtitaṃ na upagatāni.
"Not rotted" means not having reached putrefaction.
Na pāpitānī (không bị thối rữa) có nghĩa là không bị hư hỏng.
Taṇḍulasārassa ādānato sārādāni.
Those that take the essence of rice grains are essence-takers.
Sārādāni (lấy tinh túy) là do lấy tinh túy của gạo.
Ārammaṇaggahaṇavasena viññāṇaṃ tiṭṭhati etthāti viññāṇaṭṭhitiyo.
"Consciousness-stations" (viññāṇaṭṭhitiyo) are where consciousness stands by way of grasping an object.
Viññāṇaṭṭhitiyo (các chỗ trú của thức) là nơi thức trú ngụ theo cách nắm giữ đối tượng.
Ārammaṇavasenāti ārammaṇabhāvavasena.
"By way of an object" means by being an object.
Ārammaṇavasenā (theo cách đối tượng) có nghĩa là theo cách là đối tượng.
Sinehanaṭṭhenāti taṇhāyanavasena siniddhatāpādanena, yato ‘‘nandūpasecana’’nti vuttaṃ.
"By means of moistening" means by rendering it moist through craving, since it is said, "moistened by delight."
Sinehanaṭṭhenā (theo nghĩa làm cho ẩm ướt) có nghĩa là làm cho trơn tru theo cách tham ái, vì đã nói “nandūpasecana” (được tưới tẩm bằng hỷ).
Tathā hi viropitaṃ taṃ kammaviññāṇaṃ paṭisandhiaṅkuruppādanasamatthaṃ hoti.
For thus, that kamma-consciousness, being planted, becomes capable of producing the sprout of rebirth-linking.
Như vậy, thức nghiệp đã được gieo trồng đó có khả năng làm phát sinh mầm tái sinh.
Sappaccayanti avijjāayonisonamanasikārādipaccayehi sappaccayaṃ.
"Conditioned" means conditioned by ignorance, unwise attention, and so on.
Sappaccayaṃ (có nhân duyên) có nghĩa là có nhân duyên do vô minh, tác ý không như lý v.v...
Viruhati vipākasantānuppādanasamattho hutvā.
"It grows" means becoming capable of producing the continuum of results.
Viruhati (phát triển) có nghĩa là trở nên có khả năng làm phát sinh sự tiếp nối của quả báo.
55. Udānaṃ udāharīti attamanavācaṃ nicchāresi.
"Expressed a solemn utterance" (udānaṃ udāharī) means uttered words of joy.
55. Udānaṃ udāharī (thốt lên lời cảm hứng) có nghĩa là phát ra lời hoan hỷ.
Esa vuttappakāro udāhāro.
"This" refers to the solemn utterance as stated.
Esa (lời cảm hứng) là lời cảm hứng đã nói trên.
Bhuso nissayo upanissayo, dānameva upanissayo dānūpanissayo.
Strong support is upanissaya; donation itself as upanissaya is dānūpanissayo.
Nissaya (nương tựa) rất mạnh là upanissaya (nhân duyên mạnh mẽ), bố thí chính là upanissaya thì gọi là dānūpanissayo (nhân duyên mạnh mẽ từ bố thí).
Esa nayo sesesupi.
The same method applies to the rest.
Phương pháp này cũng áp dụng cho các trường hợp còn lại.
Tattha dānūpanissayo annādivatthūsu balavāti balavabhāvena hoti, tasmā upanissayabahulo kāmarāgappahāneneva kataparicayattā vipassanamanuyuñjanto na cirasseva anāgāmiphalaṃ pāpuṇāti, tathā suvisuddhasīlūpanissayo kāmadosajigucchanena.
Among these, dānūpanissaya is strong with respect to food and other requisites; thus, being abundant in upanissaya, one who practices vipassanā, having become acquainted with the abandonment of sensual lust, attains the Anāgāmi fruit without delay. Similarly, a very pure sīlūpanissaya by disdaining sensual desires and ill-will.
Trong đó, dānūpanissayo (nhân duyên mạnh mẽ từ bố thí) trở nên mạnh mẽ trong các vật phẩm như thức ăn v.v..., do đó, người có nhiều nhân duyên mạnh mẽ này, đã quen thuộc với việc đoạn trừ dục tham, khi thực hành thiền quán sẽ nhanh chóng đạt được quả Bất Lai. Tương tự, người có sīlūpanissayo (nhân duyên mạnh mẽ từ giới) rất thanh tịnh sẽ ghê tởm tham ái và sân hận.
Yadi evaṃ kasmā ime dve upanissayā dubbalāti vuttā?
If so, why are these two upanissayas called weak?
Nếu vậy, tại sao hai nhân duyên mạnh mẽ này lại được gọi là yếu kém?
Vijjūpamaññāṇasseva paccayabhāvato.
Because they are conditions only for lightning-like knowledge.
Vì chúng chỉ là nhân duyên cho trí tuệ như chớp (vijjūpamaññāṇa).
Sopi bhāvanūpanissayasahāyalābheneva, na kevalaṃ.
And that too is only by obtaining the aid of bhāvanūpanissaya, not by itself.
Và trí tuệ đó cũng chỉ đạt được nhờ sự hỗ trợ của bhāvanūpanissaya (nhân duyên mạnh mẽ từ tu tập), không phải chỉ riêng nó.
Bhāvanā pana paṭivedhassa visesahetubhāvato balavā upanissayo.
But bhāvanā is a strong upanissaya because it is a special cause for penetration.
Tuy nhiên, bhāvanā (tu tập) là nhân duyên mạnh mẽ vì nó là nguyên nhân đặc biệt cho sự thể nhập (paṭivedha).
Tathā hi sā vajirūpamañāṇassa visesapaccayo.
For thus, it is a special condition for diamond-like knowledge.
Như vậy, nó là nhân duyên đặc biệt cho trí tuệ như kim cương (vajirūpamañāṇa).
Tenāha ‘‘bhāvanūpanissayo arahattaṃ pāpetī’’ti.
Therefore, it is said, "bhāvanūpanissaya leads to arahantship."
Vì vậy, đã nói “bhāvanūpanissayo (nhân duyên mạnh mẽ từ tu tập) dẫn đến A-la-hán quả.”
Soti milakatthero.
"He" refers to the Elder Miḷaka.
So (vị ấy) là trưởng lão Milaka.
Vihāranti vasanaṭṭhānaṃ.
"Dwelling" (vihāraṃ) means a place of residence.
Vihāraṃ (tu viện) là nơi ở.
Vihārapaccante hi paṇṇasālāya thero viharati.
Indeed, the Elder dwells in a leaf-hut at the edge of the dwelling place.
Trưởng lão sống trong một tịnh xá ở rìa tu viện.
Upaṭṭhāti ekalakkhaṇena.
"Appears" (upaṭṭhāti) with a single characteristic.
Upaṭṭhāti (hiện hữu) với một đặc điểm.
Kūṭagoṇo viya gamanavīthiṃ.
"Like a wild ox" (kūṭagoṇo viya) on a path of travel.
Kūṭagoṇo viya (như con bò đực đầu đàn) trên con đường đi.
Tatthāti allakaṭṭharāsimhi.
"There" refers to the pile of wet wood.
Tatthā (ở đó) trên đống củi ướt.
Udakamaṇikānanti udakathevānaṃ.
"Drops of water" means drops of water.
Udakamaṇikānaṃ (những giọt nước) là những giọt nước.
Attaniyeva upanesi udānakathāya vuttadhammānaṃ paripuṇṇānaṃ attani saṃvijjamānattā.
He applied to himself because the teachings mentioned in the udāna story were fully present in himself.
Attaniyeva upanesi (áp dụng cho chính mình) vì những pháp đã nói trong lời cảm hứng đều hiện hữu đầy đủ trong chính mình.
Tenāha ‘‘uṭṭhānavatā’’tiādi.
Therefore, it is said, "being diligent" and so on.
Vì vậy, đã nói “uṭṭhānavatā” (người có sự nỗ lực) v.v...
Ayañhi milakatthero sikkhāya gāravo sappatisso vattapaṭivattaṃ pūrento visuddhasīlo hutvā ṭhito, tasmā ‘‘dubbalūpanissaye’’ti vuttaṃ.
Indeed, this Elder Miḷaka, reverent and respectful in training, fulfilling duties and counter-duties, remained with pure sīla; therefore, it is said, "weak upanissayas."
Vị trưởng lão Milaka này kính trọng giới luật, giữ gìn bổn phận và hành vi, trở nên thanh tịnh về giới, vì vậy đã nói “dubbalūpanissaye” (nhân duyên yếu kém).
Tenāha bhagavā udānento ‘‘no cassaṃ…pe… saññojanānī’’ti.
Therefore, the Blessed One uttered the udāna, "If I were not... the fetters."
Vì vậy, Thế Tôn đã thốt lên lời cảm hứng: “Nếu ta không có... (pe)... các kiết sử.”
Sace ahaṃ na bhaveyyanti yadi ahaṃ nāma koci na bhaveyyaṃ tādisassa ahaṃsaddavacanīyassa kassaci atthassa abhāvato.
"If I were not" (sace ahaṃ na bhaveyyaṃ) means if there were no such thing as "I," due to the non-existence of any entity that could be designated by the word "I."
Sace ahaṃ na bhaveyyaṃ (nếu ta không hiện hữu) có nghĩa là nếu không có cái gọi là “ta,” vì không có bất kỳ thực thể nào có thể được gọi bằng từ “ta” như vậy.
Tato eva mama parikkhāropi na bhaveyyatassa ca pabhaṅgubhāvena anavaṭṭhitabhāvato.
Then "my requisites would also not exist" (eva mama parikkhāropi na bhaveyya), due to their perishable and impermanent nature.
Từ đó, eva mama parikkhāropi na bhaveyya (thì vật dụng của ta cũng không hiện hữu) vì sự tan rã và không ổn định của chúng.
Evaṃ attuddesikabhāvena padadvayassa atthaṃ vatvā idāni kammaphalavasena vattuṃ ‘‘sace vā panā’’tiādi vuttaṃ.
Thus, having explained the meaning of the two terms in an egocentric way, now, to speak by way of kamma and its results, "or if it were" and so on was stated.
Sau khi giải thích ý nghĩa của hai từ này theo cách tự quy chiếu, bây giờ để nói theo cách nghiệp quả, đã nói “sace vā panā” (hoặc nếu) v.v...
Atītapaccuppannavasena suññataṃ dassetvā idāni paccuppannānāgatavasena taṃ dassento ‘‘idāni panā’’tiādi vuttaṃ.
Having shown emptiness by way of past and present, now, showing it by way of present and future, "now then" and so on was stated.
Sau khi chỉ ra tính không (suññatā) theo cách quá khứ và hiện tại, bây giờ để chỉ ra nó theo cách hiện tại và vị lai, đã nói “idāni panā” (bây giờ thì) v.v...
Evaṃ adhimuccantoti edisaṃ adhimuttiṃ pavattento.
"Thus being resolved" (evaṃ adhimuccanto) means setting forth such a resolve.
Evaṃ adhimuccanto (người quyết định như vậy) có nghĩa là người thực hành sự quyết định như thế.
Vibhavissatīti vinassissati.
"Will vanish" (vibhavissatī) means will perish.
Vibhavissatī (sẽ biến mất) có nghĩa là sẽ bị hủy diệt.
Vibhavo hi vināso.
For vibhava is perishing.
Vibhavo (sự biến mất) chính là sự hủy diệt.
Tenāha ‘‘bhijjissatī’’ti.
Therefore, it is said, "will break up."
Vì vậy, đã nói “bhijjissatī” (sẽ tan rã).
Vibhavadassanaṃ vibhavoti uttarapadalopena vuttanti āha ‘‘vibhavadassanenā’’ti.
"Seeing destruction" is expressed as vibhavo by ellipsis of the latter part of the compound, thus it is said, "by seeing destruction."
Vibhavadassanaṃ (sự thấy sự biến mất) được nói bằng cách lược bỏ từ cuối, nên đã nói “vibhavadassanenā” (bằng sự thấy sự biến mất).
Vibhavadassanaṃ nāma accantāya vināsassa dassanaṃ.
"Seeing destruction" means seeing absolute destruction.
Vibhavadassanaṃ nāma (sự thấy sự biến mất) có nghĩa là sự thấy sự hủy diệt hoàn toàn.
Tanti ariyamaggaṃ.
"That" refers to the Noble Path.
Taṃ (điều đó) là Thánh đạo.
Sāmaññajotanā hesā visesaniṭṭhā hotīti tatiyamaggavasena attho veditabbo.
This is a general indication that culminates in a specific conclusion, so the meaning should be understood by way of the third path.
Đây là một sự chỉ ra chung, nhưng nó kết thúc ở một điểm cụ thể, vì vậy ý nghĩa phải được hiểu theo Thánh đạo thứ ba.
Upari maggaphalanti aggamaggaphalaṃ.
"Higher path-fruit" means the highest path-fruit.
Upari maggaphalaṃ (quả đạo cao hơn) là quả đạo tối thượng.
Natthi etissā jātiyā antaranti anantarā, anantarā vipassanā maggassa.
There is no interval in this birth, therefore anantarā, immediate vipassanā for the path.
Không có khoảng cách giữa sự phát sinh này (jātiyā antaraṃ) nên là anantarā (không gián đoạn), thiền quán không gián đoạn với đạo.
Gotrabhū pana anulomavīthipariyāpannattā vipassanāgatikaṃ vā siyā, nibbānārammaṇattā maggagatikaṃ vāti na tena maggo antariko nāma hoti.
Gotrabhū, however, being included in the course of consecutive thoughts, might be considered belonging to vipassanā, or it might be considered belonging to the path because its object is Nibbāna, so the path is not interrupted by it.
Tuy nhiên, Gotrabhū (chuyển tộc trí) thuộc về tiến trình thuận hành (anulomavīthi), nên có thể thuộc về thiền quán hoặc thuộc về đạo do có Niết Bàn làm đối tượng, vì vậy đạo không bị gián đoạn bởi nó.
Tenāha ‘‘vipassanā maggassa āsannānantaraṃ nāmā’’ti.
Therefore, it is said, "vipassanā is called immediate and proximate to the path."
Vì vậy, đã nói “vipassanā maggassa āsannānantaraṃ nāmā” (thiền quán được gọi là không gián đoạn gần với đạo).
Phalaṃ pana nibbānārammaṇattā kilesānaṃ pajahanavasena pavattanato lokuttarabhāvato ca kammamaggagatikameva, kusalavipākabhāvena pana nesaṃ attho pabhedoti vipassanāya phalassa siyā anantaratāti vuttaṃ ‘‘phalassa dūrānantaraṃ nāmā’’ti.
The fruit, however, being aimed at Nibbāna, arising through the abandoning of defilements, and being supramundane, is merely of the nature of the path of action. But in terms of their wholesome resultant state, its meaning is a distinction. Thus, it is said concerning the fruit of insight (vipassanā) that it might be 'not far away' (anantara), as in "what is meant by 'far or not far from the fruit'".
Tuy nhiên, quả (phala) là sự vận hành theo con đường của nghiệp (kammamaggagati), do có Niết Bàn làm đối tượng (nibbānārammaṇa), do vận hành theo cách từ bỏ các phiền não (kilesa), và do có tính chất siêu thế (lokuttara). Nhưng ý nghĩa của chúng là sự phân biệt theo trạng thái quả thiện (kusalavipāka). Do đó, đã nói rằng quả có thể là vô gián với tuệ quán (vipassanā) là ‘‘quả có tên là vô gián xa’’.
‘‘Āsavānaṃ khayo’’ti pana aggamagge vuccamāne vipassanānaṃ āsannatāya vattabbameva natthi.
However, when "the destruction of the taints" (āsavānaṃ khayo) is spoken of on the highest path, there is nothing to be said regarding the nearness of insights (vipassanā).
Nhưng khi nói ‘‘sự đoạn tận các lậu hoặc (āsava)’’ trong đạo tối thượng (aggamagga), thì không có gì để nói về sự gần gũi của các tuệ quán (vipassanā).
Atasitāyeti na tasitabbe tāsaṃ anāpajjitabbe.
Atasitāya means not to be terrified, not to experience fear.
Atasitāya (không sợ hãi) nghĩa là không nên sợ hãi, không nên rơi vào sự sợ hãi.
Tāsoti tāsahetu ‘‘tasati etasmā’’ti katvā.
Tāso (fear) is that from which one is terrified, hence it is the cause of terror.
Tāso (sự sợ hãi) là nguyên nhân của sợ hãi, do từ đó mà ‘‘sợ hãi’’.
Soti assutavā puthujjano.
So refers to the uninstructed ordinary person (assutavā puthujjano).
So (người ấy) là phàm phu (puthujjana) không học hỏi.
Tilakkhaṇāhatanti aniccatādilakkhaṇattayalakkhitaṃ.
Tilakkhaṇāhataṃ means marked by the three characteristics of impermanence (aniccatā) and so forth.
Tilakkhaṇāhataṃ (bị ba tướng đánh) nghĩa là bị ba tướng vô thường (aniccatā) v.v... chi phối.
Manamhi naṭṭhoti īsakaṃ naṭṭhomhi, tato parampi tattheva ṭhatvā kiñci apūritattā eva muttoti adhippāyo.
Manamhi naṭṭho means "I was slightly lost in my mind"; the intention is that having remained there without accomplishing anything further, one is then freed.
Manamhi naṭṭho (mất trong tâm) nghĩa là đã mất một chút, ý muốn nói rằng sau đó cũng ở nguyên đó và không hoàn thành được gì nên đã được giải thoát.
‘‘Na tāso nāma hotī’’ti vatvā tassa atāsabhāvaṃ dassetuṃ ‘‘na hī’’tiādi vuttaṃ.
Having said "there is no terror," the phrase "for indeed..." and so on, is stated to show the state of being without terror.
Sau khi nói ‘‘không có sự sợ hãi nào’’, để chỉ ra trạng thái không sợ hãi của người ấy, đã nói ‘‘na hī’’ (quả thật không) v.v...
Kalyāṇaputhujjano hi bhayatupaṭṭhānañāṇena ‘‘sabhayā saṅkhārā’’ti vipassanto na uttasati.
For indeed, a noble ordinary person (kalyāṇaputhujjano), perceiving "conditioned phenomena (saṅkhārā) are frightful" with the knowledge of the manifestation of fear (bhayatupaṭṭhānañāṇa), does not tremble.
Quả thật, một phàm phu thiện lành (kalyāṇaputhujjana) khi quán chiếu bằng trí tuệ về sự hiện hữu của nỗi sợ hãi, rằng ‘‘các hành (saṅkhāra) đều đáng sợ’’, thì không hề lo sợ.
56. Catunnaṃ parivaṭṭanavasenāti paccekakkhandhesu catunnaṃ ariyasaccānaṃ parivaṭṭanavasena.
56. Catunnaṃ parivaṭṭanavasenā means by way of the fourfold rotation of the Noble Truths in each of the aggregates (khandhas).
56. Catunnaṃ parivaṭṭanavasenā (theo cách xoay chuyển bốn) nghĩa là theo cách xoay chuyển Tứ Diệu Đế (ariyasacca) trong từng uẩn (khandha).
Rūpaṃ abbhaññāsinti sakalabhūtupādārūpaṃ kucchitabhāvato tattha ca tucchavipallāsatāya ‘‘dukkhasacca’’nti abhivisiṭṭhena ñāṇena aññāsiṃ paṭivijjhiṃ.
Rūpaṃ abbhaññāsiṃ means "I directly knew (aññāsiṃ) and penetrated with highly distinguished knowledge the entire realm of physical formations (bhūtupādārūpa) as the truth of suffering (dukkhasacca) due to its repellent nature and the voidness of perversion within it."
Rūpaṃ abbhaññāsiṃ (tôi đã thắng tri sắc) nghĩa là tôi đã thắng tri, đã thấu hiểu bằng trí tuệ đặc biệt rằng toàn bộ sắc được chấp thủ (bhūtupādārūpa) là ‘‘khổ đế (dukkhasacca)’’ do bản chất đáng ghê tởm của nó và do sự biến hoại trống rỗng trong đó.
Āhāravasena rūpakāyassa hānivuddhādīnaṃ pākaṭabhāvato visesapaccayato ca tassa ‘‘āhārasamudayā’’ti vuttaṃ.
It is stated "āhārasamudayā" (from the origin of nutriment) for the body of form (rūpakāya) because of the evident nature of its decline, growth, etc., by way of nutriment, and also due to its specific condition.
Do sự hiển lộ của sự suy giảm, tăng trưởng v.v... của thân sắc (rūpakāya) theo cách thức của vật thực (āhāra), và do là nhân duyên đặc biệt, nên đã nói ‘‘āhārasamudayā’’ (do sự tập khởi của vật thực).
Dukkhasamudayakathā nāma vaṭṭakathāti ‘‘sacchandarāgo’’ti visesetvā vuttaṃ.
The discourse on the origin of suffering (dukkhasamudayakathā) is a discourse on the cycle of existence (vaṭṭakathā), hence it is specifically stated as "sacchandarāgo" (with sensual passion).
Lời nói về Khổ tập (dukkhasamudaya) là lời nói về luân hồi (vaṭṭakathā), nên đã nói đặc biệt ‘‘sacchandarāgo’’ (có dục tham).
Chandarāgaggahaṇena ca upādānakammāvijjāpi gahitā eva.
By the inclusion of chandarāga (sensual passion), clinging (upādāna), kamma, and ignorance (avijjā) are also indeed included.
Và việc nắm giữ chandarāga (dục tham) cũng bao gồm cả chấp thủ (upādāna), nghiệp (kamma) và vô minh (avijjā).
