Mūlapaṇṇāsa-ṭīkā

90

1. Mūlapariyāyasuttavaṇṇanā

1. Commentary on the Mūlapariyāya Sutta

1. Giải thích kinh Mūlapariyāya

91

Abbhantaranidānavaṇṇanā

Commentary on the Internal Introduction

Giải thích Nidāna nội bộ

92

1. Evaṃ bāhiranidāne vattabbaṃ atidisitvā idāni abhantaranidānaṃ ādito paṭṭhāya saṃvaṇṇetuṃ ‘‘yaṃ paneta’’ntiādi vuttaṃ.

Having thus referred to what is to be said in the external introduction, now, in order to comment on the internal introduction from the beginning, "But this..." and so forth is stated.

1. Sau khi đã chỉ dẫn những điều cần nói trong Nidāna bên ngoài, bây giờ để giải thích Nidāna nội bộ từ đầu, đã nói "yaṃ panetaṃ" (Tuy nhiên, điều này là), v.v.

Tattha yasmā saṃvaṇṇanaṃ karontena saṃvaṇṇetabbe dhamme padavibhāgaṃ padatthañca dassetvā tato paraṃ piṇḍattādidassanavasena saṃvaṇṇanā kātabbā, tasmā padāni tāva dassento ‘‘evanti nipātapada’’ntiādimāha.

Since a commentator, in commenting, must first show the division of words and the meaning of words in the Dhamma to be commented upon, and then make the commentary by showing its overall meaning and so forth, therefore, first showing the words, he says "The word evaṃ is a particle..." and so forth.

Ở đó, vì người giải thích cần phải trình bày sự phân chia từ (padavibhāga) và nghĩa của từ (padattha) trong các pháp cần giải thích, rồi sau đó mới giải thích bằng cách trình bày ý nghĩa tổng thể (piṇḍatthādidassanavasena), v.v., nên trước hết, để trình bày các từ, người viết đã nói "evaṃ-saddo tāvā" (Trước hết, từ evaṃ là một giới từ), v.v.

Tattha padavibhāgoti padānaṃ viseso, na padaviggaho.

Here, padavibhāgo means the distinction of words, not the grammatical analysis of words.

Ở đó, padavibhāgo (sự phân chia từ) là sự đặc biệt của các từ, không phải là sự phân tích từ (padaviggaho).

Atha vā padāni ca padavibhāgo ca padavibhāgo, padaviggaho ca padavibhāgo ca padavibhāgoti vā ekasesavasena padapadaviggahā padavibhāgasaddena vuttāti veditabbaṃ.

Alternatively, words and the distinction of words, or the grammatical analysis of words and the distinction of words, constitute padavibhāgo, or it should be understood that words and grammatical analysis of words are expressed by the term padavibhāgo in an elliptical sense.

Hoặc là, các từ và sự phân chia từ là padavibhāgo; và sự phân tích từ và sự phân chia từ là padavibhāgo, hoặc là theo cách ekasesa (còn lại một), các từ và sự phân tích từ được gọi bằng từ padavibhāga.

Tattha padaviggaho ‘‘subhagañca taṃ vanañcāti subhagavanaṃ, sālānaṃ rājā, sālo ca so rājā ca itipi sālarājā’’tiādivasena samāsapadesu daṭṭhabbo.

Here, the grammatical analysis of words (padaviggaho) should be seen in compound words such as "a beautiful forest" (subhagavanaṃ) (lit. "beautiful and that forest"), "king of sāla trees," or "a sāla tree and that king" (sālarājā).

Ở đó, sự phân tích từ (padaviggaho) cần được thấy trong các từ ghép theo cách "subhagañca taṃ vanañcāti subhagavanaṃ (rừng tốt đẹp), sālānaṃ rājā, sālo ca so rājā ca itipi sālarājā (vua của cây sāla, cây sāla đó cũng là vua, do đó là vua sāla)", v.v.

93

Atthatoti padatthato.

Atthato means according to the meaning of the word.

Atthato (về nghĩa) là về nghĩa của từ (padatthato).

Taṃ pana padatthaṃ atthuddhārakkamena paṭhamaṃ evaṃsaddassa dassento ‘‘evaṃ-saddo tāvā’’tiādimāha.

First showing that meaning of the word for the word evaṃ in the order of meaning extraction, he says "The word evaṃ first..." and so forth.

Để trình bày nghĩa của từ đó theo thứ tự trích nghĩa, trước hết, người viết đã nói "evaṃ-saddo tāvā" (Trước hết, từ evaṃ là), v.v., để trình bày nghĩa của từ evaṃ.