Paṭipannā hontīti attho.
The meaning is: they paṭipannā (practise) or have entered upon.
Paṭipannā (đã thực hành) là ý nghĩa.
Vattamānakālappayogo hesa yathā ‘‘kusalaṃ cittaṃ uppannaṃ hotī’’ti.
This is the use of the present tense, just as in "wholesome consciousness arises (uppannaṃ hoti)."
Đây là cách dùng thì hiện tại, giống như ‘‘tâm thiện (kusala citta) đã sanh khởi (uppannaṃ hoti)’’.
Patiṭṭhahantīti patiṭṭhaṃ labhanti.
Patiṭṭhahantī means they attain a foundation (patiṭṭhaṃ labhanti).
Patiṭṭhahantī (được an trú) nghĩa là đạt được sự an trú.
Kevalinoti idha vimuttiguṇena pāripūrīti āha ‘‘sakalino katasabbakiccā’’ti.
Kevalino here means complete through the quality of liberation (vimutti), thus he says "sakalino katasabbakiccā" (complete, all tasks accomplished).
Kevalino (toàn thiện) ở đây là sự viên mãn với phẩm chất giải thoát (vimuttiguṇa), nên đã nói ‘‘sakalino katasabbakiccā’’ (hoàn toàn, đã làm xong mọi việc).
Yena teti yena avasiṭṭhena te asekkhe paññāpentā paññāpeyyuṃ, taṃ nesaṃ vaṭṭaṃ sekkhānaṃ viya natthi paññāpanāya.
Yena te means that by which the Asekha (asekkha) individuals, if they were to be described, would be described; that cycle (vaṭṭaṃ) for their description, unlike that of the Sekhas, does not exist.
Yena te (mà nhờ đó họ) nghĩa là nhờ phần còn lại mà họ có thể chỉ dạy những bậc vô học (asekkha), thì không có sự luân hồi (vaṭṭa) nào để chỉ dạy cho họ như đối với các bậc hữu học (sekkhā).
Vaṭṭanti kāraṇaṃ vaṭṭanaṭṭhena phalassa pavattanaṭṭhena.
Vaṭṭanti kāraṇaṃ means the cause of revolving, in the sense of revolving, in the sense of the arising of the fruit.
Vaṭṭanti kāraṇaṃ (nhân của sự luân hồi) theo nghĩa là sự vận hành, theo nghĩa là sự vận hành của quả.
Asekkhabhūmivāroti asekkhabhūmippavatti.
Asekkhabhūmivāro means the occurrence of the Asekha stage.
Asekkhabhūmivāro (phần về cảnh giới vô học) nghĩa là sự vận hành của cảnh giới vô học.
57. Sattasu okāsesūti rūpapajānanādīsu sattasu okāsesu.
57. Sattasu okāsesu means in the seven instances such as the understanding of form (rūpapajānanādi).
57. Sattasu okāsesu (trong bảy trường hợp) nghĩa là trong bảy trường hợp như sự hiểu biết về sắc (rūpapajānanā) v.v...
Vusitavāsoti vusitaariyavāso.
Vusitavāso means a lived noble life (vusitaariyavāso).
Vusitavāso (đã sống phạm hạnh) nghĩa là đã sống phạm hạnh cao quý (ariya).
Etthāti imasmiṃ uddese.
Ettha means in this exposition.
Etthā (ở đây) nghĩa là trong đoạn này.
Sesaṃ nāma idha vuttāvasesaṃ.
Sesaṃ here means what remains unmentioned.
Sesaṃ (phần còn lại) ở đây là phần còn lại đã nói.
Vuttanayenāti heṭṭhā vuttanayena veditabbaṃ.
Vuttanayenāti it should be understood in the manner stated previously.
Vuttanayenā (theo cách đã nói) nghĩa là cần phải hiểu theo cách đã nói ở dưới.
Ussadanandiyanti ussannaguṇavato tosanaṃ sammodāpanaṃ.
Ussadanandiyaṃ means delighting and gladdening one who is abundant in good qualities.
Ussadanandiyaṃ (sự hoan hỷ dồi dào) nghĩa là sự làm hài lòng, làm vui vẻ một người có phẩm chất dồi dào.
Guṇakittanena palobhanīyaṃ sekkhakalyāṇaputhujjanānaṃ pasāduppādanena.
Palobhanīyaṃ (enticing) by praising their qualities, for the purpose of generating confidence in Sekhas and noble ordinary people.
Palobhanīyaṃ (đáng quyến rũ) bằng cách tán thán phẩm chất, bằng cách tạo ra sự thanh tịnh cho các bậc hữu học (sekkhā) và phàm phu thiện lành (kalyāṇaputhujjana).
Idāni vuttameva atthaṃ pākaṭaṃ kātuṃ ‘‘yathā hī’’tiādi vuttaṃ.
Now, to make the stated meaning clear, "yathā hi" and so on is stated.
Bây giờ, để làm rõ ý nghĩa đã nói, đã nói ‘‘yathā hī’’ (như thế nào) v.v...
Ettāvatāti pañcannaṃ khandhānaṃ vasena sattasu ṭhānesu kosalladīpanena ettakena desanākkamena.
Ettāvatā means by this much method of teaching, by the exposition of skillfulness in seven instances based on the five aggregates.
Ettāvatā (đến chừng đó) nghĩa là bằng cách trình bày sự khéo léo trong bảy trường hợp theo năm uẩn (khandha), bằng cách thuyết giảng đến chừng mực này.
Tanti ārammaṇaṃ.
Taṃ means that object (ārammaṇaṃ).
Taṃ (điều đó) là đối tượng (ārammaṇa).
Dhātuādimattamevāti dhātāyatanapaṭiccasamuppādamattameva.
Dhātuādimattamevāti means merely the elements (dhātu), sense bases (āyatana), and dependent origination (paṭiccasamuppāda).
Dhātuādimattamevā (chỉ là yếu tố v.v...) nghĩa là chỉ là các giới (dhātu), xứ (āyatana) và duyên khởi (paṭiccasamuppāda).
Imesu dhammesūti imesu jātādīsu.
Imesu dhammesu means in these phenomena such as birth (jāti) and so forth.
Imesu dhammesu (trong các pháp này) nghĩa là trong các pháp sanh (jāti) v.v... này.
Kammaṃ katvāti sammasanakammaṃ niṭṭhapetvāti attho.
Kammaṃ katvā means having completed the work of discernment (sammasanakammaṃ niṭṭhapetvāti), this is the meaning.
Kammaṃ katvā (sau khi làm nghiệp) nghĩa là sau khi hoàn thành nghiệp quán sát (sammasanakamma).
Evamettha pañcannaṃ khandhānaṃ vasena sattaṭṭhānakosallapavattiyā pabhedena vibhajitvā ‘‘tividhūpaparikkhī’’ti dasseti dhammarājā.
Thus, the King of Dhamma (Dhammarājā) shows here "one who examines in three ways" (tividhūpaparikkhī) by distinguishing the occurrence of skillfulness in seven instances based on the five aggregates.
Như vậy, ở đây, Pháp vương (Dhammarājā) đã phân loại bằng cách trình bày sự khéo léo trong bảy trường hợp theo năm uẩn (khandha), và chỉ ra ‘‘tividhūpaparikkhī’’ (người quán sát ba cách).
58. Adhikaṃ savisesaṃ payasati payuñjati etenāti adhippayāso, visiṭṭhapayogo.
58. That by which one applies or engages in something extra and special is adhippayāso, a distinguished application.
58. Adhippayāso (sự tinh tấn đặc biệt) là sự tinh tấn đặc biệt, sự ứng dụng đặc biệt, vì nhờ đó mà người ta tinh tấn, ứng dụng một cách đặc biệt.
Tenāha ‘‘adhikapayogo’’ti.
Therefore, he says "adhikapayogo" (greater application).
Do đó đã nói ‘‘adhikapayogo’’ (sự tinh tấn vượt trội).
Imañhi magganti aṭṭhaṅgikaṃ ariyamaggamāha.
Imañhi maggaṃ refers to the Noble Eightfold Path (aṭṭhaṅgikaṃ ariyamaggaṃ).
Imañhi maggaṃ (con đường này) nói về Bát Chánh Đạo (aṭṭhaṅgika ariya magga).
Idhāti imasmiṃ sutte.
Idha means in this Sutta.
Idhā (ở đây) nghĩa là trong kinh này.
Avattamānaṭṭhenāti buddhuppādato pubbe na vattamānabhāvena.
Avattamānaṭṭhenāti in the sense of not existing before the arising of a Buddha.
Avattamānaṭṭhenā (theo nghĩa không tồn tại) nghĩa là không tồn tại trước khi Phật xuất hiện.
Maggaṃ jānātīti samudāgamato paṭṭhāya sapubbabhāgaṃ sasambhāravisayaṃ saphalaṃ saudrayaṃ ariyaṃ maggaṃ jānāti avabujjhatīti maggaññū.
Maggaṃ jānātīti means one who knows the path (maggaññū) is one who knows and comprehends the Noble Path, from its origin onwards, including its preliminary stages, its requisites, its scope, its fruits, and its further development.
Maggaṃ jānāti (biết con đường) nghĩa là biết, thấu hiểu con đường cao quý (ariya magga) từ sự tập khởi trở đi, với các phần trước (pubbabhāga), với các điều kiện và đối tượng (sambhāravisaya), với quả (phala), với sự tiếp nối (udraya), nên gọi là maggaññū (người biết con đường).
Vidita nti aññesampi ñātaṃ paṭiladdhaṃ hatthatale āmalakaṃ viya pākaṭaṃ akāsi, tathā katvā desesi.
Viditaṃ means made known (pākaṭaṃ akāsi) and understood by others, as if an āmalaka fruit in the palm of one's hand; having done so, he taught it.
Viditaṃ (đã biết) nghĩa là đã được người khác biết, đã đạt được, như quả xoài trong lòng bàn tay, đã pākaṭaṃ akāsi (làm cho hiển lộ), đã thuyết giảng như vậy.
Amagge parivajjanena magge paṭipattīti tassa maggakusalatā viya amaggakusalatāpi icchitabbāti āha ‘‘magge ca amagge ca kovido’’ti.
Since practice is on the path by avoiding what is not the path, skill in what is not the path is also desirable, just as skill in the path, therefore he says "kovido in the path and the non-path."
Do thực hành trên con đường bằng cách tránh xa con đường sai lạc, nên sự khéo léo về con đường sai lạc cũng được mong muốn như sự khéo léo về con đường chân chính, do đó đã nói ‘‘magge ca amagge ca kovido’’ (thông thạo cả con đường chân chính và con đường sai lạc).
Ahaṃ paṭhamaṃ gatoti ahaṃ paṭhamamaggena samannāgato.
Ahaṃ paṭhamaṃ gato means "I am endowed with the first path."
Ahaṃ paṭhamaṃ gato (tôi đã đi trước) nghĩa là tôi đã thành tựu con đường đầu tiên.
59. Purāṇupaṭṭhāketi pubbe padhānapadahanakāle upaṭṭhākabhūte.
59. Purāṇupaṭṭhāke means those who were attendants previously during the period of striving (padhānapadahanakāle).
59. Purāṇupaṭṭhāke (những người hầu cũ) nghĩa là những người đã từng hầu hạ trong thời gian tu tập khổ hạnh trước đây.
‘‘Avasavattanaṭṭhena assāmikaṭṭhena suññataṭṭhena attapaṭikkhepaṭṭhenā’’ti evaṃ pubbe vuttehi.
Pubbe vuttehi means by those previously stated: in the sense of not being subject to control, in the sense of being without a master, in the sense of emptiness, in the sense of rejecting self.
Pubbe vuttehi (những điều đã nói trước đây) như ‘‘theo nghĩa không tự chủ, theo nghĩa không có chủ, theo nghĩa trống rỗng, theo nghĩa bác bỏ ngã (atta)’’.
Ettakena ṭhānenāti ‘‘rūpaṃ, bhikkhave, anattā’’ti ārabhitvā yāva ‘‘evaṃ me viññāṇaṃ mā ahosī’’ti ettakena suttapadesena.
Ettakena ṭhānenāti by this much of the Sutta passage, beginning with "Form, monks, is not self" (rūpaṃ, bhikkhave, anattā) up to "May this consciousness not be mine" (evaṃ me viññāṇaṃ mā ahosī).
Ettakena ṭhānenā (bằng đoạn này) nghĩa là bằng đoạn kinh từ ‘‘Này các Tỳ-kheo, sắc là vô ngã (rūpaṃ, bhikkhave, anattā)’’ cho đến ‘‘cũng vậy, thức của tôi đã không còn (evaṃ me viññāṇaṃ mā ahosī)’’.
Akathitasseva kathanaṃ uttaraṃ, na kathitassāti vuttaṃ ‘‘tāni dassetvā’’ti.
It is the explanation of what is unsaid that is supplementary, not of what is already said, thus it is stated "having shown those."
Lời nói tiếp theo là nói về điều chưa được nói, không phải điều đã được nói, nên đã nói ‘‘tāni dassetvā’’ (sau khi chỉ ra những điều đó).
Samodhānetvāti sampiṇḍitvā.
Samodhānetvā means having combined.
Samodhānetvā (sau khi tổng hợp) nghĩa là sau khi gom lại.
Vitthārakathāti vitthārato aṭṭhakathā.
Vitthārakathā means an extensive commentary (aṭṭhakathā).
Vitthārakathā (lời nói rộng rãi) nghĩa là chú giải rộng rãi.
Anattalakkhaṇamevāti tabbahulatāya tappadhānatāya ca vuttaṃ.
Anattalakkhaṇamevāti it is stated as such due to its prevalence and predominance.
Anattalakkhaṇamevā (chỉ là tướng vô ngã) đã nói như vậy do sự phổ biến và tính chủ yếu của nó.
Aniccatādīnampi hi tattha taṃdīpanatthameva vuttattā tadeva jeṭṭhaṃ padhānaṃ tathā veneyyajjhāsayato.
Indeed, impermanence (aniccatā) and other characteristics are mentioned there only to illuminate this (non-self); that (non-self) alone is supreme and primary, as it aligns with the disposition of those to be trained.
Quả thật, vô thường (aniccatā) v.v... cũng đã được nói đến ở đó chỉ để làm rõ điều đó, nên đó là điều tối thượng, chủ yếu, và cũng do khuynh hướng của những người có thể được giáo hóa.
62. Niruttiyova niruttipathāti patha-saddena padavaḍḍhanamāha yathā ‘‘bījāniyeva bījajātānī’’ti.
62. Niruttiyova niruttipathā means that the word patha refers to the extension of words, just as "seeds themselves are seed-kinds."
62. Niruttiyova niruttipathā (ngữ nguyên là con đường ngữ nguyên) nghĩa là từ patha (con đường) chỉ sự mở rộng của từ, giống như ‘‘hạt giống là các loại hạt giống (bījāniyeva bījajātānī)’’.
Niruttivasenāti nibbacanavasena.
Niruttivasenāti means by way of etymology.
Niruttivasenā (theo cách ngữ nguyên) nghĩa là theo cách giải thích từ ngữ.
Pathā ca atthānurūpabhāvato.
Pathā ca and paths due to their accordance with the meaning.
Pathā ca (và các con đường) do phù hợp với ý nghĩa.
Tīṇipīti niruttiadhivacanapaññattipathapadāni.
Tīṇipi refers to the three terms: nirutti, adhivacana, and paññattipatha.
Tīṇipī (cả ba) nghĩa là các từ nirutti, adhivacana và paññattipatha.
Tathā hi ‘‘phusatīti phasso’’tiādinā nīharitvā vacanaṃ nirutti, ‘‘sirīvaḍḍhako dhanavaḍḍhako’’tiādinā vacanamattameva adhikāraṃ katvā pavattaṃ adhivacanaṃ, ‘‘takko vitakko’’tiādinā taṃtaṃpakārena ñāpanato paññatti.
Thus, the term derived by means of ‘‘contact is that which contacts’’ and so on is nirutti (etymology); that which proceeds merely by taking the word ‘‘one who increases prosperity, one who increases wealth’’ and so on as its scope is adhivacana (conventional expression); and that which makes known in various ways by means of ‘‘thought, thinking’’ and so on is paññatti (concept).
Chẳng hạn, lời nói được rút ra bằng cách* “chạm xúc là xúc” v.v… là ngữ giải (nirutti); lời nói diễn tiến chỉ lấy lời nói làm chính bằng cách* “tăng trưởng may mắn, tăng trưởng tài sản” v.v… là danh xưng (adhivacana); do sự hiểu biết theo từng cách thức bằng cách* “tư duy, tầm tư” v.v… là chế định (paññatti).
Atha vā taṃtaṃatthappakāsanena nicchitaṃ, niyataṃ vā vacanaṃ nirutti.
Or alternatively, the certain or determined term by revealing various meanings is nirutti.
Hoặc là, lời nói được xác định, được quy định bằng cách hiển bày ý nghĩa đó là ngữ giải (nirutti).
Adhi-saddo uparibhāge, upari vacanaṃ adhivacanaṃ.
The word adhi is in the sense of 'above'; a superior term is adhivacana.
Tiếng “adhi” ở phần trên (nghĩa là “trên”), lời nói ở trên là danh xưng (adhivacana).
Kassa upari?
Above what?
Trên cái gì?
Pakāsetabbassa atthassāti pākaṭoyamattho.
Of the meaning to be revealed. This meaning is clear.
Nghĩa cần được hiển bày – ý nghĩa này là rõ ràng.
Adhīnaṃ vacanaṃ adhivacanaṃ.
A term that is dependent is adhivacana.
Lời nói thuộc về là danh xưng (adhivacana).
Kena adhīnaṃ?
Dependent on what?
Thuộc về bởi cái gì?
Atthena.
On the meaning.
Bởi ý nghĩa.
Atthassa paññāpanatthena paññattīti evaṃ niruttiādipadānaṃ sabbavacanesu pavatti veditabbā.
Thus, the occurrence of the terms nirutti and so on in all expressions, by virtue of making the meaning known, should be understood.
Do ý nghĩa của sự chế định nên là chế định (paññatti) – như vậy, cần phải hiểu sự diễn tiến của các từ ngữ giải v.v… trong tất cả các cách nói.
Aññathā ‘‘phusatīti phasso’’tiādippakārena niddhāraṇavacanānaṃyeva niruttitā, sirivaḍḍhakadhanavaḍḍhakapakārānameva abhilāpanaṃ adhivacanatā.
Otherwise, only terms of determination such as ‘‘contact is that which contacts’’ would be nirutti, and only expressions like ‘‘one who increases prosperity, one who increases wealth’’ would be adhivacana.
Nếu không thì, chỉ những lời nói xác định theo cách thức “chạm xúc là xúc” v.v… mới là ngữ giải; chỉ những cách thức như tăng trưởng may mắn, tăng trưởng tài sản mới là danh xưng.
‘‘Takko vitakko’’ti evaṃpakārānameva ekameva atthaṃ tena tena pakārena ñāpentānaṃ vacanānaṃ paññattitā ca āpajjeyya.
And only terms that make known one single meaning in various ways, such as ‘‘thought, thinking’’, would be paññatti.
Và chỉ những lời nói hiển bày cùng một ý nghĩa theo cách thức này, cách thức kia như “tư duy, tầm tư” v.v… mới trở thành chế định.
Asaṃkiṇṇāti na saṃkiṇṇā.
Asaṃkiṇṇā means not mixed.
Asaṃkiṇṇā (không lẫn lộn) nghĩa là không lẫn lộn.
Tenāha ‘‘avijahitā…pe… achaḍḍitā’’ti.
Therefore, it is said: ‘‘not abandoned...etc....not cast off’’.
Do đó,* đã nói “không từ bỏ… v.v… không loại bỏ”.
Na saṃkīyantīti na saṃkirīyanti, na saṃkīyissanti na saṃkirīyissantīti attho.
Na saṃkīyanti means they are not mixed up; na saṃkīyissanti means they will not be mixed up.
Na saṃkīyanti (không bị lẫn lộn) nghĩa là không bị lẫn lộn; na saṃkīyissanti (sẽ không bị lẫn lộn) là ý nghĩa.
Appaṭikuṭṭhāti na paṭikkhittā.
Appaṭikuṭṭhā means not rejected.
Appaṭikuṭṭhā (không bị bác bỏ) nghĩa là không bị bác bỏ.
Yasmā bhaṅgaṃ atikkantaṃ uppādādi atikkantameva hoti, tasmā vuttaṃ ‘‘bhaṅgamevā’’ti.
Since that which has gone beyond dissolution is indeed that which has gone beyond arising and so on, it is stated ‘‘dissolution itself’’.
Bởi vì cái đã vượt qua sự hoại diệt thì chính là cái đã vượt qua sự sanh khởi v.v…, do đó đã nói “chính là sự hoại diệt”.
Yasmā desantaraṃ saṅkantopi atikkantanti vuccati, tasmā tadābhāvaṃ dassetuṃ ‘‘desantaraṃ asaṅkamitvā’’ti vuttaṃ.
Since that which has moved to another place is also called 'gone beyond', to show the absence of that, it is stated ‘‘without moving to another place’’.
Bởi vì cái đã di chuyển đến nơi khác cũng được gọi là đã vượt qua, do đó đã nói “không di chuyển đến nơi khác” để chỉ sự không có của điều đó.
Yattha yattha hi saṅkhārā uppajjanti, tattha tattheva bhijjanti nirujjhanti vipariṇamanti vināsaṃ āpajjanti.
For wherever saṅkhāras arise, there itself they break up, cease, undergo change, and come to destruction.
Quả thật, các hành sanh khởi ở đâu thì chính ở đó chúng bị hoại diệt, bị diệt trừ, bị biến đổi, đi đến sự tiêu vong.
Tenāha ‘‘vipariṇatanti…pe… naṭṭha’’nti.
Therefore, it is stated ‘‘changed...etc....destroyed’’.
Do đó đã nói “đã biến đổi… v.v… đã hoại diệt”.
Apākaṭībhūtaṃ ajātattā eva.
Apākaṭībhūtaṃ is precisely because it has not arisen.
Apākaṭībhūtaṃ (chưa hiển lộ) là do chưa sanh khởi.
Vasabhaṇagottatāya vassabhaññā.
Due to being of the Gotra of Vasabhaṇa, they are Vassabhaññā.
Do thuộc dòng họ Vassabhaṇa nên là Vassabhaññā.
Mūladiṭṭhigatikāti mūlabhūtā diṭṭhigatikā, imasmiṃ kappe sabbapaṭhamaṃ tādisadiṭṭhisamuppādakā.
Mūladiṭṭhigatikā means those whose views are fundamental; in this eon, they were the very first to produce such views.
Mūladiṭṭhigatikā (những người có tà kiến gốc) nghĩa là những người có tà kiến cơ bản, trong kiếp này là những người đầu tiên sanh khởi tà kiến như vậy.
Punappunaṃ āvajjentassāti ahetuvādapaṭisaṃyuttaganthaṃ uggahetvā pariyāpuṇitvā tadatthaṃ vīmaṃsantassa ‘‘natthi hetu, natthi paccayo sattānaṃ saṃkilesāyā’’tiādinayappavattāya laddhiyā ārammaṇe micchāsati santiṭṭhati, ‘‘natthi hetū’’tiādivasena anussavūpaladdhe atthe tadākāraparivitakkanehi saviggahe viya sarūpato cittassa paccupaṭṭhite cirakālaparicayena ‘‘evameta’’nti nijjhānakkhamabhāvūpagamanena nijjhānakkhantiyā tathāgahite punappunaṃ tatheva āsevantassa bahulīkarontassa micchāvitakkena samādiyamānā micchāvāyāmūpatthambhitā ataṃsabhāvaṃ ‘‘taṃsabhāva’’nti gaṇhantī micchāsatīti laddhanāmā taṃladdhisahagatā taṇhā santiṭṭhati.
Punappunaṃ āvajjentassā means, for one who has learned and mastered texts related to the doctrine of no cause (ahetuvāda) and repeatedly investigates their meaning, the wrong mindfulness becomes established upon the object of the doctrine that proceeds in the manner of ‘‘there is no cause, no condition for the defilement of beings’’ and so on. Through repeatedly cultivating and making much of such perception, which is like a vivid mental apprehension of the meaning perceived by hearsay in the manner of ‘‘there is no cause’’ and so on, and which, through familiarization over a long period, has reached the state of being acceptable to insight, and is thus seized by insight-knowledge—a craving associated with that doctrine, named wrong mindfulness, supported by wrong effort, seizing that which is not its true nature as its true nature, becomes established by means of wrong thought.
Punappunaṃ āvajjentassā (đối với người quán xét lặp đi lặp lại) nghĩa là đối với người đã học thuộc lòng và tinh thông kinh điển liên quan đến thuyết vô nhân, và đang suy xét ý nghĩa của nó, thì tà niệm an trú trên đối tượng của tà kiến diễn tiến theo cách “không có nhân, không có duyên cho sự ô nhiễm của chúng sanh” v.v…; trong ý nghĩa đã được nghe biết theo cách “không có nhân” v.v…, do sự suy tư lặp đi lặp lại về hình thức đó, tâm an trú như thể hiện tiền với hình tướng của nó một cách rõ ràng, do sự quen thuộc lâu dài mà đi đến trạng thái có thể suy xét “sự việc là như vậy”, do sự nhẫn nại trong việc suy xét mà đã chấp thủ như vậy, và do sự thực hành lặp đi lặp lại, thường xuyên như vậy, thì ái (taṇhā) đi kèm với tà kiến đó, được gọi là tà niệm, được chấp thủ bằng tà tầm (micchāvitakka), được hỗ trợ bởi tà tinh tấn (micchāvāyāma), chấp thủ cái không phải là bản chất đó là “bản chất đó”, an trú.
Yathāsakaṃ vitakkādipaccayalābhena tasmiṃ ārammaṇe adhiṭṭhitatāya anekaggataṃ pahāya cittaṃ ekaggataṃ appitaṃ viya hoti micchāsamādhinā.
By receiving their respective conditions such as thought, the mind, having abandoned its scatteredness and become fixed on that object, appears as if concentrated through wrong samādhi.
Tâm, do đạt được các duyên như tầm (vitakka) tùy theo sự thích hợp, từ bỏ trạng thái không nhất tâm, trở nên nhất tâm như thể được an định bằng tà định (micchāsamādhi).
Sopi hi paccayavisesehi laddhabhāvanābalo īdise ṭhāne samādhānapatirūpakiccakaro hotiyeva vālavijjhanādīsu viyāti daṭṭhabbaṃ.
It should be understood that this also, having gained strength through cultivation by specific conditions, performs the function resembling samādhi in such instances, just as in piercing a hair and so on.
Cần phải hiểu rằng, chính tà định đó, do sức mạnh của sự tu tập đã đạt được nhờ các duyên đặc biệt, cũng có thể thực hiện chức năng tương tự như sự an định trong những trường hợp như bắn lông v.v….
Tathā hi anekakkhattuṃ tenākārena pubbabhāgiyesu javanavāresu pavattesu sabbapacchime javanavāre satta javanāni javanti.
Thus, when the initial javana impetuses have occurred many times in that manner, seven javana impetuses occur in the very last javana moment.
Chẳng hạn, khi các sát na tốc hành (javana) đã diễn tiến nhiều lần theo cách thức đó trong các sát na tốc hành thuộc giai đoạn chuẩn bị, thì trong sát na tốc hành cuối cùng, bảy sát na tốc hành diễn ra.
Tattha paṭhame satekiccho hoti, tathā dutiyādīsu.
In the first, it is curable; likewise in the second and so on.
Trong đó, ở sát na đầu tiên, có thể chữa trị được, cũng như ở các sát na thứ hai v.v….
Sattame pana javane sampatte atekiccho hoti.
But upon reaching the seventh javana, it becomes incurable.
Tuy nhiên, khi đạt đến sát na tốc hành thứ bảy, thì không thể chữa trị được.
Tenāha ‘‘assādentassā’’tiādi.
Therefore, it is stated ‘‘for one who savours’’ and so on.
Do đó đã nói “đối với người nếm trải” v.v….
Imesupīti dvīsupi ṭhānesu.
Imesupi means in both these instances.
Imesupi (trong hai điều này) nghĩa là trong cả hai trường hợp.
Paccuppannaṃ vāti ettha iti-saddo ādiattho.
In paccuppannaṃ vā, the word iti means ‘and so on’.
Paccuppannaṃ vā (hoặc hiện tại) – ở đây, từ iti có nghĩa là “v.v…” (adi-attha).
Tena ‘‘yadetaṃ anāgataṃ nāma, nayidaṃ anāgata’’ntiādikaṃ saṅgaṇhāti.
By that, it includes ‘‘what is called the future, that is not the future’’ and so on.
Do đó, nó bao gồm những* như “cái gọi là vị lai này, nó không phải là vị lai” v.v….
Tepīti te vassabhaññāpi na maññiṃsu lokasamaññāya anatikkamanīyato.
Tepi means those Vassabhaññā also na maññiṃsu (did not conceive) because it cannot be surpassed by conventional worldly designation.
Tepī (họ cũng) – những người Vassabhaññā đó cũng na maññiṃsu (không cho rằng) vì không thể vượt qua sự quy ước của thế gian.
Tenāha ‘‘atītaṃ panā’’tiādi.
Therefore, it is stated ‘‘however, the past’’ and so on.
Do đó đã nói “còn quá khứ thì…” v.v….
Khandhānaṃ upari niruḷhā paṇṇatti.
Paññatti is established upon the khandhas.
Paññatti (chế định) được thiết lập trên các uẩn (khandha).
63. Gaṇhamānoti ‘‘etaṃ mamā’’tiādinā gaṇhamāno.
63. Gaṇhamāno means grasping with ‘‘this is mine’’ and so on.
63. Gaṇhamāno (đang chấp giữ) nghĩa là đang chấp giữ bằng cách* “cái này là của tôi” v.v….
Pāsenāti rāgapāsena.
Pāsenā means by the snare of greed.
Pāsenā (bằng sợi dây thòng lọng) nghĩa là bằng sợi dây thòng lọng của tham ái (rāga).
Tañhi māro mārapāsoti maññati.
For Māra considers it to be Māra’s snare.
Ma-ra (Māra) cho rằng đó là sợi dây thòng lọng của Ma-ra.
Tenāha ‘‘antalikkhacaro pāso, yvāyaṃ carati mānaso’’ti (saṃ. ni. 1.151; mahāva. 33).
Therefore, it is said: ‘‘This snare, born of the mind, moves in the sky’’.
Do đó đã nói “sợi dây thòng lọng đi trong không gian, đó là tâm đang đi” (Saṃ. Ni. 1.151; Mahāva. 33).
Mutto nāma hoti anupādiyato sabbaso khandhassa abhāvato.
Mutto nāma hoti (is called liberated) due to the complete absence of the khandha for one who does not cling.
Mutto nāma hoti (được gọi là giải thoát) là do không chấp thủ, do hoàn toàn không có các uẩn.
64-68. ‘‘Etaṃ mamā’’tiādinā.
64-68. ‘‘This is mine’’ and so on.
64-68. “Cái này là của tôi” v.v….
Maññanā abhinandanā ca.
Maññanā (conceiving) and abhinandanā (delighting).
Maññanā abhinandanā (sự cho rằng, sự hoan hỷ) cũng vậy.
Taṇhāchandoti taṇhā eva chando.
Taṇhāchando means craving itself is desire.
Taṇhāchando (dục ái) nghĩa là chính là ái (taṇhā).
Sā hi taṇhāyanaṭṭhena taṇhā, chandikataṭṭhena chando.
For it is taṇhā (craving) in the sense of 'longing', and chando (desire) in the sense of 'being desired'.
Chính ái đó là taṇhā theo nghĩa là sự khao khát, là chanda theo nghĩa là sự ưa thích.
Catutthaṃ aniccalakkhaṇamukhena vuttaṃ, pañcamaṃ dukkhalakkhaṇamukhena, chaṭṭhaṃ anattalakkhaṇamukhena.
The fourth is stated by way of the characteristic of impermanence, the fifth by way of the characteristic of suffering, the sixth by way of the characteristic of non-self.
Kinh thứ tư được nói theo phương diện tướng vô thường (aniccalakkhaṇa), kinh thứ năm theo phương diện tướng khổ (dukkhalakkhaṇa), kinh thứ sáu theo phương diện tướng vô ngã (anattalakkhaṇa).
Sesaṃ tīsupi sadisamevāti vuttaṃ ‘‘eseva nayo’’ti.
The rest are similar in all three, hence it is stated ‘‘the same method applies’’.
Phần còn lại là giống nhau trong cả ba*, do đó đã nói “cách thức cũng như vậy” (eseva nayo).
70-72. Rajanīyenāti rajanīyena rāguppādakena.
70-72. Rajanīyena means by that which causes defilement, that which causes greed to arise.
70-72. Rajanīyenā (bởi cái đáng tham đắm) nghĩa là bởi cái đáng tham đắm, cái sanh khởi tham ái (rāga).
Tenāha ‘‘rāgassa paccayabhāvenā’’ti.
Therefore, it is stated ‘‘as a condition for greed’’.
Do đó đã nói “do là duyên của tham ái”.
Rāhulasaṃyutte rāhulattherassa pucchāvasena āgatā.
In the Rāhulasaṃyutta, they appear in the form of questions by Venerable Rāhula.
Trong Rāhulasaṃyutta (Tương Ưng Rāhula),* đã xuất hiện theo câu hỏi của Trưởng lão Rāhula.
Idha rādhattherassa surādhattherassa ca pucchāvasena, pāḷi pana sabbattha sadisā.
Here, they appear in the form of questions by Venerable Rādha and Venerable Surādha; but the Pali text is the same everywhere.
Ở đây, theo câu hỏi của Trưởng lão Rādha và Trưởng lão Surādha, nhưng bản Pāḷi thì giống nhau ở mọi nơi.
Tenāha ‘‘vuttanayeneva veditabbānī’’ti.
Therefore, it is stated ‘‘they should be understood in the manner already explained’’.
Do đó đã nói “cần phải hiểu theo cách thức đã nói”.
73-75. Catusaccameva kathitaṃ assādādīnañceva samudayādīnañca vasena desanāya pavattattā.
73-75. The Four Noble Truths are explained because the discourse proceeds by way of delight and so on, and by way of origination and so on.
73-75. Catusaccameva kathitaṃ (chỉ có Tứ Diệu Đế được nói đến) là do sự thuyết giảng diễn tiến theo phương diện sự vị ngọt (assāda) v.v… và sự tập khởi (samudaya) v.v….
Yasmā assādo samudayasaccaṃ, ādīnavo dukkhasaccaṃ, nissaraṇaṃ maggasaccaṃ nirodhasaccañcāti vuttovāyamattho; dutiye samudayassādo samudayasaccaṃ, ādīnavo dukkhasaccaṃ, atthaṅgamo nirodhasaccaṃ, nissaraṇaṃ maggasaccanti vuttovāyamattho; tatiyaṃ ariyasāvakasseva vasena vuttaṃ.
This meaning is stated thus: delight is the truth of origination, danger is the truth of suffering, escape is the truth of the path and the truth of cessation; in the second, the delight in origination is the truth of origination, danger is the truth of suffering, disappearance is the truth of cessation, escape is the truth of the path. The third is stated solely in the context of a noble disciple.
Bởi vì ý nghĩa này đã được nói đến: vị ngọt là Tập đế, sự nguy hiểm là Khổ đế, sự xuất ly là Đạo đế và Diệt đế; trong kinh thứ hai, vị ngọt của sự tập khởi là Tập đế, sự nguy hiểm là Khổ đế, sự diệt tận là Diệt đế, sự xuất ly là Đạo đế – ý nghĩa này đã được nói đến; kinh thứ ba được nói theo phương diện của riêng vị Thánh đệ tử.
Tadatthaparidīpanāhīti ‘‘pañcakkhandhe pariññāya.
By the elucidation of its meaning (i.e., of that Sutta), beginning with “Having fully understood the five aggregates,
Bằng những lời giải thích ý nghĩa đó là "sau khi thấu hiểu năm uẩn".
Taṇhā tesaṃ na vijjati.
craving is not found in them.
Ái dục không còn nơi họ.
Asmimāno samucchinno’’tiādinā tassa yathāniddiṭṭhassa suttassa atthadīpanāhi ceva ‘‘anejaṃ te anuppattā, cittaṃ tesaṃ anāvila’’ntiādinā visesatthaparidīpanāhi ca.
The conceit 'I am' is eradicated,” and by elucidations of the meaning of that Sutta as indicated, and by elucidations of specific meanings, beginning with “they have attained non-agitation, their minds are unblemished.”
Ngã mạn đã bị đoạn trừ" v.v., bằng những lời giải thích ý nghĩa của bài kinh đã được chỉ rõ đó, và bằng những lời giải thích ý nghĩa đặc biệt như "Họ đã đạt đến sự vô tham, tâm họ không còn tạp nhiễm" v.v.
Jhānamaggaphalapariyāpannaṃ atisayitasukhaṃ etesamatthīti sukhinoti āha ‘‘jhāna…pe… sukhitā’’ti.
Because supreme happiness, which is included in jhāna, the path, and the fruit, exists for them, it is said that they are happy in “jhāna…etc.…are happy.”
Vì họ có một hạnh phúc siêu việt bao gồm thiền, đạo và quả, nên nói họ là những người hạnh phúc; tức là "thiền... v.v... hạnh phúc".
Taṇhā tesaṃ na vijjatīti ettha tesaṃ apāyadukkhajanikā taṇhā na vijjatīti vuttaṃ.
Here, in “craving is not found in them,” it is said that craving, which generates suffering in the lower realms, is not found in them.
Ở đây, "Ái dục không còn nơi họ" có nghĩa là ái dục gây ra khổ đau trong các cõi đọa không còn nơi họ.
Vaṭṭamūlikāya taṇhāya abhāvā ‘‘nandī tesaṃ na vijjatī’’ti ettha vuccatīti.
Because there is no craving that is the root of Saṃsāra, it is said here, “joy is not found in them.”
Vì không có ái dục là gốc rễ của luân hồi, nên ở đây nói "Hỷ lạc không còn nơi họ".
Imassapīti pi-saddena dukkhassābhāvenapīti dukkhābhāvo viya vaṭṭamūlikataṇhābhāvo sampiṇḍīyatīti daṭṭhabbaṃ.
In “this also”, it should be understood that the word “pi” (also) implies the absence of suffering as well, thus encompassing both the absence of suffering and the absence of craving that is the root of Saṃsāra.
Cả điều này nữa — từ pi (cũng) có nghĩa là sự không có khổ đau cũng như sự không có ái dục là gốc rễ của luân hồi đều được bao hàm.
Tena hi te anupādisesanibbānappattiyā accantasukhitā evāti vuccantīti.
For this reason, it is said that they are indeed supremely happy through the attainment of Nibbāna without remainder.
Do đó, họ được gọi là những người hoàn toàn hạnh phúc vì đã đạt đến Niết Bàn vô dư y.
‘‘Seyyohamasmī’’tiādinayappavattiyā navavidho.
Of nine kinds as expressed in ways such as “‘I am superior’,” etc.
Theo cách thức "Tôi là hơn" v.v., thì chín loại (mạn).
Ñāṇenāti aggamaggaññāṇena.
By knowledge means by the knowledge of the supreme path.
Bằng trí tuệ là bằng trí tuệ của đạo tối thượng.
Nirāsaṅkacāro nāma gahito kutocipi tesaṃ āsaṅkāya abhāvato.
A fearless movement is grasped because there is no apprehension for them from any quarter.
Một hành vi không sợ hãi được chấp nhận vì không có sự sợ hãi nào từ bất cứ đâu đối với họ.
Sammādiṭṭhiādīhi dasahi aṅgehi sammāvimutti-sammāñāṇapariyosānehi.
With the ten factors beginning with right view, culminating in right liberation and right knowledge.
Với mười chi phần bắt đầu từ chánh kiến và kết thúc bằng chánh giải thoát và chánh trí.
‘‘Āguṃ na karotī’’tiādīhi catūhi kāraṇehi.
By the four reasons such as “‘does not commit an offense’,” etc.
Với bốn lý do như "không gây lỗi" v.v.
Taṇhā tesaṃ na vijjatīti idampi taṇhāpahānassa bahūpakāratādassanaṃ.
“ Craving is not found in them” also shows the great benefit of abandoning craving.
"Ái dục không còn nơi họ" cũng là để chỉ ra lợi ích lớn lao của việc đoạn trừ ái dục.
Tenāha ‘‘dāsakārikā taṇhāpi tesaṃ natthī’’ti.
Therefore, it is said, “even craving, which is like a slave-girl, does not exist for them.”
Do đó, nói "ngay cả ái dục như người hầu gái cũng không còn nơi họ".
Uddhaṃ tiriyaṃ apācīnanti ettha ‘‘uddhaṃ vuccatī’’tiādinā rūpamukhena attabhāvaṃ gahetvā pavatto paṭhamanayo.
In “above, across, and down”, the first method of expression is described by taking the individual existence through the aspect of form, such as “‘above’ is said,” etc.
Ở đây, trong "lên trên, ngang qua, xuống dưới", cách thức đầu tiên được trình bày bằng cách lấy tự thân qua hình thái, như "lên trên được gọi là" v.v.
Kālattayavasena dhammappavattiṃ gahetvā pavatto dutiyanayo.
The second method of expression is described by taking the arising of phenomena in terms of the three times.
Cách thức thứ hai được trình bày bằng cách lấy sự vận hành của các pháp theo ba thời gian.
Ṭhānavasena sakalalokadhātuṃ gahetvā pavatto tatiyanayo.
The third method of expression is described by taking the entire world system in terms of location.
Cách thức thứ ba được trình bày bằng cách lấy toàn bộ thế giới theo vị trí.
Buddhāti cattāri saccāni buddhavanto.
Buddhas means those who have understood the four Noble Truths.
Chư Phật là những bậc đã giác ngộ Tứ Diệu Đế.
Sīhanādasamodhānanti sīhanādānaṃ saṃkalanaṃ.
The roar of a lion means the combination of lion’s roars.
Tiếng rống sư tử hòa hợp là sự tổng hợp các tiếng rống sư tử.
Loke attano uttaritarassābhāvā anuttarā.
Unsurpassed because there is no one superior to them in the world.
Vì không có ai cao hơn mình trong thế gian, nên vô thượng.
Uttaro tāva tiṭṭhatu puriso, sadisopi tāva natthīti asadisā.
Unequalled means that a superior person does not exist, and even an equal does not exist.
Hãy để người cao hơn sang một bên, ngay cả người ngang bằng cũng không có, nên không ai sánh bằng.
Sakalampi bhavaṃ uttaritvā bhavapiṭṭhe ṭhatvā vimuttisukhena sukhitattādivasena ekavīsatiyākārehi sīhanādaṃ nadanti.
Standing on the summit of existence by surpassing all existence, they roar a lion’s roar in twenty-one ways, such as by being happy with the happiness of liberation.