Avadhāraṇādīti ettha ādi-saddena idamatthapucchāparimāṇādiatthānaṃ saṅgaho daṭṭhabbo.

Here, in avadhāraṇādī (determinative, etc.), the term ādi (etc.) should be understood to include meanings like 'this', 'question', 'measure', etc.

Trong avadhāraṇādī (sự xác định, v.v.) ở đây, cần hiểu rằng từ ādi (v.v.) bao gồm các nghĩa như "điều này", "câu hỏi", "số lượng", v.v.

Tathā hi ‘‘evaṃgatāni puthusippāyatanāni (dī. ni. 1.163), evavidho evamākāro’’ti ca ādīsu idaṃ-saddassa atthe evaṃ-saddo.

Indeed, in phrases like "such diverse crafts" (D.N. 1.163) and "of such a kind, of such a form," the word evaṃ is used in the sense of the word idaṃ (this).

Thật vậy, trong các trường hợp như "evaṃgatāni puthusippāyatanāni (các nghề nghiệp đa dạng như thế này), evavidho evamākāro (kiểu cách như thế này)" v.v., từ evaṃ mang nghĩa của từ idaṃ (này).

Gata-saddo hi pakārapariyāyo, tathā vidhākāra-saddā ca.

For the word gata (gone) means 'kind', as do the words vidha (kind) and ākāra (form).

Từ gata (đến) là một từ đồng nghĩa với pakāra (cách thức), cũng như các từ vidha (loại) và ākāra (kiểu cách).

Tathā hi vidhayuttagata-sadde lokiyā pakāratthe vadanti.

Indeed, in worldly usage, people use vidha, yutta, and gata in the sense of 'kind' or 'manner'.

Thật vậy, trong đời thường, người ta dùng các từ vidhayuttagata để chỉ nghĩa "cách thức".

‘‘Evaṃ su te sunhātā suvilittā kappitakesamassū āmukkamaṇikuṇḍalābharaṇā odātavatthavasanā pañcahi kāmaguṇehi samappitā samaṅgībhūtā paricārenti, seyyathāpi tvaṃ etarahi sācariyakoti.

"Thus, are they, having bathed well, anointed well, with hair and beard trimmed, adorned with jeweled earrings, clad in white garments, endowed and replete with the five strands of sensual pleasure, serving you, just as you are now with your teachers?"

"Evaṃ su te sunhātā suvilittā kappitakesamassū āmukkamaṇikuṇḍalābharaṇā odātavatthavasanā pañcahi kāmaguṇehi samappitā samaṅgībhūtā paricārenti, seyyathāpi tvaṃ etarahi sācariyakoti. (Vậy các vị đó có tắm gội sạch sẽ, thoa dầu thơm, cắt tỉa tóc râu, đeo vòng ngọc, khuyên tai và trang sức, mặc y phục trắng, được năm dục công đức đầy đủ và trọn vẹn phục vụ, giống như ngài bây giờ cùng với các đệ tử không?)".

No hidaṃ, bho gotamā’’tiādīsu (dī. ni. 1.286) pucchāyaṃ.

In phrases like "Not so, good Gotama" (D.N. 1.286), evaṃ is used for a question.

No hidaṃ, bho gotamā" (Không phải vậy, thưa Tôn giả Gotama), v.v., là trong câu hỏi.

‘‘Evaṃlahuparivattaṃ (a. ni. 1.48) evamāyupariyanto’’ti (pārā. 12) ca ādīsu parimāṇe.

In phrases like "such a trifling thing" (A.N. 1.48) and "such is the limit of life" (Pārā. 12), evaṃ is used for measure.

"Evaṃlahuparivattaṃ (nhanh chóng thay đổi như thế này), evamāyupariyanto (tuổi thọ kết thúc như thế này)", v.v., là trong nghĩa "số lượng".

94

Nanu ca ‘‘evaṃ su te sunhātā suvilittā, evamāyupariyanto’’ti ettha evaṃ-saddena pucchanākāraparimāṇākārānaṃ vuttattā ākārattho eva evaṃ-saddoti?

"Well, is it not the case that in 'Thus, are they, having bathed well, anointed well?' and 'Such is the limit of life', the word evaṃ expresses the manner of questioning and the manner of limitation, and therefore the word evaṃ simply means 'manner'?"

Chẳng phải trong "evaṃ su te sunhātā suvilittā (Vậy các vị đó có tắm gội sạch sẽ, thoa dầu thơm), evamāyupariyanto (tuổi thọ kết thúc như thế này)", từ evaṃ đã được dùng để chỉ cách hỏi và cách số lượng, nên từ evaṃ chỉ có nghĩa là "cách thức" sao?