Vượt qua tất cả các cõi hữu, đứng trên đỉnh hữu, họ rống tiếng sư tử theo hai mươi mốt cách, chẳng hạn như vì họ hạnh phúc với niềm hạnh phúc giải thoát.
78. Sīhoti parissayasahanato paṭipakkhahananato ca ‘‘sīho’ti laddhanāmo migādhipati.
78. Lion means the king of beasts, known as “lion” due to its endurance of dangers and its vanquishing of adversaries.
78. Sư tử là chúa tể các loài thú, được gọi là "sư tử" vì khả năng chịu đựng nguy hiểm và khả năng tiêu diệt đối thủ.
Cattāroti ca samānepi sīhajātikabhāve vaṇṇavisesādisiddhena visesena cattāro sīhā.
Four refers to the four lions, distinguished by specific characteristics such as differences in color, even though they belong to the same lion species.
Bốn loại là bốn loại sư tử, mặc dù cùng loài sư tử, nhưng có sự khác biệt được xác định bởi màu sắc đặc biệt v.v.
Te idāni nāmato vaṇṇato āhārato dassetvā idhādhippetasīhaṃ nānappakārato vibhāvetuṃ ‘‘tiṇasīho’’tiādi āraddhaṃ.
To show these lions by name, color, and diet, and then to elucidate the lion referred to here in various ways, the passage “grass-lion” etc., is begun.
Để chỉ ra những con sư tử được đề cập ở đây theo nhiều cách khác nhau, sau khi trình bày chúng theo tên, màu sắc và thức ăn, đoạn "sư tử cỏ" v.v. được bắt đầu.
Tiṇabhakkho sīho tiṇasīho purimapade uttarapadalopena yathā ‘‘sākapatthivo’’ti.
A lion that eats grass is a grass-lion, with the elision of the latter part of the compound, like “sākapatthivo” (a king of vegetables).
Sư tử ăn cỏ là sư tử cỏ, với sự lược bỏ hậu tố trong từ đầu tiên, giống như "vua rau" (sākapatthivo).
Kāḷavaṇṇatāya kāḷasīho.
A black lion due to its black color.
Vì có màu đen, nên sư tử đen.
Tathā paṇḍusīho.
Similarly, a pale lion.
Tương tự, sư tử vàng.
Tenāha ‘‘kāḷasīho kāḷagāvisadiso, paṇḍusīho paṇḍupalāsavaṇṇagāvisadiso’’ti.
Therefore, it is said, “A black lion is like a black cow; a pale lion is like a cow the color of a pale leaf.”
Do đó, nói "sư tử đen giống như bò cái đen, sư tử vàng giống như bò cái có màu lá vàng".
Rattakambalassa viya kesaro kesarakalāpo etassa atthīti kesarī.
Kesarī (maned lion) means one that has a mane, a tuft of hair, like a red blanket.
Vì có bờm, tức là một chùm bờm, giống như một tấm chăn đỏ, nên có bờm.
Lākhārasaparikammakatehi viya pādapariyantehīti yojanā.
The phrase should be construed as “with the ends of its paws as if treated with lac-dye.”
Câu nói này có nghĩa là "với các đầu chân như được trang điểm bằng nước sơn mài".
Samasīhoti samajātiko samabhāgo ca sīho.
An equal lion means a lion of equal birth and equal share.
Sư tử bình đẳng là sư tử cùng loài và cùng phần.
Samānosmīti desanāmattaṃ, samappabhāvatāyapi na bhāyati.
“I am equal” is merely a teaching; he does not fear even those of equal power.
Tôi là bình đẳng chỉ là một lời dạy, không sợ hãi ngay cả khi có sức mạnh ngang nhau.
Sakkāyadiṭṭhibalavatāyāti ‘‘ke aññe amhehi uttaritarā, atha kho mayameva mahābalā’’ti evaṃ balātimānanimittāya ahaṅkārahetubhūtāya sakkāyadiṭṭhiyā balabhāvena.
By the strength of sakkāya-diṭṭhi means by the powerful nature of the view of a permanent self, which gives rise to conceit such as, “Who else is superior to us? Indeed, we alone are mighty,” and is the cause of egoism.
Do sức mạnh của tà kiến về thân là do sức mạnh của tà kiến về thân, là nguyên nhân của sự ngã mạn, là nguyên nhân của sự kiêu mạn mạnh mẽ như "Ai hơn chúng ta? Chỉ có chúng ta là mạnh mẽ".
Sakkāyadiṭṭhipahīnattāti sakkāyadiṭṭhiyā pahīnattā nirahaṅkārattā attasinehassa suṭṭhu samugghāṭitattā na bhāyati.
Having abandoned sakkāya-diṭṭhi means because sakkāya-diṭṭhi is abandoned, because there is no egoism, because self-affection is completely uprooted, he does not fear.
Do tà kiến về thân đã bị đoạn trừ là do tà kiến về thân đã bị đoạn trừ, không còn ngã mạn, sự chấp trước vào tự ngã đã bị nhổ tận gốc, nên không sợ hãi.
Katābhinīhārassa lokanāthassa bodhiyā niyatabhāvappattiyā ekantabhāvībuddhabhāvoti katvā ‘‘tīsu pāsādesu nivāsakālo, magadharañño paṭiññādānakālo, pāyāsassa paribhuttakālo’’tiādinā abhisambodhito purimāvatthāpi sīhasadisaṃ katvā dassitā.
Even the pre-enlightenment stages of the World-Savior, who had made a great resolve, are shown to be like a lion, considering his certain attainment of Buddhahood and definite future Buddhahood, as in “the time spent residing in the three palaces, the time of giving a pledge to the king of Magadha, the time of partaking of rice-milk,” etc.
Của vị Thế Tôn đã thực hiện nguyện vọng — vì trạng thái Phật quả chắc chắn đã đạt được sự chắc chắn của giác ngộ, nên trạng thái trước khi giác ngộ cũng được trình bày giống như sư tử, như "thời gian cư trú trong ba cung điện, thời gian hứa với vua Magadha, thời gian thọ dụng cháo sữa" v.v.
Bhāvini, bhūtopacāropi hi lokavohāro.
For indeed, the usage of future events as if they were past is a common worldly expression.
Thật vậy, trong ngôn ngữ thế gian, việc sử dụng quá khứ cho tương lai cũng là một cách nói thông thường.
Vijjābhāvasāmaññato bhūtavijjā itaravijjāpi ekajjhaṃ gahetvā paṭiccasamuppādasammasanato taṃ puretaraṃ siddhaṃ vipākaṃ viya katvā āha ‘‘tisso vijjā visodhetvā’’ti.
By generalizing the state of knowledge, encompassing both acquired knowledge and other knowledge, and by reflecting on dependent co-arising, as if making the previously attained result a reality, it is said, “having purified the three knowledges.”
Do sự tương đồng về sự hiện hữu của minh, sau khi tổng hợp minh đã có và minh khác, và sau khi quán xét Duyên khởi, Ngài nói "sau khi làm thanh tịnh ba minh" như thể quả đã thành tựu trước đó.
Anulomapaṭilomato pavattañāṇavasena ‘‘yamakañāṇamanthanenā’’ti vuttaṃ.
“By the churning of the twin knowledge” is said with reference to the knowledge arising through both direct and reverse order.
Bằng sự khuấy động của song trí được nói đến theo trí tuệ vận hành theo thuận và nghịch.
Tattha viharantassāti ajapālanigrodhamūle viharantassa.
As he was dwelling there means as he was dwelling at the foot of the Ajapāla Banyan tree.
Khi Ngài an trú ở đó là khi Ngài an trú dưới gốc cây Ajapāla Nigrodha.
Ekādasame divaseti sattasattāhato paraṃ ekādasame divase.
On the eleventh day means on the eleventh day after the seven weeks.
Vào ngày thứ mười một là vào ngày thứ mười một sau bảy tuần.
Acalapallaṅketi isipatane dhammacakkapavattanatthaṃ nisinnapallaṅke.
On the unwavering seat means on the seat on which he sat at Isipatana to set in motion the Wheel of Dhamma.
Trên tòa ngồi bất động là trên tòa ngồi để chuyển Pháp luân tại Isipatana.
Tampi hi kenaci appaṭivattiyadhammacakkapavattanatthaṃ nisajjāti katvā vajirāsanaṃ viya acalapallaṅkaṃ vuccati.
This also is called the unwavering seat, like the Vajirāsana, because it was a sitting for the setting in motion of the Wheel of Dhamma, which cannot be turned back by anyone.
Thật vậy, ngay cả điều đó cũng được gọi là tòa kim cương bất động vì đó là sự ngồi để chuyển Pháp luân không thể bị bất cứ ai làm cho xoay chuyển.
Imasmiñca pana padeti ‘‘dveme, bhikkhave, antā’’tiādinayappavatte imasmiṃ saddhammakoṭṭhāse.
And in this section means in this portion of the Dhamma, which proceeds in the manner of “‘These two extremes, monks’,” etc.
Trong đoạn này là trong phần giáo pháp này, được trình bày theo cách "Này các Tỳ-kheo, có hai cực đoan" v.v.
Dhammaghoso…pe… dasasahassilokadhātuṃ paṭicchādesi ‘‘sabbattha ṭhitā suṇantū’’ti adhiṭṭhānena.
The sound of Dhamma…etc.…covered the ten-thousandfold world system by the determination, “May all who are present listen.”
Tiếng Pháp... v.v... bao trùm mười ngàn thế giới bằng sự quyết định "mong tất cả những ai đang ở khắp nơi đều lắng nghe".
Soḷasahākārehīti ‘‘dukkhapariññā, samudayappahānaṃ, nirodhasacchikiriyā, maggabhāvanā’’ti evaṃ ekekasmiṃ magge cattāri cattāri katvā soḷasahi ākārehi.
In sixteen ways means by making four aspects for each path—namely, “full understanding of suffering, abandonment of the origin, realization of cessation, development of the path”—thus in sixteen ways.
Theo mười sáu phương diện là theo mười sáu phương diện, bằng cách chia mỗi đạo thành bốn, như "biết rõ khổ, đoạn trừ tập, chứng ngộ diệt, tu tập đạo".
Vuttoyeva, na idha vattabbo, tasmā tattha vuttanayeneva veditabboti adhippāyo.
It has already been stated, it should not be stated here, therefore, the meaning should be understood in the manner stated there.
Đã được nói rồi, không cần phải nói ở đây, do đó, ý nghĩa là phải hiểu theo cách đã nói ở đó.
Yasmā ca aparehipi aṭṭhahi kāraṇehi bhagavā tathāgatoti ārabhitvā udānaṭṭhakathādīsupi (udā. aṭṭha. 18; itivu. 38) tathāgatapadassa attho vutto eva, tasmā tattha vuttanayena attho veditabbo.
Since the meaning of the word Tathāgata has also been explained in the Udāna Aṭṭhakathā and other commentaries (udā. aṭṭha. 18; itivu. 38), beginning with the eight other reasons why the Blessed One is a Tathāgata, the meaning should be understood in the manner stated there.
Và vì ý nghĩa của từ Tathāgata đã được nói đến trong Udānaṭṭhakathā v.v. (Udā. Aṭṭha. 18; Itivu. 38) bắt đầu từ việc Đức Thế Tôn là Tathāgata với tám lý do khác, do đó, ý nghĩa phải được hiểu theo cách đã nói ở đó.
Yadipi bhagavā na bodhipallaṅke nisinnamattova abhisambuddho jāto, tathāpi tāya nisajjāya nisinnova panujja sabbaparissayaṃ abhisambuddho jāto.
Even though the Blessed One did not become fully enlightened merely by sitting on the Bodhi-seat, yet, by sitting in that posture, having dispelled all dangers, he became fully enlightened.
Mặc dù Đức Thế Tôn không trở thành bậc Chánh Đẳng Giác chỉ bằng việc ngồi trên Bồ-đề tòa, nhưng chính nhờ ngồi trong tư thế đó, Ngài đã xua tan mọi chướng ngại và trở thành bậc Chánh Đẳng Giác.
Tathā hi taṃ ‘‘aparājitapallaṅka’’nti vuccati.
Thus, it is called 'the undefeated seat' (aparājitapallaṅka).
Vì vậy, nơi đó được gọi là “Aparājitapallaṅka” (Tòa Bất Bại).
Tasmā ‘‘yāva bodhipallaṅkā vā’’ti vatvā tena aparitussanto ‘‘yāva arahattamaggañāṇā vā’’ti āha.
Therefore, having said "or up to the Bodhi-seat", and not being satisfied with that, he said "or up to the knowledge of the path of Arahantship".
Do đó, sau khi nói “cho đến Bồ-đề tòa” và vẫn chưa hài lòng, Ngài nói “hoặc cho đến A-la-hán đạo trí”.
Iti rūpanti ettha iti-saddo nidassanattho.
Here, in "thus form" (iti rūpaṃ), the word "thus" (iti) has the meaning of "showing" or "example".
Ở đây, trong iti rūpaṃ (như vậy là sắc), từ iti (như vậy) có nghĩa là ví dụ.
Tena rūpaṃ sarūpato parimāṇato paricchedato dassitanti āha ‘‘idaṃ rupa’’ntiādi.
By that, form is shown in its nature, extent, and limitation, thus he said "this form", etc.
Nhờ đó, sắc được trình bày về tự tánh, về lượng, về giới hạn, do đó nói “đây là sắc”, v.v.
‘‘Idaṃ rūpa’’nti hi iminā bhūtupādāyabhedarūpaṃ sarūpato dassitaṃ.
Indeed, by "this form", the form differentiated into fundamental elements and derivative elements is shown in its nature.
Quả thật, bằng “đây là sắc”, sắc được phân biệt thành các đại hiển và sở tạo sắc được trình bày về tự tánh.
Ettakaṃ rūpanti iminā taṃ parimāṇato dassitaṃ.
By "this much form" (ettakaṃ rūpaṃ), it is shown in its extent.
Bằng “sắc chừng này”, nó được trình bày về lượng.
Tassa ca parimāṇassa ekantabhāvadassanena ‘‘na ito bhiyyo rūpaṃ atthī’’ti vuttaṃ.
And by showing the exclusive nature of that extent, it is said "there is no more form than this".
Và bằng cách trình bày tính tuyệt đối của lượng đó, đã nói “không có sắc nào hơn thế này”.
Sabhāvatoti salakkhaṇato.
"By nature" (sabhāvato) means by its own characteristic.
Sabhāvato (theo tự tánh) là theo tự tướng.
Sarasatoti sakiccato.
"By function" (sarasato) means by its own action.
Sarasato (theo nhiệm vụ) là theo chức năng riêng.
Pariyantatoti parimāṇapariyantato.
"By limit" (pariyantato) means by the boundary of its extent.
Pariyantato (theo giới hạn) là theo giới hạn về lượng.
Paricchedatoti yattake ṭhāne tassa pavatti, tassa paricchedanato.
"By delimitation" (paricchedato) means by the delimitation of the space in which it occurs.
Paricchedato (theo sự phân định) là theo sự phân định nơi mà nó tồn tại.
Paricchindanatoti pariyosānappattito.
"By bringing to an end" (paricchindanato) means by reaching its culmination.
Paricchindanato (theo sự chấm dứt) là theo sự đạt đến điểm cuối.
Taṃ sabbaṃ dassitaṃ hoti yathāvuttena vibhāgena.
"All that is shown" by the aforementioned division.
Tất cả những điều đó được trình bày bằng cách phân loại đã nói.
Ayaṃ rūpassa samudayo nāmāti ayaṃ āhārādi rūpassa samudayo nāma.
"This is called the origination of form" (ayaṃ rūpassa samudayo nāmā) means this origination of form is called that of nutriment, etc.
Ayaṃ rūpassa samudayo nāmā (đây là sự tập khởi của sắc) nghĩa là sự tập khởi của sắc như thức ăn, v.v.
Tenāha ‘‘ettāvatā’’tiādi.
Therefore, he said "to this extent", etc.
Do đó nói “đến chừng đó”, v.v.
Atthaṅgamoti nirodho.
"Cessation" (atthaṅgamo) means Nirodha.
Atthaṅgamo (sự diệt trừ) là sự đoạn diệt.
‘‘Āhārasamudayā āhāranirodhā’’ti ca asādhāraṇameva gahetvā sese ādi-saddena saṅgaṇhāti.
And by taking "with the origination of nutriment, with the cessation of nutriment" as exclusive, he includes the rest with the word "etc."
Và bằng cách chỉ lấy “do sự tập khởi của thức ăn, do sự đoạn diệt của thức ăn” một cách đặc biệt, các điều còn lại được bao gồm bằng từ ādi (v.v.).
Paṇṇāsalakkhaṇapaṭimaṇḍitanti paṇṇāsaudayabbayalakkhaṇavibhūsitaṃ samudayatthaṅgamagahaṇato.
"Adorned with fifty characteristics" (paṇṇāsalakkhaṇapaṭimaṇḍitaṃ) means adorned with fifty characteristics of arising and passing away, by encompassing origination and cessation.
Paṇṇāsalakkhaṇapaṭimaṇḍitaṃ (được trang hoàng bằng năm mươi đặc tính) là được trang sức bằng năm mươi đặc tính sinh diệt, do sự nắm bắt sự tập khởi và đoạn diệt.
Khīṇāsavattāti anavasesaṃ sāvasesañca āsavānaṃ parikkhīṇattā.
"Because the Taints are exhausted" (khīṇāsavattā) means because the Taints are completely exhausted, both without remainder and with remainder.
Khīṇāsavattā (do đã đoạn tận các lậu hoặc) là do các lậu hoặc đã được đoạn tận hoàn toàn và không hoàn toàn.
Anāgāmīnampi hi bhayaṃ cittutrāso ca na hotīti.
For even for non-returners (Anāgāmī), fear and mental agitation do not arise.
Ngay cả những vị Bất Lai cũng không có sợ hãi và kinh hoàng trong tâm.
Ñāṇasaṃvego bhayatūpaṭṭhānañāṇaṃ.
"Knowledge of urgency" (ñāṇasaṃvego) is the knowledge of the appearance of fear.
Ñāṇasaṃvego là trí tuệ về sự kinh hoàng của hiểm nguy.
Itaresaṃ pana devānanti akhīṇāsave deve sandhāya vadati.
"But for other deities" (itaresānaṃ pana devānaṃ) refers to deities whose Taints are not exhausted.
Itaresaṃ pana devānaṃ (còn đối với các vị chư thiên khác) là nói đến các vị chư thiên chưa đoạn tận các lậu hoặc.
Bhoti dhammālapanamattanti vācasikaṃ tathālapanamattaṃ.
"It is merely a discussion of Dhamma" (bhoti dhammālapanamattaṃ) is merely a verbal discussion of such.
Bhoti dhammālapanamattaṃ (chỉ là lời nói về Pháp) là chỉ là lời nói suông như vậy.
Cakkanti satthu āṇācakkaṃ, taṃ pana dhammato āgatanti dhammacakkaṃ.
"Wheel" (cakkaṃ) refers to the wheel of the Teacher's authority; since it comes from the Dhamma, it is the "Dhamma-wheel".
Cakka (bánh xe) là bánh xe uy quyền của Bậc Đạo Sư, nhưng vì nó đến từ Pháp nên là dhammacakkaṃ (bánh xe Pháp).
Tattha ariyasāvakānaṃ paṭivedhadhammato āgatanti dhammacakkaṃ.
Therein, since it comes from the Dhamma of penetration of the noble disciples, it is the "Dhamma-wheel".
Ở đó, vì nó đến từ Pháp thể nhập của các bậc Thánh đệ tử nên là dhammacakkaṃ.
Itaresaṃ desanādhammato āgatanti dhammacakkaṃ.
For others, since it comes from the Dhamma of exposition, it is the "Dhamma-wheel".
Đối với những người khác, vì nó đến từ Pháp thuyết giảng nên là dhammacakkaṃ.
Duvidhepi ñāṇaṃ padhānanti ñāṇasīsena vuttaṃ ‘‘paṭivedhañāṇampi desanāñāṇampī’’ti.
In both, knowledge is paramount, hence it is stated primarily as knowledge: "both the knowledge of penetration and the knowledge of exposition".
Trong cả hai loại, trí tuệ là chính yếu, do đó đã nói bằng đầu trí tuệ là paṭivedhañāṇampi desanāñāṇampī (cả trí tuệ thể nhập và trí tuệ thuyết giảng).
Idāni taṃ ñāṇadvayaṃ sarūpato dassetuṃ ‘‘paṭivedhañāṇaṃ nāmā’’tiādi vuttaṃ.
Now, to show the nature of that two-fold knowledge, "knowledge of penetration is called", etc. is stated.
Bây giờ, để trình bày hai loại trí tuệ đó về tự tánh, đã nói “paṭivedhañāṇaṃ nāmā” (trí tuệ thể nhập là), v.v.
Yasmā cassa ñāṇassa suppaṭividdhattā bhagavā tāni saṭṭhi nayasahassāni veneyyānaṃ dassetuṃ samattho ahosi, tasmā tāni saṭṭhi nayasahassāni tena ñāṇena saddhiṃyeva siddhānīti katvā dassento ‘‘saṭṭhiyā ca nayasahassehi paṭivijjhī’’ti āha.
And because the Blessed One was able to show those sixty thousand ways to those who were capable of being trained, due to his profound penetration of that knowledge, he indicated by saying "he penetrated with the sixty thousand ways," assuming that those sixty thousand ways were achieved together with that knowledge.
Vì nhờ trí tuệ đó đã được thể nhập một cách hoàn hảo, Đức Thế Tôn có khả năng trình bày sáu mươi ngàn phương pháp cho những người có thể được giáo hóa, do đó, cho rằng sáu mươi ngàn phương pháp đó đã thành tựu cùng với trí tuệ đó, Ngài nói “saṭṭhiyā ca nayasahassehi paṭivijjhī” (và đã thể nhập bằng sáu mươi ngàn phương pháp).
Tiparivaṭṭanti idaṃ dukkhanti ca, pariññeyyanti ca, pariññātanti ca evaṃ tiparivaṭṭaṃ, taṃyeva dvādasākāraṃ.
"Three-revolutioned" (tiparivaṭṭaṃ) means it is three-revolutioned thus: 'this is suffering', 'it should be fully understood', and 'it has been fully understood'; that same is "twelve-fold".
Tiparivaṭṭaṃ (ba vòng) là đây là khổ, cần phải được liễu tri, đã được liễu tri, như vậy là ba vòng, chính nó là dvādasākāraṃ (mười hai khía cạnh).
Ta nti desanāñāṇaṃ pavatteti esa bhagavā.
"That" (taṃ), the knowledge of exposition, "this" Blessed One "sets in motion".
Taṃ (nó) là trí tuệ thuyết giảng, pavatteti esa (vị đó làm cho vận hành) là Đức Thế Tôn.
Appaṭipuggaloti patinidhibhūtapuggalarahito.
"Unequalled person" (appaṭipuggalo) means devoid of a person who is a substitute.
Appaṭipuggalo (người không có đối thủ) là không có người đại diện.
Ekasadisassāti nibbikārassa.
"Of the one uniform" (ekasadisassā) means of the unchanging.
Ekasadisassā (của một loại) là của cái không biến đổi.
79. Vipassanāvasenāti etarahi rūpavedanādayo anussaritvā ‘‘pubbepāhaṃ evaṃvedano ahosi’’nti atītānaṃ rūpavedanādīnaṃ paccuppannehi visesābhāvadassanā vipassanā, tassā vipassanāya vasena.
"By means of insight" (vipassanāvasena) refers to insight, which involves recollecting form, feeling, etc. now, and seeing that there is no difference between past forms and feelings, and present ones, by means of that insight.
79. Vipassanāvasenā (theo cách quán chiếu) là bây giờ, sau khi hồi tưởng sắc, thọ, v.v., “trước đây ta cũng có cảm thọ như vậy”, do sự trình bày không có sự khác biệt giữa sắc, thọ, v.v. trong quá khứ và hiện tại, đó là quán chiếu, theo cách quán chiếu đó.
Yvāyaṃ ‘‘na idaṃ abhiññāvasenā’’ti paṭikkhepo kato, tassa kāraṇaṃ dassento ‘‘abhiññāvasena hī’’tiādimāha.
He states the reason for the aforementioned rejection "this is not by means of higher knowledge" by saying "for by means of higher knowledge", etc.
Để trình bày lý do của sự phủ nhận “điều này không phải theo cách thắng trí” đã được nêu ra, Ngài nói “abhiññāvasena hī” (vì theo cách thắng trí), v.v.
Khandhapaṭibaddhā nāma gottavaṇṇahārādayo.
"Bound to the aggregates" (khandhapaṭibaddhā) are things like clan, color, nutriment, etc.
Khandhapaṭibaddhā (liên quan đến uẩn) là dòng dõi, sắc tộc, thức ăn, v.v.
Evaṃ anussarantoti yathāvuttavipassanāvasena anussaranto.
"Thus recollecting" (evaṃ anussaranto) means recollecting by means of the aforementioned insight.
Evaṃ anussaranto (hồi tưởng như vậy) là hồi tưởng theo cách quán chiếu đã nói.
Sabhāvadhammānaṃ eva anussaraṇassa vuttattā ‘‘suññatāpabba’’nti vuttaṃ.
Because the recollection of natural phenomena itself is stated, it is called "the section on emptiness" (suññatāpabbaṃ).
Vì sự hồi tưởng các pháp tự tánh đã được nói, nên đã nói “suññatāpabba” (phần về tánh không).
Kiñcāti hetuatthajotake kāraṇe paccattavacananti āha ‘‘kiñcāti kāraṇapucchā, kena kāraṇena rūpaṃ vadethā’’ti.
"Kiñca" (kiñcā) is a causal question, taking the accusative case to indicate cause, so he says "kiñcāti is a causal question, for what reason do you call it form?"
Kiñcā (cái gì) là đại từ nghi vấn chỉ nguyên nhân, ở đây là cách sở hữu, do đó nói “kiñcāti kāraṇapucchā, kena kāraṇena rūpaṃ vadethā” (kiñca là câu hỏi về nguyên nhân, do nguyên nhân nào mà gọi là sắc?).
Etanti etaṃ bhūtupādāyabhedaṃ dhammajātaṃ.
"This" (etaṃ) refers to this class of phenomena, differentiated into fundamental elements and derivative elements.
Etaṃ (cái này) là pháp loại được phân biệt thành các đại hiển và sở tạo.
Kena kāraṇena rūpaṃ nāmāti kiṃ kāraṇaṃ nissāya rūpanti vuccatīti attho.
"For what reason is it called form?" (kena kāraṇena rūpaṃ nāmā) means by virtue of what cause is it called form?
Kena kāraṇena rūpaṃ nāmā (do nguyên nhân nào mà gọi là sắc) nghĩa là nương vào nguyên nhân nào mà được gọi là sắc.
Kāraṇuddesoti kāraṇassa uddisanaṃ.
"Statement of cause" (kāraṇuddeso) means the designation of the cause.
Kāraṇuddeso (sự trình bày nguyên nhân) là sự chỉ rõ nguyên nhân.
Ruppatīti ettha rūpaṃ nāma sītādivirodhipaccayasannipātena visadisuppatti.
Here, in "it is afflicted" (ruppatī), "form" (rūpaṃ) refers to the heterogeneous arising due to the conjunction of opposing conditions like cold, etc.
Ở đây, ruppatī (bị biến hoại), rūpaṃ (sắc) là sự sinh khởi không đồng nhất do sự hội tụ của các duyên đối nghịch như lạnh, v.v.
Tenāha ‘‘sītenapī’’tiādi.
Therefore, he says "by cold", etc.
Do đó nói “sītenapī” (bằng cái lạnh), v.v.
Pabbatapādeti cakkavāḷapabbatapāde, so pana tattha accuggato pākāro viya ṭhito.
"At the foot of the mountain" (pabbatapāde) refers to the foot of the cakkavāḷa mountain, which stands there like a very high wall.
Pabbatapāde (ở chân núi) là ở chân núi Cakkavāḷa, nó đứng ở đó như một bức tường thành rất cao.
Tathā hi tattha sattā olambantā tiṭṭhanti.
Thus, beings cling there and remain.
Quả thật, các chúng sinh bám vào đó mà đứng.
Hatthapāsāgatāti hatthapāsaṃ āgatā upāgatā.
"Within reach" (hatthapāsāgatā) means arrived at, come near to, within arm's reach.
Hatthapāsāgatā (đến tầm tay) là đã đến, đã đạt đến tầm tay.
Tatthāti tasmiṃ hatthapāsāgate satte.
"There" (tatthā) refers to those beings within arm's reach.
Tatthā (ở đó) là ở những chúng sinh đã đến tầm tay đó.
Chijjitvāti mucchāpattiyā muccitvā, aṅgapaccaṅgaucchedavasena vā paricchijjitvā.
"Having shattered" (chijjitvā) means having been freed from unconsciousness, or having been cut up by way of the severing of limbs and minor parts.
Chijjitvā (bị cắt đứt) là thoát khỏi sự bất tỉnh, hoặc bị cắt đứt theo cách các chi phần bị hủy hoại.
Accantakhāre udaketi ātapasantāpābhāvena atisītabhāvameva sandhāya accantakhāratā vuttā siyā.
"In extremely saline water" (accantakhāre udake) might refer to extreme coldness, by implication of the absence of heat.
Accantakhāre udake (trong nước cực mặn) có lẽ nói đến tính cực mặn do không có sự nóng bức của mặt trời, chỉ là trạng thái cực lạnh.
Na hi taṃ kappasaṇṭhānaudakaṃ sampattikaramahāmeghavuṭṭhaṃ pathavīsandhārakaṃ kappavināsaudakaṃ viya khāraṃ bhavituṃ arahati, tathā sati pathavīpi vilīyeyyāti.
For that water of the world-cycle's formation, rained down by the great auspicious clouds and supporting the earth, cannot be saline like the water of world-destruction, for if so, the earth too would dissolve.
Vì nước trong thời kỳ hình thành thế giới đó không thể mặn như nước hủy diệt thế giới, được mưa từ những đám mây lớn mang lại sự thịnh vượng và duy trì trái đất, nếu không thì trái đất cũng sẽ tan chảy.
Mahiṃsakaraṭṭhaṃ nāma himavantapadese ekaṃ raṭṭhaṃ.
"Mahiṃsaka country" (mahiṃsakaraṭṭhaṃ) is a country in the Himalayan region.
Mahiṃsakaraṭṭhaṃ (vương quốc Mahiṃsaka) là một vương quốc ở vùng Himavanta.
Purimasadisanti purime rūpakkhandhe vuttena sadisaṃ.
"Similar to the previous" (purimasadisaṃ) means similar to what was said regarding the previous form aggregate.
Purimasadisaṃ (giống như trước) là giống như điều đã nói về sắc uẩn trước đây.
Taṃ ‘‘kinti kāraṇapucchā’’tiādinā vuttanayeneva veditabbaṃ.
That is to be understood "in the manner stated" by "kinti kāraṇapucchā" (what is the causal question), etc.
Điều đó cần được hiểu theo cách đã nói bằng “kinti kāraṇapucchā” (kinti là câu hỏi về nguyên nhân), v.v.
Sukhaṃ iṭṭhārammaṇaṃ.
"Pleasant" (sukhaṃ) is a desirable object.
Sukhaṃ (lạc) là đối tượng dễ chịu.
Sukhādīnaṃ vedanānaṃ.
"Of pleasant feelings", etc. (sukhādīnaṃ vedanānaṃ).
Sukhādīnaṃ (của lạc, v.v.) là của các cảm thọ.
Paccayatoti ārammaṇapaccayato.
"By means of cause" (paccayato) means by means of the object-condition.
Paccayato (do duyên) là do duyên đối tượng.
Ayamatthoti ‘‘sukhārammaṇaṃ sukhanti vuccatī’’ti ayamattho.
"This meaning" (ayamattho) means "a pleasant object is called pleasant" is this meaning.
Ayamattho (ý nghĩa này) là “đối tượng lạc được gọi là lạc”, ý nghĩa này.
Uttarapadalopena hesa niddeso.
Indeed, this is a designation with the omission of a later word.
Quả thật, đây là cách trình bày bằng cách lược bỏ hậu tố.
Vedayatīti anubhavati.
"Feels" (vedayatī) means experiences.
Vedayatī (cảm thọ) là trải nghiệm.
Vedayitalakkhaṇāti anubhavanalakkhaṇā.
"Characterized by feeling" (vedayitalakkhaṇā) means characterized by experiencing.
Vedayitalakkhaṇā (có đặc tính cảm thọ) là có đặc tính trải nghiệm.
Nīlapuppheti nīlavaṇṇapupphe.
"In a blue flower" (nīlapupphe) means in a blue-colored flower.
Nīlapupphe (trên hoa màu xanh) là trên hoa có màu xanh.
Vatthe vāti nīlavatthe.
"Or in cloth" (vatthe vā) means in blue cloth.
Vatthe vā (hoặc trên vải) là trên vải màu xanh.
Vā-saddena vaṇṇadhātuādiṃ saṅgaṇhāti.
The word "or" (vā) includes color-element, etc.
Bằng từ vā (hoặc), bao gồm nguyên tố màu sắc, v.v.
Appanaṃ vā jhānaṃ vāpento.
"Or bringing about absorption" (appanaṃ vāpento) means jhāna.
Appanaṃ vā (hoặc sự an định) là làm cho thiền vāpento (lan tỏa).
Uppajjanasaññāpīti yaṃ kiñci nīlaṃ rūpāyatanaṃ ārabbha uppajjanasaññāpi, yā pakiṇṇakasaññāti vuccati.
"Even the arising perception" (uppajjanasaññāpī) means any arising perception concerning a blue visual object, which is called scattered perception.
Uppajjanasaññāpī (ngay cả tưởng sinh khởi) là bất kỳ tưởng nào sinh khởi liên quan đến sắc xứ màu xanh, cái được gọi là tưởng tạp loạn.
Rūpattāyāti rūpabhāvāya.
"For the state of form" (rūpattāyā) means for the condition of being form.
Rūpattāyā (để thành sắc) là để trở thành sắc.
Yāgumevāti yāgubhāvinameva vatthuṃ.
"Only gruel" (yāgumevā) means only the substance that becomes gruel.
Yāgumevā (chính là cháo) là vật chất chính là cháo.
Yāguttāya yāgubhāvāya.
"For the state of gruel" (yāguttāya) means for the condition of being gruel.
Yāguttāya (để thành cháo) là để trở thành cháo.
Pacati nāma puggalo.
"A person cooks" (pacati nāma puggalo).
Pacati nāma (người nấu) là người nấu.
Evanti yathā yāguādivatthuṃ puriso yāguādiatthāya pacati nipphādeti, ayaṃ evaṃ ruppanādisabhāve dhammasamūhe yathāsakaṃ paccayehi abhisaṅkhariyamāne cetanāpadhāno dhammasamūho pavattanatthaṃ visesapaccayo hutvā te abhisaṅkharoti niropeti nibbatteti.
Thus, just as a person cooks and produces a gruel-like substance for the purpose of gruel, so too, this group of phenomena, predominated by volition, when being conditioned by their respective conditions in phenomena having the nature of "being afflicted," becomes a special condition for their arising, and thereby conditions, implants, and produces them.
Như vậy, ví như người nấu nướng, làm ra các vật thực như cháo vì mục đích cháo, thì nhóm pháp này, chủ yếu là ý chí (cetanā), trở thành duyên đặc biệt để tạo tác, gieo trồng và làm phát sinh các nhóm pháp có bản chất biến hoại (ruppanā) này, khi chúng được tạo tác bởi các duyên riêng của chúng để duy trì sự vận hành.
Tenāha ‘‘paccayehī’’tiādi.
Therefore, it is said, "by conditions," etc.
Vì vậy đã nói “bởi các duyên” và vân vân.
Rūpamevāti rūpasabhāvameva, na aññaṃ sabhāvaṃ.
"Form itself" means the nature of form itself, not any other nature.
Chỉ là sắc nghĩa là chỉ có bản chất sắc, không phải bản chất nào khác.
Abhisaṅkharotīti itarehi paccayadhammehi adhikaṃ suṭṭhu paccayataṃ karoti.
"Conditions" means it makes them very much more a condition than other conditional phenomena.
Tạo tác nghĩa là làm cho các pháp duyên khác trở thành duyên tốt hơn, vượt trội hơn.
‘‘Upagacchati yāpeti āyūhatī’’ti tasseva vevacanāni.
"Approaches, maintains, strives" are synonyms for it.
“Tiếp cận, duy trì, tích lũy” là những từ đồng nghĩa của chính từ đó.
Abhisaṅkharaṇameva hi āyūhanādīni.
Indeed, conditioning itself implies striving, etc.
Thật vậy, sự tạo tác chính là sự tích lũy, v.v.
Nibbattetīti tesaṃ dhammānaṃ ruppanādibhāvena nibbattiyā paccayo hotīti attho.
"Produces" means it becomes a condition for the production of those phenomena in the nature of "being afflicted," etc.
Làm phát sinh nghĩa là trở thành duyên cho sự phát sinh của các pháp đó với bản chất biến hoại, v.v.
Cetayitalakkhaṇassa saṅkhārassāti idaṃ saṅkhārakkhandhadhammānaṃ cetanāpadhānattā vuttaṃ.
"Of the volitional formation characterized by intention" is said because the phenomena of the saṅkhāra-khandha are predominated by volition.
Của hành có đặc tính tư duy – điều này được nói vì các pháp hành uẩn chủ yếu là ý chí (cetanā).
Tathā hi bhagavā suttantabhājanīye saṅkhārakkhandhaṃ vibhajantena cetanāva vibhattā.
For thus, when the Blessed One analyzed the saṅkhāra-khandha in the Suttanta-bhājanīya, volition itself was analyzed.
Thật vậy, Đức Thế Tôn khi phân tích hành uẩn trong phần phân tích kinh tạng đã phân tích chính ý chí.
Vātiṅgaṇaṃ brahatiphalaṃ.
"Vātiṅgaṇaṃ" means a large fruit (eggplant).
Vātiṅgaṇaṃ là quả cà tím.
Caturassavallīti tivutālatā.
"Caturassavallī" means a creeper with four angles (cissus quadrangularis).
Caturassavallī là cây dây leo tivutā.
Akhārikanti khārarasarahitaṃ, taṃ pana paṇṇaphalādi.
"Akhārikaṃ" means devoid of an alkaline taste, such as leaves and fruits.
Không có vị kiềm nghĩa là không có vị kiềm, đó là lá, quả, v.v.
Yattha loṇaraso adhiko, taṃ loṇikanti āha ‘‘loṇayāgū’’tiādi.
What has an excess of salty taste, that is called "loṇikaṃ," as in "salty gruel," etc.
Nơi nào có nhiều vị mặn, nơi đó gọi là mặn, vì vậy đã nói “cháo mặn” và vân vân.
Ambilādibhedaṃ rasaṃ.
Taste, such as sour, etc.
Vị khác biệt như chua, v.v.
Ākārasaṇṭhānagahaṇavasenāti nīlapītādiākāragahaṇavasena ceva vaṭṭacaturassādisaṇṭhānagahaṇavasena ca.
"By way of grasping forms and configurations" means by way of grasping blue, yellow, etc., forms, and by way of grasping circular, square, etc., configurations.
Theo cách nắm bắt hình thái và hình dạng nghĩa là theo cách nắm bắt hình thái như xanh, vàng, v.v. và theo cách nắm bắt hình dạng như tròn, vuông, v.v.
Vināpi ākārasaṇṭhānāti ākārasaṇṭhānehi vinā, te ṭhapetvāpi.
"Even without forms and configurations" means without forms and configurations, setting them aside.
Ngay cả không có hình thái và hình dạng nghĩa là không có hình thái và hình dạng, tức là bỏ qua chúng.
Paccattabhedagahaṇavasenāti tassa tassa ārammaṇassa pabhedagahaṇavasena.
"By way of grasping individual distinctions" means by way of grasping the distinctions of each object.
Theo cách nắm bắt sự khác biệt riêng biệt nghĩa là theo cách nắm bắt sự phân biệt của từng đối tượng.
Asammohatoti yāthāvato.
"Undeludedly" means truly.
Không mê lầm nghĩa là như thật.
Viseso visesatthadīpanato, aviseso ayaṃ dhammo avisesadīpanato.
"Distinction" means by illustrating a distinct meaning; "non-distinction" means this phenomenon by illustrating a non-distinction.
Sự đặc biệt là do làm rõ ý nghĩa đặc biệt, sự không đặc biệt là do làm rõ rằng pháp này không đặc biệt.
Tenāha ‘‘viseso veditabbo’’ti.
Therefore, it is said, "distinction should be understood."
Vì vậy đã nói “cần phải biết sự đặc biệt”.
Jānanañhi avisiṭṭhaṃ, taṃ samāsapadato upasaggā visesenti.
For understanding is not distinct; the prefixes distinguish it from the compound word.
Thật vậy, sự biết là không đặc biệt, các tiền tố làm cho nó đặc biệt từ từ ghép.
Tathā hi sañjānanapadaṃ paccabhiññāṇanimittaṃ ākāragahaṇamattaṃ bodheti, vijānanapadaṃ tato visiṭṭhavisayagahaṇaṃ.
For thus, the word 'sañjānanapada' (cognition) signifies merely the grasping of a characteristic as a sign of recognition, while the word 'vijānanapada' (discrimination) signifies the grasping of a more distinct object.
Thật vậy, từ “sañjānanā” (nhận biết) chỉ sự ghi nhận dấu hiệu, sự nắm bắt hình thái đơn thuần; từ “vijānanā” (liễu tri) chỉ sự nắm bắt đối tượng đặc biệt hơn từ đó.
Pajānanapadaṃ pana tatopi visiṭṭhataraṃ pakārato avabodhaṃ bodheti.
The word 'pajānanapada' (comprehension), however, signifies a still more distinct understanding, an apprehension in a particular manner.
Còn từ “pajānanā” (tuệ tri) chỉ sự thấu hiểu theo cách đặc biệt hơn nữa, vượt trội hơn từ đó.
Tenāha ‘‘tassāpī’’tiādi.
Therefore, it is said, "even for that," etc.
Vì vậy đã nói “của chính nó” và vân vân.
Ārammaṇasañjānanamattamevāti nīlādibhedassa ārammaṇassa sallakkhaṇamattameva.
"Merely the cognition of the object" means merely the observation of the object distinguished as blue, etc.
Chỉ là sự nhận biết đối tượng nghĩa là chỉ là sự ghi nhận đối tượng có các phân biệt như xanh, v.v.
Avadhāraṇena lakkhaṇapaṭivedhattaṃ nivatteti.
By way of emphasis, it excludes the penetration of characteristics.
Bằng cách nhấn mạnh, nó loại bỏ sự thâm nhập đặc tính.
Tenāha ‘‘anicca’’ntiādi.
Therefore, it is said, "impermanent," etc.
Vì vậy đã nói “vô thường” và vân vân.
Ñāṇasampayuttacittehi vipassantassa vipassanāya paguṇabhāve sati ñāṇavippayuttena cittenapi vipassanā hotiyevāti āha ‘‘aniccādivasena lakkhaṇapaṭivedhañca pāpetī’’ti.
When one who contemplates with consciousness accompanied by knowledge has ripened vipassanā, even with consciousness dissociated from knowledge, vipassanā still arises; therefore, it is said, "and brings about the penetration of characteristics by way of impermanence, etc."
Khi vị hành giả tuệ quán với các tâm tương ưng trí tuệ đã thuần thục trong tuệ quán, thì ngay cả với tâm không tương ưng trí tuệ cũng có tuệ quán. Vì vậy đã nói “cũng đạt đến sự thâm nhập đặc tính theo cách vô thường, v.v.”.
Paṭivedhanti ca upaladdhimeva vadati, na paṭivijjhanaṃ.
And "penetration" here refers to attainment, not penetration itself.
Và sự thâm nhập ở đây chỉ sự nhận thức, không phải sự xuyên thấu.
Tenāha ‘‘ussakkitvā panā’’tiādi.
Therefore, it is said, "when it exerts itself," etc.
Vì vậy đã nói “nhưng khi đã nâng cao” và vân vân.
Ussakkitvāti ussakkāpetvā maggapātubhāvampi pāpeti asammohasabhāvattā.
"When it exerts itself" means by causing it to exert itself, it brings about even the manifestation of the path, due to its undeluded nature.
Đã nâng cao nghĩa là đã làm cho nâng cao, cũng đạt đến sự hiện khởi của đạo lộ vì có bản chất không mê lầm.
Yathā lakkhaṇapaṭivedhakāle sañjānanalakkhaṇavasena saññāṇaanurūpavaseneva pavattaṃ, evaṃ viññāṇavijānanavasena vāyaṃ anurūpavaseneva pavattatīti daṭṭhabbaṃ.
Just as during the time of characteristic penetration, it proceeds in conformity with cognition, by way of the characteristic of cognizing, so too, it should be understood that this proceeds in conformity with discrimination, by way of the characteristic of discriminating.
Cần phải hiểu rằng, cũng như trong lúc thâm nhập đặc tính, sự nhận biết (saññāṇa) vận hành theo cách phù hợp với đặc tính nhận biết, thì thức (viññāṇa) cũng vận hành theo cách phù hợp với sự liễu tri (vijānanā) của nó.
Idāni tamatthaṃ heraññikādiupamāya vibhāvetuṃ ‘‘yathā hī’’tiādimāha.
Now, to illustrate that meaning with the simile of a money-changer, etc., it says, "Just as," etc.
Bây giờ, để làm rõ ý nghĩa đó bằng ví dụ về người thợ vàng, v.v., đã nói “ví như” và vân vân.
Hiraññaṃ vuccati kahāpaṇaṃ, hiraññajānane niyutto heraññiko.
Gold is called kahāpaṇa; one appointed to know gold is a "money-changer."
Hiraññaṃ được gọi là kahāpaṇa (tiền đồng), người được giao nhiệm vụ nhận biết hiraññaṃ là heraññiko (người thợ vàng).
Lokavohāre ajātā asañjātā buddhi etassāti ajātabuddhi, bāladārako.
"Ajātabuddhi" is one whose understanding has not arisen, who is undeveloped in worldly matters, a foolish child.
Người mà trí tuệ chưa phát sinh, chưa xuất hiện trong cách nói thế gian, là ajātabuddhi (người chưa có trí tuệ), tức là đứa trẻ.
Vohārakusalo gāmavāsī puriso gāmikapuriso.
A villager skilled in worldly affairs is a "gāmikapuriso" (village man).
Người đàn ông sống ở làng, khéo léo trong giao dịch, là gāmikapuriso (người làng).
Upabhogaparibhogārahattā upabhogaparibhogaṃ.
"Upabhogaparibhogaṃ" (use and enjoyment) because it is worthy of use and enjoyment.
Upabhogaparibhogaṃ (sự hưởng dụng và sử dụng) là do thích hợp để hưởng dụng và sử dụng.
Tambakaṃsamayattā kūṭo.
"Kūṭo" (false coin) because it is made of copper and bronze.
Kūṭo (giả) là do làm bằng đồng thau.
Mahāsārattā cheko.
"Cheko" (genuine) because it is of great essence.
Cheko (tinh xảo) là do có giá trị lớn.
Aḍḍhasārattā karaṭo.
"Karaṭo" (semi-genuine) because it is of half essence.
Karaṭo (pha tạp) là do có giá trị một nửa.
Nihīnasārattā saṇho.
"Saṇho" (inferior) because it is of low essence.
Saṇho (mịn) là do có giá trị thấp kém.
Ettha ca yathā heraññiko kahāpaṇaṃ cittādibhāvato uddhaṃ kūṭādibhāvaṃ rūpadassanādivasena uppattiṭṭhānatopi jānanto anekākārato jānāti, evaṃ paññā ārammaṇaṃ nānappakārato jānāti paṭivijjhati, tāya saddhiṃ pavattamānaviññāṇampi yathāvisayaṃ ārammaṇaṃ jānāti.
In this regard, just as a money-changer knows a kahāpaṇa in many ways, understanding its false, etc., nature from its appearance, etc., and also from its place of origin, so too, wisdom knows and penetrates an object in various ways, and consciousness accompanying it also knows the object according to its domain.
Ở đây, cũng như người thợ vàng biết đồng kahāpaṇa theo nhiều cách, từ bản chất tâm, v.v., cho đến bản chất giả, v.v., và biết từ nơi phát sinh bằng cách nhìn thấy hình dạng, v.v., thì tuệ cũng biết và thâm nhập đối tượng theo nhiều cách khác nhau, và thức (viññāṇa) vận hành cùng với tuệ cũng biết đối tượng theo phạm vi của nó.
Yasmā panettha ‘‘taṃ kiṃ maññatha, bhikkhave’’tiādidesanāya tīsu lakkhaṇesu idameva padhānabhāvena dassitaṃ, idaṃ appadhānabhāvenāti na sakkā vattuṃ, tasmā ‘‘tīṇi lakkhaṇāni samodhānetvā dassetumpī’’ti vuttaṃ.
Since it is not possible to say that among the three characteristics, this one is shown as primary and that one as secondary in the teaching beginning with "What do you think, bhikkhus?", it is said, "to show by combining the three characteristics."
Tuy nhiên, trong lời dạy này, với câu hỏi “Này các tỳ-kheo, các ông nghĩ sao?”, không thể nói rằng đặc tính này được trình bày như chủ yếu và đặc tính kia như thứ yếu. Vì vậy đã nói “để trình bày ba đặc tính cùng một lúc”.
Apacinātīti apacayagāmidhamme nivatteti ekaṃsato apacayagāmipaṭipadāya paripūraṇato.
"Reduces" means it turns away phenomena destined for decline, by perfectly fulfilling the path destined for decline absolutely.
Apacināti (làm suy giảm) nghĩa là làm cho các pháp hướng đến sự suy giảm không còn tồn tại, do hoàn thiện con đường chắc chắn dẫn đến sự suy giảm.
Tenāha ‘‘no ācinātī’’tiādi.
Therefore, it is said, "does not accumulate," etc.
Vì vậy đã nói “không tích lũy” và vân vân.
Vaṭṭaṃ vināsetīti vidhamati adassanaṃ gameti.
"Destroys the round" means it disperses it, brings it to disappearance.
Phá hủy vòng luân hồi nghĩa là làm cho tan rã, làm cho biến mất.
Neva cinātīti na vaḍḍheti.
"Does not accumulate" means does not increase.
Không tích lũy nghĩa là không làm cho tăng trưởng.
Tadevāti taṃ vaṭṭaṃ eva.
"That very" means that very round of existence.
Chính nó nghĩa là chính vòng luân hồi đó.
Vissajjetīti chaḍḍeti.
"Relinquishes" means it discards.
Vissajjetī (vứt bỏ) nghĩa là bỏ đi.
Vikiratīti viddhaṃseti.
"Disperses" means it shatters.
Vikiratī (phân tán) nghĩa là phá hủy.
Vidhūpetīti vaṭṭattayasaṅkhātaṃ aggikkhandhaṃ vigatadhūmaṃ vigatasantāpaṃ karotīti atthoti āha ‘‘nibbāpetī’’ti.
"Extinguishes" means it makes the mass of fire, called the three rounds of existence, free from smoke and free from burning; hence, it is said, "cools."
Vidhūpetī (làm tan khói) nghĩa là làm cho khối lửa được gọi là ba vòng luân hồi không còn khói, không còn sự thiêu đốt. Ý nghĩa là vậy, nên đã nói “làm cho tịch diệt”.
Evaṃ passantiādi anāgāmiphale ṭhitassa ariyasāvakassa aggamaggaphalādhigamāya desanāti adhippāyenāha ‘‘vaṭṭaṃ vināsetvā ṭhitaṃ mahākhīṇāsavaṃ dassessāmī’’ti.
"See thus," etc., refers to the teaching for a noble disciple established in the anāgāmi fruit, for the attainment of the highest path and fruit; hence, it is said, "I will show the great Arahant, who has destroyed the round of existence and stands."
Hãy thấy như vậy và vân vân, là lời dạy cho vị Thánh đệ tử đã đạt đến A-na-hàm quả để chứng đắc quả vị A-la-hán tối thượng. Với ý nghĩa đó, đã nói “Ta sẽ chỉ cho các ông vị A-la-hán vĩ đại đã phá hủy vòng luân hồi và đang an trụ”.
Khīṇāsavassa anāgatabhāvadassanaṃyeva, sabbā cāyaṃ heṭṭhimā desanā suddhavipassanākathā, sahapaṭhamamaggā vā sahavijjūpamadhammā vā vipassanākathāti dassento ‘‘ettakena ṭhānenā’’tiādimāha.
This is merely showing the future state of the Arahant, and all this preceding teaching is a discourse on pure vipassanā, or a discourse on vipassanā accompanied by the first path, or accompanied by phenomena like lightning; thus, to show this, it says, "by this much of a statement," etc.
Việc chỉ ra trạng thái vị A-la-hán trong tương lai, và toàn bộ lời dạy trước đó là lời nói về tuệ quán thuần túy, hoặc lời nói về tuệ quán cùng với Đạo lộ thứ nhất, hoặc cùng với các pháp giống như ánh chớp. Để chỉ ra điều đó, đã nói “với chừng đó chỗ” và vân vân.
Namassantiyeva mahatā gāravabahumānena.
"They pay homage" with great respect and reverence.
Chỉ đảnh lễ với sự tôn kính và ngưỡng mộ lớn lao.
Tenāha ‘‘namo te purisājaññā’’tiādi.
Therefore, it is said, "Homage to you, noble man," etc.
Vì vậy đã nói “Kính lễ ngài, bậc trượng phu cao quý” và vân vân.
Tattha nidassanaṃ dassento ‘‘āyasmantaṃ nītattheraṃ viyā’’ti vatvā tamatthaṃ vibhāvetuṃ ‘‘thero’’tiādimāha.
There, showing an example, it says, "like Venerable Nīta Thera," and to elaborate on that meaning, it says, "The Elder," etc.
Ở đây, để đưa ra ví dụ, đã nói “như Tôn giả Nīta” và sau đó để làm rõ ý nghĩa đó, đã nói “Vị Trưởng lão” và vân vân.
Tattha khuraggeyevāti kesoropanatthaṃ khuradhārāya agge sīse ṭhapite tacapañcakakammaṭṭhānamukhena bhāvanaṃ anuyuñjanto arahattaṃ patvā.
There, "at the edge of the razor" means by meditating through the meditation subject of the fivefold body-parts (skin, hair, nails, teeth, flesh) while the razor's edge was placed on the head for hair removal, he attained arahatship.
Ở đây, ngay trên lưỡi dao cạo nghĩa là khi lưỡi dao cạo được đặt trên đầu để cạo tóc, vị ấy đã tu tập thiền định thông qua đề mục năm phần của thân (tacapañcakakammaṭṭhāna) và đã chứng đắc A-la-hán quả.
Brahmavimānāti brahmānaṃ nivāsabhūtā vimānā.
"Brahmavimānā" means celestial mansions that are abodes of Brahmas.
Cung điện Phạm thiên nghĩa là các cung điện là nơi cư ngụ của chư Phạm thiên.
80. Apakarīyati etenāti apakaraṇaṃ, padaṃ.
"Apakaraṇaṃ" (occasion) means that by which something is done, a passage.
80. Apakaraṇaṃ (sự làm hại) là một từ, do bị làm hại bởi nó.
Apakaraṇaṃ pakaraṇaṃ kāraṇanti atthato ekaṃ.
Apakaraṇaṃ, pakaraṇaṃ, and kāraṇaṃ are essentially one in meaning.
Apakaraṇaṃ, pakaraṇaṃ, kāraṇaṃ có cùng một ý nghĩa.
Tenāha ‘‘kismiñcideva kāraṇe’’ti.
Therefore, it is said, "in some particular reason."
Vì vậy đã nói “trong một nguyên nhân nào đó”.
Nīharitvāti attano samīpacārabhāvato apanetvā.
"Having removed" means having taken away from one's immediate vicinity.
Nīharitvā (đã lấy ra) nghĩa là đã loại bỏ khỏi sự gần gũi của mình.
Tathākaraṇañca evamete ettakampi appaṭirūpaṃ akatvā āyatiṃ sammā paṭipajjissantīti.
And by doing so, these*, not having committed even such an improper act, will practice rightly in the future.
Và việc làm như vậy (là để) những người này, không làm điều không phù hợp dù chỉ một chút như thế này, sẽ thực hành đúng đắn trong tương lai.
Laddhabalāti laddhañāṇabalā.
Laddhabalā means those who have acquired the power of knowledge.
Laddhabalā (có sức mạnh) nghĩa là có sức mạnh của trí tuệ.
Ekadvīhikāyāti ekekassa ceva dvinnaṃ dvinnañca īhikā gati upasaṅkamanā ekadvīhikā.
Ekadvīhikā means the going, the approach, of one by one and two by two.
Ekadvīhikā (từng một và từng hai) nghĩa là sự đi, sự đến, sự tiếp cận của từng một và từng hai.
Tenāha ‘‘ekeko ceva dve dve ca hutvā’’ti.
Therefore, it is said: "being one by one and two by two."
Do đó nói “từng một và từng hai”.
Puthujjanānaṃ samuditānaṃ nāma kiriyā tādisīpi siyāti vuttaṃ ‘‘keḷimpi kareyyu’’nti.
It is said that the actions of assembled ordinary people could indeed be like that: "they might even play."
Hành động như vậy của những phàm nhân tụ họp lại có thể xảy ra, nên nói “có thể vui đùa”.
Parikappanavasena sammāsambuddhaṃ uddissa pesalā bhikkhūpi evaṃ karontīti.
It is imagined that even virtuous bhikkhus, with reference to the Sammāsambuddha, would act in this way.
Với ý định như vậy, ngay cả các tỳ khưu đáng kính cũng hành động như vậy đối với Đức Chánh Đẳng Giác.
Yugandharapabbatādīnaṃ antare sīdantaraṃ samuddaṃ nāma.
Between the Yugandhara mountain and others, there is an ocean called Sīdantara.
Giữa núi Yugandhara và các núi khác có một biển gọi là Sīdantara.
Tattha kira vāto na vāyati, patitaṃ yaṃ kiñcipi sīdantaranadiyaṃ vilīyantā sīdanteva, tasmā taṃ parivāretvā ṭhitā yugandharādayopi sīdapabbatā nāma.
It is said that no wind blows there; whatever falls into the Sīdantara river simply sinks, dissolving. Therefore, the Yugandhara and other mountains surrounding it are also called Sīda mountains.
Ở đó gió không thổi, bất cứ thứ gì rơi xuống sông Sīdantara đều tan chảy, do đó các núi Yugandhara và các núi khác bao quanh nó cũng được gọi là núi Sīda.
Taṃ sandhāya vuttaṃ ‘‘sīdantare sannisinnaṃ mahāsamuddaṃ viyā’’ti.
Referring to that, it is said: "like the great ocean sunk in the Sīdantara."
Do đó nói “giống như biển lớn nằm trong Sīdantara”.
Āhārahetūti āmisahetu sappitelādinimittaṃ, tesaṃ paṇāmanā.
Āhārahetū means for the sake of material things, for the sake of ghee, oil, etc., a giving forth of these.
Āhārahetū (vì thức ăn) nghĩa là vì vật thực, vì mỡ, dầu, v.v., sự dâng cúng của chúng.
Ādīsu (jā. 1.3.135) viya.
as in these*.
Như trong các trường hợp khác.
Ulatīti abhicarati.
Ulatī means to curse.
Ulatī (nguyền rủa) nghĩa là làm hại.
Abhisapanti etenāti abhisāpo.
That by which one curses is abhisāpo.
Vì nguyền rủa bằng điều này nên gọi là abhisāpo (lời nguyền).
Abhisāpavatthu piṇḍolyaṃ.
The cause for cursing is piṇḍolyaṃ (begging for alms).
Đối tượng của lời nguyền là piṇḍolyaṃ (sự khất thực).
Attho phalaṃ vaso etassāti atthavasaṃ, kāraṇaṃ, tampi tesu atthi, tattha niyuttāti atthavasikā.
That which has meaning, result, or power as its master is atthavasaṃ, a reason; that is also present in them, and they are engaged in it, hence atthavasikā.
Điều có mục đích, quả, quyền năng là atthavasaṃ (có mục đích), tức là lý do, điều đó cũng có ở họ, những người được giao phó cho điều đó nên gọi là atthavasikā (có mục đích).
Abhijjhāyitāti abhijjhāyanasīlo.
Abhijjhāyitā means one prone to covetousness.
Abhijjhāyitā (người tham lam) nghĩa là người có thói quen tham lam.
Abhiṇhappavattiyā ceva bahulabhāvena ca bahularāgo.
Due to frequent occurrence and abundant presence, bahularāgo (abundant lust).
Do sự thường xuyên phát sinh và sự phổ biến nên là bahularāgo (tham ái nhiều).
Pūtibhāvenāti kuthitabhāvena.
Pūtibhāvenā means in a rotten state.
Pūtibhāvena (bởi sự thối rữa) nghĩa là bởi sự mục nát.
Byāpādo hi uppajjamāno cittaṃ apagandhaṃ karoti, na sucimanuññabhāvaṃ.
For ill-will, when it arises, makes the mind foul-smelling, not pure and pleasant.
Vì khi sân hận phát sinh, nó làm cho tâm trở nên hôi hám, không trong sạch và dễ chịu.
Bhattanikkhittakāko viyāti idaṃ bhattaṭṭhānassa asaraṇena kākassa naṭṭhasatitā paññāyatīti katvā vuttaṃ, na bhattanikkhittatāya.
Bhattanikkhittakāko viyā (like a crow that has put down its food) – this is said because the crow's loss of mindfulness at the place of food is understood, not because of the mere act of placing the food.
Bhattanikkhittakāko viyā (như con quạ bị bỏ thức ăn) câu này được nói vì sự mất trí nhớ của con quạ do không có nơi nương tựa ở chỗ thức ăn, chứ không phải vì việc bỏ thức ăn.
Asaṇṭhitoti asaṇṭhitacitto.
Asaṇṭhito means with an unsettled mind.
Asaṇṭhito (không ổn định) nghĩa là tâm không ổn định.
Kaṭṭhatthanti kaṭṭhena kattabbakiccaṃ.
Kaṭṭhatthaṃ means a task to be done with wood.
Kaṭṭhatthaṃ (công việc của gỗ) nghĩa là công việc cần làm bằng gỗ.
Pāpavitakkehi kato, tasmā te anavasesato pahātabbāti dassanatthaṃ.
Pāpavitakkehi kato (made by unwholesome thoughts), therefore, to show that they should be entirely abandoned, dassanatthaṃ (for the purpose of showing).
Được tạo ra bởi các tà tư duy, do đó cần phải loại bỏ chúng hoàn toàn, đây là dassanatthaṃ (để chỉ rõ).
Dvinnaṃ vuttattā eko pubbabhāgo, itaro missakoti vattuṃ yuttanti adhippāyena ‘‘ettha cā’’tiādi vuttaṃ.
Because two are mentioned, one is the prior part, and the other is mixed, so it is appropriate to say "ettha cā" (and here) and so on, is the intention.
Vì hai điều đã được nói, một là phần trước, điều kia là hỗn hợp, nên có lý để nói “ettha cā” (và ở đây) v.v..
Evaṃ taṃ bhāventassa nirujjhanti evāti ekekamissakatāvasena gahetabbanti porāṇā.
The ancients say that for one who cultivates it in this way, they cease completely, so it should be taken as each being mixed individually.
Các bậc cổ nhân nói rằng, khi tu tập như vậy, chúng sẽ diệt trừ, do đó cần phải hiểu theo cách từng hỗn hợp một.
Upari tiparivaṭṭadesanāya animittasamādhiyeva dīpito.
Above, through the teaching of the three turnings, only the signless concentration (animittasamādhi) is revealed.
Ở trên, trong bài thuyết pháp ba vòng, chỉ có định vô tướng được chỉ rõ.
Tenāha ‘‘yāvañcida’’nti.
Therefore, it is said: "yāvañcida" (insofar as this).
Do đó nói “yāvañcida” (cho đến khi nào).
Niddosoti vītarāgādinā niddoso.
Niddoso means faultless due to being without passion (vītarāga) and so on.
Niddoso (không lỗi lầm) nghĩa là không lỗi lầm do đã ly tham, v.v..
Nāgenāti buddhanāgena aṅkusarahitena.
Nāgenā means by the Buddha-elephant, without a goad.
Nāgena (bởi con voi) nghĩa là bởi Phật voi không có móc câu.
Tato eva ujubhūtena cittena.
Therefore, with a mind that is upright.
Do đó cittena (bởi tâm) ngay thẳng.
Īsādantassa naṅgalasadisadantassa hatthino evaṃ cittaṃ sameti.
The mind of an elephant with tusks like a plowshare Īsādantassa is settled in this way.
Tâm của con voi có ngà giống như cái cày thì hòa hợp như vậy.
Tattha kāraṇamāha ‘‘yadeko ramatī vane’’ti.
The reason for this is stated: "when he delights alone in the forest."
Ở đó, lý do được nói là “yadeko ramatī vane” (khi một mình vui thích trong rừng).
Etena kāyavivekena ratisāmaññaṃ vadati.
By this, it speaks of the common delight through physical seclusion.
Qua điều này, nói về sự tương đồng của niềm vui với sự độc cư thân.
Āsavānaṃ khayoti idha arahattaṃ adhippetaṃ, taṃ pana aggamaggānantaramevāti āha ‘‘maggānantaraṃ arahattaphala’’nti.
Āsavānaṃ khayo here refers to arahantship, but it comes immediately after the highest path, so it says: "arahantship is the fruit immediately after the path."
Āsavānaṃ khayo (sự diệt trừ các lậu hoặc) ở đây ý muốn nói đến A-la-hán quả, điều đó xảy ra ngay sau đạo quả tối thượng, nên nói “maggānantaraṃ arahattaphala” (A-la-hán quả ngay sau đạo quả).
Vicayo desanāpaññā adhippetā, sā ca anekadhā pavattā evāti vuttaṃ ‘‘vicayaso’’ti, anekakkhattuṃ pavattamānāpi vicayo evāti katvā ‘‘vicayenā’’ti attho vutto.
Vicayo (investigation) refers to the wisdom of teaching, and since it occurred in various ways, it is said: "vicayaso" (through investigation), and even when occurring many times, it is still investigation, thus the meaning is given as "vicayenā" (by investigation).
Vicaya (sự phân tích) ý muốn nói đến tuệ thuyết pháp, và nó đã được thực hành theo nhiều cách, nên nói “vicayaso” (theo cách phân tích), ngay cả khi được thực hành nhiều lần, nó vẫn là sự phân tích, nên ý nghĩa được nói là “vicayenā” (bởi sự phân tích).
Sāsanadhammoti sīlakkhandhādiparidīpano pariyattidhammo.
Sāsanadhammo means the Dhamma of the Dispensation, which elucidates the aggregates of virtue (sīlakkhandha) and so on.
Sāsanadhammo (pháp giáo) nghĩa là pháp học được giải thích bởi giới uẩn, v.v..
Parivitakko udapādi ‘‘cattāro satipaṭṭhānā’’tiādinā, evaṃ koṭṭhāsato paricchijja desite mayā dhamme katamassa jānanassa antarā āsavānaṃ khayo hotīti ekaccassa kaṅkhā hotiyevāti adhippāyo.
Parivitakko udapādi (a thought arose) "the four foundations of mindfulness" and so on; the intention is that in the Dhamma taught by me, divided into categories in this way, some might still have doubt as to at which point of knowing there occurs the destruction of the taints.
Parivitakko udapādi (ý nghĩ đã phát sinh) “bốn niệm xứ” v.v., ý muốn nói rằng khi pháp được Đức Phật thuyết giảng theo từng phần như vậy, thì một số người có thể có nghi ngờ rằng lậu hoặc diệt trừ ở giai đoạn hiểu biết nào.
Diṭṭhi eva samanupassanā diṭṭhisamanupassanā.
Insight (samanupassanā) is indeed view (diṭṭhi), hence diṭṭhisamanupassanā (insight into views).
Diṭṭhi (kiến) chính là sự quán sát, diṭṭhisamanupassanā (sự quán sát kiến).
Diṭṭhisaṅkhāroti diṭṭhipaccayo saṅkhāro.
Diṭṭhisaṅkhāro means a formation conditioned by view.
Diṭṭhisaṅkhāro (hành kiến) nghĩa là hành duyên bởi kiến.
Tato eva taṇhāpaccayo hotīti vuttaṃ ‘‘tatojo so saṅkhāro’’ti.
Therefore, it is said: "tatojo so saṅkhāro" (that formation is born of that), meaning it is also conditioned by craving.
Do đó, nó là duyên của tham ái, nên nói “tatojo so saṅkhāro” (hành đó sinh từ đó).
Tato taṇhāto so saṅkhāro jātoti catūsu esa diṭṭhisaṅkhāro diṭṭhūpanissayo saṅkhāro jāyati.
Tato taṇhāto so saṅkhāro jāto (that formation is born of that craving) – this view-formation, this view-supported formation, arises in these four instances.
Tato taṇhāto so saṅkhāro jāto (hành đó sinh từ tham ái đó) nghĩa là hành kiến này, hành nương tựa vào kiến, sinh ra trong bốn điều đó.
Avijjāsamphassoti avijjāsampayuttasamphasso.
Avijjāsamphasso means contact associated with ignorance.
Avijjāsamphasso (xúc vô minh) nghĩa là xúc tương ưng với vô minh.
Evamettha bhagavā saḷāyatananāmarūpaviññāṇāni saṅkhārapakkhikāneva katvā dasseti.
Thus, here the Blessed One shows the six sense bases, mind-and-matter, and consciousness as belonging to the category of formations.
Như vậy, ở đây Đức Thế Tôn chỉ ra rằng sáu xứ, danh sắc, thức đều thuộc về hành.
Ettake ṭhāneti ‘‘idha bhikkhave assutavā puthujjano’’tiādiṃ katvā yāva ‘‘na me bhavissatī’’ti ettake ṭhāne.
Ettake ṭhāne means in this much scope, from "Here, bhikkhus, the uninstructed ordinary person" and so on, up to "it will not be for me."
Ettake ṭhāne (ở những chỗ này) nghĩa là từ “Ở đây, này các tỳ khưu, phàm nhân không được nghe giáo pháp” v.v., cho đến “Tôi sẽ không có” ở những chỗ này.
Gahitagahitadiṭṭhinti sakkāyadiṭṭhiyā ‘‘so attā, so loko’’tiādinā pavattaṃ sassatadiṭṭhiṃ, no cassaṃ, no ca me siyā’’tiādinā pavattaṃ ucchedadiṭṭhinti tathā tathā gahitadiṭṭhiṃ.
Gahitagahitadiṭṭhiṃ means the view grasped in various ways, such as the view of self (sakkāyadiṭṭhi) "that is self, that is the world" and so on, the eternalist view (sassatadiṭṭhi), and the annihilationist view (ucchedadiṭṭhi) "I would not be, nor would it be for me" and so on.
Gahitagahitadiṭṭhiṃ (kiến đã chấp thủ) nghĩa là kiến chấp thủ như vậy, ví dụ như tà kiến thân kiến “đó là tự ngã, đó là thế giới” v.v., tà kiến thường kiến, tà kiến đoạn kiến “tôi không có, tôi sẽ không có” v.v..
‘‘Iti kho, bhikkhave, sopi saṅkhāro anicco’’tiādidesanāya vissajjāpento āgato.
He came dispelling through teachings such as "Thus, bhikkhus, that formation is impermanent" and so on.
Đức Phật đã vissajjāpento āgato (đến để giải thích) bằng bài thuyết pháp “Như vậy, này các tỳ khưu, hành đó cũng là vô thường” v.v..
Tattha tatthevāssa uppannadiṭṭhivivecanato imissā desanāya puggalajjhāsayena pavattitatā veditabbā, tevīsatiyā ṭhānesu arahattapāpanena desanāvilāso.
Since the views that arose in those specific places were elucidated, it should be understood that this teaching puggalajjhāsayena (according to the individual's disposition) was presented, and the desanāvilāso (elaboration of the teaching) led to arahantship in twenty-three instances.
Do sự phân tích các kiến chấp đã phát sinh ở đó, nên cần phải biết rằng bài thuyết pháp này đã được thực hành puggalajjhāsayena (theo khuynh hướng của cá nhân), và desanāvilāso (sự phong phú của bài thuyết pháp) là do đạt được A-la-hán quả ở hai mươi ba chỗ.
Tatojo so saṅkhāroti tato vicikicchāya paccayabhūtataṇhāto jāto vicikicchāya sampayutto saṅkhāro.
Tatojo so saṅkhāro means that formation, associated with doubt, is born of that craving which is the condition for doubt.
Tatojo so saṅkhāro (hành đó sinh từ đó) nghĩa là hành tương ưng với nghi ngờ, sinh ra từ tham ái là duyên của nghi ngờ.
Yadi sahajātādipaccayavasena tato taṇhāto jātoti tatojo saṅkhāroti vucceyya, idamayuttanti dassento ‘‘taṇhāsampayutta…pe… jāyatī’’ti codeti.
If it were to be said that 'that formation is born of that craving' in the sense of conascent and so on, this would be inappropriate, so it challenges: "taṇhāsampayutta…pe… jāyatī" (associated with craving... arises).
Nếu nói rằng hành đó sinh từ tham ái đó theo duyên đồng sinh, v.v., thì điều này không hợp lý, nên hỏi “taṇhāsampayutta…pe… jāyatī” (tương ưng với tham ái… v.v… sinh ra).
Itaro upanissayakoṭi idhādhippetāti dassento ‘‘appahīnattā’’ti vatvā ‘‘yassa hī’’tiādinā tamatthaṃ vivarati.
The other (the commentator) explains that the conditioning factor (upanissaya) is intended here, saying "appahīnattā" (because it is not abandoned) and elucidates that meaning with "yassa hī" (for whom indeed) and so on.
Người kia chỉ ra rằng ở đây ý muốn nói đến khía cạnh nương tựa, nên nói “appahīnattā” (vì chưa đoạn trừ) và giải thích ý nghĩa đó bằng “yassa hī” (vì của ai) v.v..
Na hi taṇhāya vicikicchā sambhavati.
For doubt does not arise from craving.
Vì nghi ngờ không thể phát sinh từ tham ái.
Yadi asati sahajātakoṭiyā upanissayakoṭiyā taṇhāpaccayā vicikicchāya sambhavo eva.
If there is no conascent condition, there is indeed a possibility of doubt arising from craving as an enabling condition.
Nếu không có khía cạnh đồng sinh, thì nghi ngờ có thể phát sinh từ duyên tham ái theo khía cạnh nương tựa.
Diṭṭhiyāpīti dvāsaṭṭhidiṭṭhiyāpi.
Diṭṭhiyāpī means also by the sixty-two views.
Diṭṭhiyāpī (ngay cả bởi kiến) nghĩa là ngay cả bởi sáu mươi hai kiến.
Tenāha ‘‘catūsu hī’’tiādi.
Therefore, it is said: "catūsu hī" (for in the four) and so on.
Do đó nói “catūsu hī” (vì trong bốn điều) v.v..
Vīsati sakkāyadiṭṭhiyo sassatadiṭṭhiṃ ucchedadiṭṭhiṃ vicikicchañca pakkhipitvā paccekaṃ aniccatāmukhena vipassanaṃ dassetvā arahattaṃ pāpetvā desanā niṭṭhāpitāti āha ‘‘tevīsatiyā ṭhānesū’’tiādi.
Having included the twenty views of self (sakkāyadiṭṭhi), the eternalist view (sassatadiṭṭhi), the annihilationist view (ucchedadiṭṭhi), and doubt (vicikicchā), and having shown insight (vipassanā) through the aspect of impermanence for each, and having led to arahantship, the teaching is concluded, so it is said: "tevīsatiyā ṭhānesū" (in twenty-three instances) and so on.
Bài thuyết pháp đã được hoàn tất bằng cách bao gồm hai mươi tà kiến thân kiến, tà kiến thường kiến, tà kiến đoạn kiến và nghi ngờ, sau đó chỉ ra sự quán vô thường qua từng cái một và dẫn đến A-la-hán quả, nên nói “tevīsatiyā ṭhānesū” (ở hai mươi ba chỗ) v.v..
82. Dissati apadissatīti deso, kāraṇaṃ, tañca kho ñāpakaṃ daṭṭhabbaṃ.
82. That which is seen or shown is deso (a spot/reason), which should be understood as a means of knowing.
82. Điều được thấy, được chỉ ra là deso (chỗ), tức là lý do, và điều đó cần được hiểu là một dấu hiệu.
Yañhi so jānitukāmo ruppanādisabhāvaṃ, paṭhamaṃ pana sarūpaṃ pucchitvā puna tassa viseso pucchitabboti paṭhamaṃ ‘‘ime nu kho’’tiādinā pucchaṃ karoti, idhāpi ca so viseso eva tassa bhikkhuno antanti dasseti.
For, wishing to know the nature of impermanence and so forth, he first asks about its characteristics and then asks about its specifics, so he first asks with "Are these then...", and here too, it shows that those specifics are the bhikkhu's aim.
Vì vị ấy muốn biết bản chất của sự biến hoại, v.v., nên trước hết hỏi về hình tướng, rồi sau đó hỏi về đặc điểm của nó, do đó trước tiên đặt câu hỏi bằng cách nói “Phải chăng những điều này…”, và ở đây cũng chỉ ra rằng chính đặc điểm đó là mục đích của vị tỳ khưu ấy.
Ajānanto viya pucchati tesaṃ hetunti adhippāyo.
The intention is that he asks as if not knowing their cause.
Ý muốn nói là hỏi về nguyên nhân của chúng như thể không biết.
Taṇhāchandamūlakā pabhavattā.
Having craving and desire as their root because they originate from them.
Vì chúng có nguồn gốc từ tham ái và dục lạc.
Pañcupādānakkhandhāti ettha visesato taṇhupādānassa gahaṇaṃ itarassa taggahaṇeneva gahitaṃ tadavinābhāvatoti chandarāgo eva uddhaṭo.
In "the five aggregates of clinging," the specific inclusion of craving-clinging (taṇhupādāna) implies the inclusion of the others (upādāna), as they are inseparable from it; thus, merely sensual desire (chandarāga) is highlighted.
Trong cụm từ năm uẩn chấp thủ, việc nắm giữ chấp thủ tham ái được đặc biệt đề cập, còn những chấp thủ khác được bao hàm trong đó vì chúng không thể tách rời, do đó chỉ có dục lạc được nêu bật.
Idanti tappañhapaṭikkhipanaṃ.
This is the rejection of that question.
Điều này là sự bác bỏ câu hỏi đó.
Yadipi khandhā upādānehi asahajātāpi honti upādānassa anārammaṇabhūtāpi, upādānaṃ pana tehi sahajātameva, tadārammaṇañca hotiyevāti dasseti.
Although aggregates may be non-concomitant with clingings and not be objects of clinging, clinging itself is concomitant with them and is indeed their object; thus, it shows this.
Mặc dù các uẩn có thể không đồng sinh với các chấp thủ và cũng không là đối tượng của chấp thủ, nhưng chấp thủ thì đồng sinh với chúng, và luôn là đối tượng của chúng, điều này được chỉ ra.
Na hi asahajātaṃ anārammaṇañca upādānaṃ atthīti.
For there is no clinging that is non-concomitant or not an object.
Vì không có chấp thủ nào không đồng sinh và không là đối tượng.
Idāni tamatthaṃ vivaritvā dassetuṃ ‘‘taṇhāsampayuttasmi’’ntiādi vuttaṃ, taṃ suviññeyyameva.
Now, to clarify and show that meaning, "When conjoined with craving" and so forth was said, which is indeed easy to understand.
Bây giờ, để giải thích ý nghĩa đó, câu “khi hiệp thế với tham ái” đã được nói, điều đó rất dễ hiểu.
Ārammaṇatoti ārammaṇakaraṇato.
Due to being an object means due to making it an object.
Từ đối tượng có nghĩa là do tạo thành đối tượng.
‘‘Evaṃrūpo siya’’nti evaṃpavattassa chandarāgassa ‘‘evaṃvedano siya’’nti evaṃpavattiyā abhāvato tattha tattheva natasaṅkhārā bhijjanti, tasmā rūpavedanārammaṇānaṃ chandarāgādīnaṃ abhāvato attheva chandarāgavemattatā.
Since the sensual desire (chandarāga) that thus arises as "May it be of such a form" does not arise as "May it be of such a feeling," the conditioned things (saṅkhārā) become different in each case; therefore, due to the absence of sensual desire and so forth being objects of form and feeling, there is dissimilarity of sensual desire.
Vì dục lạc phát sinh như “mong muốn có hình sắc như vậy” không có sự phát sinh như “mong muốn có cảm thọ như vậy”, nên các hành được tập hợp ở đó bị tan rã ở chính nơi đó. Do đó, vì không có dục lạc, v.v. là đối tượng của sắc và thọ, nên sự khác biệt của dục lạc là có.
Chandarāgassa pahānādivasena chandarāgapaṭisaṃyuttassa apucchitattā, ‘‘anusandhi na ghaṭiyatī’’ti vuttaṃ.
Since sensual desire conjoined with sensual desire's abandonment and so forth was not asked, it was said, "the connection is not established."
Vì không hỏi về dục lạc liên hệ với sự đoạn trừ dục lạc, v.v., nên đã nói “không thể kết nối”.
Kiñcāpi na ghaṭiyatīti aññasseva pucchitattā, tathāpi sānusandhikāva pucchā, tato eva sānusandhikaṃ vissajjanaṃ.
Although it is not established because something else was asked, still the question is connected, and from that, the answer is connected.
Mặc dù không thể kết nối, vì đã hỏi về điều khác, nhưng câu hỏi vẫn có sự kết nối, và từ đó câu trả lời cũng có sự kết nối.
Tattha kāraṇamāha ‘‘tesaṃ tesa’’ntiādinā.
Here, the reason is stated with "of these and those" and so forth.
Lý do được nói bằng cách “của những điều đó”, v.v.
Tena ajjhāsayānusandhivasena sānusandhikāneva pucchāvissajjanānīti dasseti.
Thus, it shows that the questions and answers are connected by way of intention and connection.
Điều đó cho thấy rằng các câu hỏi và câu trả lời đều có sự kết nối theo ý định.
83. Paṭiccāti nissayaṃ katvā.
83. Paṭiccā means making it a support.
83. Nương vào có nghĩa là lấy làm nương tựa.
‘‘Esohamasmī’’ti diṭṭhiggāho, ‘‘seyyohamasmī’’ti mānaggāho ca taṇhāvaseneva hontīti taṇhāpi tathāpavattiyā paccayabhūtā tathāpavatti evāti vuttaṃ ‘‘asmīti evaṃ pavattaṃ taṇhāmānadiṭṭhipapañcattayaṃ hotī’’ti.
The view of "I am this" and the conceit of "I am superior" arise solely due to craving, and craving itself is a cause of such arising, being such an arising; thus, it was said: "the three-fold proliferation of craving, conceit, and view that arises as 'I am'."
Sự chấp thủ tà kiến “ta là thế này” và sự chấp thủ kiêu mạn “ta tốt hơn thế này” đều phát sinh do tham ái, nên tham ái cũng là nguyên nhân của sự phát sinh như vậy, chính là sự phát sinh như vậy, do đó đã nói “ba loại hý luận tham ái, kiêu mạn, tà kiến phát sinh như ‘ta là’”.
Daharasaddo bāladārakepi pavattatīti tato visesanatthaṃ ‘‘yuvā’’ti vuttaṃ.
Since the word dahara applies even to a young child, "young" was said to distinguish it.
Từ “dahara” (trẻ) cũng được dùng cho trẻ con, nên để phân biệt đã nói “yuvā” (thanh niên).
Yuvāpi eko amaṇḍanasīloti tato visesanatthaṃ ‘‘maṇḍanakajātiko’’ti vuttaṃ.
Since a young person might also be someone not inclined to adornment, "fond of adornment" was said to distinguish it.
Cũng có một người thanh niên không thích trang điểm, nên để phân biệt đã nói “maṇḍanakajātiko” (người thích trang điểm).
Tena mukhanimittapaccavekkhaṇassa sabbhāvaṃ dasseti.
Thereby, it shows the presence of observing one's facial features.
Điều đó cho thấy sự hiện hữu của việc xem xét hình ảnh khuôn mặt.
Tanti ādāsamaṇḍalaṃ olokayato.
It refers to one looking at a mirror.
Điều đó là khi nhìn vào gương.
Parammukhaṃ hutvā paññāyeyyāti yadi puratthimadisābhimukhaṃ hutvā ṭhitaṃ, mukhanimittampi puratthimadisābhimukhameva hutvā paññāyeyyāti attho.
It would appear averted means that if one stands facing the eastern direction, the facial features would also appear facing the eastern direction.
Hiện ra quay lưng lại có nghĩa là nếu đứng quay mặt về hướng đông, thì hình ảnh khuôn mặt cũng hiện ra quay mặt về hướng đông.
Yadipi parassa sadisassa mukhaṃ bhaveyya, tathāpi kāci asadisatā bhaveyyāti vuttaṃ ‘‘vaṇṇādīhi asadisaṃ hutvā paññāyeyyā’’ti.
Although it might be the face of another similar person, there might be some dissimilarity, so it was said, "it would appear dissimilar in color and so forth."
Mặc dù có thể là khuôn mặt giống với người khác, nhưng vẫn có thể có một số điểm không giống, nên đã nói “hiện ra không giống về sắc thái, v.v.”.
Nibhāsarūpanti paṭibhāsarūpaṃ.
Image means a reflected image.
Hình ảnh phản chiếu là hình ảnh đối diện.
Nibhāsarūpaṃ tāva kaṃsādimaye pabhassare maṇḍale paññāyatu, udake pana kathanti ‘‘kena kāraṇenā’’ti pucchati.
Since an image appears in a luminous disc made of bronze and so forth, but how does it appear in water? So, it asks, "for what reason?"
Hình ảnh phản chiếu có thể hiện ra trong gương sáng làm bằng đồng, v.v., nhưng trong nước thì sao? Do đó hỏi “do nguyên nhân nào?”.
Itaro ‘‘mahābhūtānaṃ visuddhatāyā’’ti vadanto tatthāpi yathāladdhapabhassarabhāvenevāti dasseti.
The other replies, "due to the purity of the great elements," showing that there too it is due to the inherent luminous nature.
Người kia trả lời “do sự trong sạch của các đại chủng”, điều đó cho thấy rằng ở đó cũng do bản chất sáng chói vốn có.
Ettha ca maṇḍanajātiko puriso viya puthujjano, ādāsatalādayo viya pañcakkhandhā, mukhanimittaṃ viya ‘‘asmī’’ti gahaṇaṃ, mukhanimittaṃ upādāya dissamānarūpādi viya ‘‘asmī’’ti sati ‘‘ahamasmī’’ti ‘‘parosmī’’tiādayo gāhavisesā.
Here, the person fond of adornment is like a worldling (puthujjana), the mirror and so forth are like the five aggregates, the facial features are like the grasping of "I am," and the various grasps such as "I am I" or "I am another" are like the form and so forth seen by taking the facial features as a basis.
Ở đây, người thích trang điểm ví như phàm nhân, bề mặt gương, v.v. ví như năm uẩn, sự chấp thủ “ta là” ví như hình ảnh khuôn mặt, các loại chấp thủ đặc biệt như “ta là”, “người khác là” ví như sắc, v.v. hiện ra do hình ảnh khuôn mặt.
Abhisametoti abhisamito, ayameva vā pāṭho.
Abhisameto means abhisamito, or this indeed is the reading.
Đã thấu hiểu là đã hiểu rõ, hoặc đây là cách đọc đúng.
84. Madhurakaṃ vuccati kāye vibhāranti āha – ‘‘madhurakajāto viyāti sañjātagarubhāvo viyā’’ti.
84. Madhuraka is said to be a burden on the body, so it says: "like one affected by madhuraka means like one who has developed heaviness."
84. “Madhuraka” được gọi là sự nặng nề trong thân, nên nói – “như thể bị madhuraka, tức như thể phát sinh sự nặng nề”.
Garubhāve sati lahutā anokāsāva, tathā mudutā kammaññatā cāti vuttaṃ ‘‘akammañño’’ti.
When there is heaviness, lightness is impossible, and similarly, softness and pliancy are impossible, so it was said, "unworkable."
Khi có sự nặng nề, sự nhẹ nhàng không có chỗ, cũng như sự mềm mại và sự dễ điều khiển, do đó đã nói “không dễ điều khiển”.
‘‘Kāye’’ti ānetvā vattabbaṃ.
"In the body" should be brought in and stated.
Phải thêm từ “trong thân” vào để nói.
Na pakkhāyantīti pakāsā hutvā na khāyanti.
Do not shine forth means they do not appear luminous.
Không hiện rõ có nghĩa là không hiện ra rõ ràng.
Tenāha ‘‘na pākaṭā hontī’’ti.
Therefore, he says, "they are not evident."
Do đó nói “không hiện rõ”.
Upaṭṭhahantīti upatiṭṭhanti.
Upaṭṭhahantī means they stand ready.
Hiện diện có nghĩa là đứng vững.
Na dissatīti gahaṇaṃ na gacchati.
It is not seen means it does not come into perception.
Không thấy có nghĩa là không bị chấp thủ.
Mahāvicikicchāti aṭṭhavatthukā soḷasavatthukā ca vimati.
Great perplexity means doubt regarding eight or sixteen things.
Đại hoài nghi là sự nghi ngờ có tám hoặc mười sáu đối tượng.
Na hi uppajjati paripakkakusalamūlattā.
Indeed, it does not arise because of fully developed roots of skillfulness.
Không phát sinh vì căn lành đã chín muồi.
Anuyogavattaṃ nāma yena yutto, tassa attano gāhaṃ nijjhānakkhantiyāva yāthāvato pavedanaṃ.
Anuyogavattaṃ (course of inquiry) means for one who is qualified by it, the true declaration of one's own grasp through observation and acceptance.
Thực hành thẩm vấn là việc người bị thẩm vấn trình bày chân thực sự chấp thủ của mình theo sự chấp nhận của trí tuệ.
Therassa anuyoge bhummanti ‘‘taṃ kiṃ maññasi, āvuso yamakā’’tiādinā therena kathitapucchāya bhummaniddeso.
"In the Elder's inquiry, it is fundamental" refers to the fundamental explanation of the question stated by the Elder, "What do you think, friend Yamaka?" and so forth.
Trong sự thẩm vấn của Trưởng lão là sự chỉ định về nền tảng của câu hỏi do Trưởng lão nói: “Này hiền giả Yamaka, ông nghĩ sao?”
Sace taṃ āvusoti idanti ‘‘sace taṃ, āvuso’’ti evamādikaṃ idaṃ vacanaṃ.
"If you, friend" refers to this means this statement, "If you, friend," and so forth.
Nếu là ông, này hiền giả, điều này có nghĩa là câu nói này bắt đầu bằng “Nếu là ông, này hiền giả”.
Etanti yamakattheraṃ.
This refers to Elder Yamaka.
Người đó là Trưởng lão Yamaka.
Aññanti arahattaṃ.
Other refers to Arahantship.
Khác là A-la-hán quả.
Vattabbākārena vadanto atthato arahattaṃ byākaronto nāma hotīti adhippāyena vadati.
Speaking in the manner of declaration, he speaks with the intention that it amounts to declaring Arahantship in terms of meaning.
Khi nói theo cách phải nói, thì theo ý nghĩa, là đang tuyên bố A-la-hán quả.
Upetīti taṇhupayadiṭṭhupayehi upādiyati taṇhādiṭṭhivatthuṃ pappoti.
Upeti means it grasps a craving-view object, it reaches it by means of the clingings of craving and view.
Chấp thủ có nghĩa là chấp thủ đối tượng của tham ái và tà kiến bằng cách chấp thủ tham ái và tà kiến.
Upādiyatīti daḷhaggāhaṃ gaṇhāti.
Upādiyatī means it grasps firmly.
Chấp chặt có nghĩa là nắm giữ một cách vững chắc.
Adhitiṭṭhatīti abhinivissa tiṭṭhati.
Adhitiṭṭhatī means it adheres firmly.
An trú có nghĩa là an trú một cách kiên cố.
‘‘Attā me’’ti.
"This is my self."
“Tự ngã của tôi”.
Paccatthikā me eteti ete rūpavedanādayo pañcupādānakkhandhā mayhaṃ paccatthikā anatthāvahattāti vipassanāñāṇena ñatvā.
"These are my adversaries" means knowing through insight-knowledge that these five aggregates of clinging, such as form and feeling, are my adversaries, bringing harm.
Những điều này là kẻ thù của tôi có nghĩa là biết bằng tuệ quán rằng năm uẩn chấp thủ này như sắc, thọ, v.v. là kẻ thù của tôi, vì chúng mang lại bất lợi.
Vipassanāya yojetvāti vipassanāya khandhe yojetvā.
Applying by insight means applying the aggregates by insight.
Kết hợp với tuệ quán có nghĩa là kết hợp các uẩn với tuệ quán.
86. Tasseva vihārassāti mahāvane yasmiṃ vihāre bhagavā viharati, tasseva vihārassa.
86. Of that same dwelling means of that same dwelling in the great forest where the Blessed One was dwelling.
86. Của chính trú xứ đó là của chính trú xứ Mahāvana, nơi Đức Thế Tôn đang trú ngụ.
Imeti aññatitthiyā.
These refers to other sectarians.
Những người này là những người ngoại đạo.
Yasmā ayaṃ thero ṭhapanīyaṃ pañhaṃ ṭhapanīyabhāvena na ṭhapesi, tasmā.
Because this elder did not set aside a question that should be set aside in the manner of being set aside, therefore.
Bởi vì vị Trưởng lão này đã không gác lại câu hỏi cần được gác lại theo cách gác lại, cho nên.
Aññatitthiyā…pe… etadavocuṃ.
Sectarians… (and so on) …said this.
Các ngoại đạo…v.v… đã nói điều này.
Tenāha ‘‘ekadesena sāsanasamayaṃ jānantā’’ti.
Therefore, it is said: "knowing the teaching's system only in part."
Do đó, đã nói ‘‘biết giáo pháp một phần’’.
87. Nagaramajjhe mahāābādho uppajjīti nagaramajjhena āgacchanto kammasamuṭṭhāno mahanto ābādho uppajjati.
87. A great affliction arose in the midst of the city: A great affliction, karmically produced, arose, affecting those who came through the city center.
87. Một bệnh nặng nổi lên giữa thành phố là một bệnh nặng do nghiệp khởi lên khi đi ngang qua giữa thành phố.
Samantato adhosīti sabbabhāgena paripphandi.
It encompassed him all around: It afflicted him in every way.
Xung quanh đều bị ảnh hưởng là bị ảnh hưởng khắp mọi phần.
Iriyāpathaṃ yāpetunti sayananisajjādibhedaṃ iriyāpathaṃ pavattetuṃ.
To maintain a posture: To maintain a bodily posture (iriyāpatha) such as lying down or sitting.
Để duy trì oai nghi là để duy trì oai nghi gồm các tư thế nằm, ngồi v.v….
Nivattantīti osakkanti, parihāyantīti attho.
They decrease: They recede, they decline; this is the meaning.
Lui sụt là lùi lại, tức là suy yếu.
Adhigacchantīti vaḍḍhanti.
They increase: They grow.
Đạt được là tăng trưởng.
Satthu guṇasarīraṃ nāma navavidhalokuttaradhammādhigamamūlanti katvā vuttaṃ ‘‘navavidho hi…pe… kāyo nāmā’’ti, yathā sattānaṃ kāyo paṭisandhimūlako.
Having understood that the Buddha's body of qualities (guṇasarīra) is rooted in the attainment of the nine supramundane qualities (navavidhalokuttaradhamma), it is said: "for the ninefold… (and so on) …body", just as the body of beings is rooted in rebirth-linking (paṭisandhi).
Thân công đức của Đức Phật là căn bản của sự thành tựu chín pháp siêu thế, nên đã nói ‘‘chín loại…v.v… gọi là thân’’, giống như thân của chúng sanh có gốc rễ từ tái sanh.
Kāḷasilāyaṃ katavihāro kāḷasilāvihāro.
A monastery built on a black rock is Kāḷasilāvihāra.
Tu viện được xây dựng trên tảng đá đen là tu viện Kāḷasilā.
Maggavimokkhatthāyāti aggamaggavimokkhādhigamāya.
For the sake of the path and liberation: For the attainment of the supreme path and liberation.
Vì sự giải thoát đạo là vì sự thành tựu giải thoát đạo tối thượng.
Devatāti suddhāvāsadevatā.
A deity: A Suddhāvāsa deity.
Chư thiên là chư thiên Tịnh Cư Thiên.
Alāmakaṃ nāma puthujjanakālakiriyāya abhāvato.
Not mean: Because there is no death of a worldling.
Không tầm thường là vì không có sự chết của phàm phu.
Tenāha ‘‘thero kirā’’tiādi.
Therefore, it is said: "it is said the elder…" (and so on).
Do đó, đã nói ‘‘vị Trưởng lão này được biết là’’ v.v….
Ekaṃ dve ñāṇānīti ekaṃ dve paccavekkhaṇañāṇāni sabhāvato avassaṃ uppajjanti, ayaṃ dhammatā.
One or two knowledges: One or two reviewing knowledges (paccavekkhaṇañāṇa) necessarily arise by nature; this is the norm (dhammatā).
Một hoặc hai tuệ là một hoặc hai tuệ quán xét chắc chắn khởi lên theo tự tánh, đây là một định luật tự nhiên.
Maggaphalanibbānapaccavekkhaṇāni taṃtaṃmaggavuṭṭhāne uppajjanti eva.
The reviewing of the path, fruition, and Nibbāna always arises upon emergence from that particular path.
Các tuệ quán xét đạo, quả, Niết Bàn chắc chắn khởi lên khi xuất khỏi đạo tương ứng.
Ekaṃ dveti vacanaṃ uppannabhāvadassanatthaṃ vuttaṃ.
The phrase "one or two" is said to indicate the state of having arisen.
Lời nói ‘‘một hoặc hai’’ được nói ra để chỉ sự khởi lên.
88. Passambhitvāti nirodhetvā.
88. Having calmed: Having ceased.
88. Làm cho lắng xuống là làm cho chấm dứt.
No ca svāhanti no ca su ahaṃ.
But I am not: No, indeed I am not.
Không phải ta là không phải chính ta.
Parihāyi kuppadhammattā.
Declined: Being subject to agitation.
Suy yếu vì có tính chất bị khuấy động.
Etanti samādhimattasāraṃ, sīlamatte pana vattabbameva natthi.
This: What is merely concentration; there is nothing to be said about mere moral conduct.
Điều này là chỉ cốt lõi của thiền định, còn về giới thì không cần phải nói.
Kathaṃ hotīti kathaṃ abhinandanā hoti.
How does it happen?: How does delighting occur?
Xảy ra như thế nào là sự hoan hỷ xảy ra như thế nào.
Dukkhaṃ patvāti dukkhuppattihetu sukhaṃ pattheti ‘‘evaṃ me dukkhapariḷāho na bhavissatī’’ti.
Having met with suffering: Due to the arising of suffering, one craves for pleasure, thinking: "Thus, my burning pain will not be."
Khi gặp khổ là vì nguyên nhân khổ khởi lên, mong cầu lạc ‘‘để sự thiêu đốt của khổ này không xảy ra cho ta’’.
Yadaggenāti yena bhāgena.
By which part: By which aspect.
Bằng phần nào là bằng phần đó.
‘‘Dukkhaṃ patthetiyevā’’ti vatvā tattha kāraṇamāha ‘‘sukhavipariṇāmena hī’’tiādi.
Having said "one still craves for suffering," the reason for this is given: "for by the alteration of pleasure…" (and so on).
Sau khi nói ‘‘chắc chắn mong cầu khổ’’, tại đó đã nói lý do ‘‘vì sự biến đổi của lạc’’ v.v….
Sukhaviparivatte sukhavipariṇāmadukkhaṃ, tasmā sukhaṃ abhinandanto atthato dukkhaṃ abhinandati nāma.
In the reversal of pleasure, there is the suffering of pleasure's alteration. Therefore, one who delights in pleasure is in essence delighting in suffering.
Trong sự biến đổi của lạc là khổ do sự biến đổi của lạc, do đó, người hoan hỷ lạc, về bản chất, là hoan hỷ khổ.
89. Attaniyanti diṭṭhigatikaparikappitassa attano santakaṃ.
89. One's own: Something belonging to oneself, conceived by the view-ridden person.
89. Là của mình là tài sản của cái tôi được tưởng tượng theo tà kiến.
Tenāha ‘‘attano parikkhārajāta’’nti.
Therefore, it is said: "one's own belongings."
Do đó, đã nói ‘‘các vật dụng của mình’’.
Taṇhāmāno adhigato arahattassa anadhigatattā, no diṭṭhimāno adhigato, tathā kāmarāgabyāpādāpi.
Craving and conceit were attained due to the non-attainment of Arahantship, not conceit of views; similarly for sensual lust and ill-will.
Tham ái và ngã mạn đã được thành tựu vì chưa thành tựu A-la-hán, ngã mạn chấp kiến chưa được thành tựu, và cũng vậy tham dục và sân hận.
Anāgāmī kira khemakatthero, ‘‘sakadāgāmī’’ti keci vadanti.
It is said that Elder Khemaka was an Anāgāmī; some say he was a Sakadāgāmī.
Được biết, Trưởng lão Khemaka là bậc Bất Lai, một số người nói là bậc Nhất Lai.
Sandhāvanikāyāti sañcaraṇena.
By wandering: By moving about.
Do sự đi lại là do sự đi lại.
Tenāha ‘‘punappunaṃ gamanāgamanenā’’ti.
Therefore, it is said: "by repeatedly going and coming."
Do đó, đã nói ‘‘do sự đi và đến nhiều lần’’.
Catukkhattuṃ gamanāgamanenāti catukkhattuṃ gamanena ca āgamanena ca.
By going and coming four times: By going and coming four times.
Do sự đi và đến bốn lần là do sự đi và đến bốn lần.
Tenāha – ‘‘taṃ divasaṃ dviyojanaṃ addhānaṃ āhiṇḍī’’ti.
Therefore, it is said: "that day he traveled a distance of two yojanas."
Do đó, đã nói – ‘‘ngày hôm đó đã đi lại một quãng đường hai dojana’’.
Ñatvāti ajjhāsayaṃ ñatvā.
Having known: Having known his inclination.
Biết là biết ý định.
Theroti khemakatthero.
The elder: Elder Khemaka.
Vị Trưởng lão là Trưởng lão Khemaka.
Kathetunti uddesavasena kathetuṃ.
To declare: To declare by way of outline.
Để nói là để nói theo cách tóm tắt.
Pakāsetunti niddesavasena tamatthaṃ pakāsetuṃ.
To explain: To explain that meaning by way of detailed exposition.
Để tuyên bố là để tuyên bố ý nghĩa đó theo cách chi tiết.
Jānāpetunti kāraṇavasena jānāpetuṃ.
To make known: To make known by way of reasoning.
Để làm cho hiểu rõ là để làm cho hiểu rõ theo cách lý do.
Patiṭṭhāpetunti kathāpetuṃ.
To establish: To cause to be spoken.
Để thiết lập là để làm cho nói ra.
Vivaṭaṃ kātunti udāharaṇaṃ vaṇṇetvā pākaṭaṃ kātuṃ.
To make manifest: To make clear by expounding with examples.
Để làm cho rõ ràng là sau khi mô tả ví dụ, làm cho nó rõ ràng.
Suvibhattaṃ kātunti anvayato byatirekato suṭṭhu, vibhattaṃ kātuṃ.
To make well-divided: To make well-divided by way of agreement and disagreement.
Để làm cho phân biệt rõ ràng là làm cho phân biệt rõ ràng theo cách thuận và nghịch.
Uttānakaṃ kātunti upanayanigamehi tamatthaṃ vibhūtaṃ kātuṃ.
To make plain: To make that meaning vivid by means of concluding analogies.
Để làm cho dễ hiểu là làm cho ý nghĩa đó hiển lộ bằng cách dẫn chứng và kết luận.
Aññena nīhārenāti vipassanāvimuttena cittābhinīhārena.
By another way: By a mental aspiration free from insight.
Bằng một cách khác là bằng sự hướng tâm thoát ly thiền quán.
Paritassanā upādānanti bhayaparitassanā diṭṭhupādānaṃ.
Agitation is clinging: Frightening agitation is clinging to views (diṭṭhupādāna).
Sự sợ hãi là chấp thủ là sự sợ hãi là chấp thủ tà kiến.
Anattani sati anattakatāni kammāni kamattānaṃ phusissantīti bhayaparitassanā ceva diṭṭhupādānañca uppajjati.
When there is no self, the thought "how will actions not done by a self affect a self?" leads to the arising of frightening agitation and clinging to views.
Khi không có ngã, các nghiệp không do ngã làm sẽ chạm đến ai, thì sự sợ hãi và chấp thủ tà kiến khởi lên.
Paṭinivattatīti yathāraddhavipassanāto paṭinivattati, nāsakkhīti attho.
He reverted: He reverted from the insight he had begun; that is, he was unable.
Lùi lại là lùi lại khỏi thiền quán đã bắt đầu, tức là không thể làm được.
Kasmā panetassa vipassanamanuyuñjantassa evaṃ ahosīti tattha kāraṇaṃ vadati ‘‘ayaṃ kirā’’tiādinā.
Why did this happen to him while practicing insight? The reason is stated: "for it is said…" (and so on).
Vì sao khi tu tập thiền quán lại xảy ra điều này cho vị ấy, tại đó đã nói lý do ‘‘được biết, vị này’’ v.v….
Evanti ‘‘ko nu kho me attā’’ti evaṃ na hoti.
Thus: "Who indeed is my self?" – thus it does not happen.
Như vậy là ‘‘cái ngã của ta là gì?’’ thì không phải như vậy.
Tāvatikā vissatthīti ‘‘mayhaṃ dhammaṃ desetū’’ti vuttavissāso atthīti attho.
Such confidence: The meaning is that there is confidence as expressed in "teach me the Dhamma."
Sự tin cậy như vậy là có sự tin cậy đã nói ‘‘hãy thuyết pháp cho tôi’’.
Idaṃ kaccānasatthaṃ addasāti yojanā.
This sentence is to be construed as: "he saw this Kaccāna Sutta."
Đây là sự kết nối ‘‘đã thấy giáo lý Kaccāna’’.
‘‘Dvayanissito, kaccāna, loko’’tiādi diṭṭhiviniveṭhanā.
"The world, Kaccāna, is supported by two" (Dvayanissito, kaccāna, loko) and so on, is the removal of views.
‘‘Này Kaccāna, thế gian dựa vào hai điều’’ v.v… là sự loại bỏ tà kiến.
‘‘Ete te, kaccāna, ubho ante anupagammā’’tiādi buddhabaladīpanā.
"These two extremes, Kaccāna, without approaching them" (Ete te, kaccāna, ubho ante anupagammā) and so on, is the demonstration of the Buddha's power.
‘‘Này Kaccāna, không đi theo hai cực đoan đó’’ v.v… là sự hiển lộ Phật lực.