Na, visesasabbhāvato.

No, because there is a specific distinction.

Không, vì có sự khác biệt.

Ākāramattavācako hi evaṃ-saddo ākāratthoti adhippeto yathā ‘‘evaṃ byā kho’’tiādīsu (ma. ni. 1.234, 396), na pana ākāravisesavācako.

Indeed, the word evaṃ referring to mere manner is intended as 'manner' (ākārattha), as in "Thus, indeed it is" (M.N. 1.234, 396), but not as referring to a specific manner.

Từ evaṃ chỉ có nghĩa là "cách thức" khi nó chỉ đơn thuần là "cách thức", như trong "evaṃ byā kho" (Thật vậy), v.v., chứ không phải khi nó chỉ một "cách thức đặc biệt".

Evañca katvā ‘‘evaṃ jātena maccenā’’tiādīni upamādiudāharaṇāni upapannāni honti.

And having done so, examples of simile and so forth, like "A mortal born thus...", become appropriate.

Và khi hiểu như vậy, các ví dụ như "evaṃ jātena maccenā" (bởi kẻ phàm phu đã sinh ra như thế này), v.v., về sự so sánh, v.v., sẽ trở nên hợp lý.

Tathā hi ‘‘yathāpi…pe… bahu’’nti (dha. pa. 53) ettha puppharāsiṭṭhāniyato manussūpapatti-sappurisūpanissaya-saddhammassavana-yonisomanasikāra- bhogasampatti-ādidānādi-puññakiriyahetusamudāyato sobhā-sugandhatādiguṇayogato mālāguṇasadisiyo pahūtā puññakiriyā maritabbasabhāvatāya maccena sattena kattabbāti jotitattā puppharāsimālāguṇāva upamā, tesaṃ upamākāro yathā-saddena aniyamato vuttoti ‘‘evaṃ-saddo upamākāranigamanattho’’ti vattuṃ yuttaṃ.

Indeed, in "just as... many" (Dh.p. 53), it is declared that abundant wholesome actions, similar to garlands made from a heap of flowers due to their qualities of beauty and fragrance, must be performed by a mortal being, owing to the aggregate of causes for human rebirth, association with good people, listening to the true Dhamma, wise attention, prosperity of possessions, and other acts of generosity. Therefore, the heap of flowers and garlands are the similes, and the manner of these similes is expressed indefinitely by the word yathā. Thus, it is appropriate to say that "the word evaṃ signifies the conclusion of the simile's manner."

Thật vậy, trong "yathāpi…pe… bahu" (như… nhiều), vì đã được làm rõ rằng những hành động công đức dồi dào, giống như vòng hoa kết từ đống hoa, cần được thực hiện bởi chúng sinh có bản chất phải chết (maccena sattena), do sự kết hợp của các nguyên nhân tạo phước như sự tái sinh làm người, nương tựa vào người thiện, nghe chánh pháp, tác ý đúng đắn, tài sản dồi dào, bố thí, v.v., và do sự kết hợp của các phẩm chất như vẻ đẹp, hương thơm, v.v., nên vòng hoa kết từ đống hoa là ví dụ (upamā); và cách so sánh của chúng được diễn tả một cách không xác định bằng từ yathā (như), nên việc nói "từ evaṃ có nghĩa là kết luận về cách so sánh" là hợp lý.

So pana upamākāro niyamiyamāno atthato upamāva hotīti āha ‘‘upamāyaṃ āgato’’ti.

When this manner of simile is definitively stated, it is in meaning a simile itself. Therefore, it is said, "it is used in simile".

Và cách so sánh đó, khi được xác định, về nghĩa thì chính là sự so sánh (upamā), nên nói "upamāyaṃ āgato" (được dùng trong sự so sánh).

Tathā ‘‘evaṃ iminā ākārena abhikkamitabba’’ntiādinā upadisiyamānāya samaṇasāruppāya ākappasampattiyā yo tattha upadisanākāro, so atthato upadeso evāti vuttaṃ ‘‘evaṃ te…pe… upadese’’ti.

Similarly, regarding the proper conduct suitable for a recluse, which is instructed with phrases like "Thus, in this manner, one should proceed," the manner of instruction there is, in essence, instruction itself. Thus, it is said, "Thus they... in instruction".

Tương tự, trong sự hoàn thiện về tư cách (ākappasampattiyā) phù hợp với một sa-môn, được chỉ dẫn bằng "evaṃ iminā ākārena abhikkamitabba" (cần phải tiến bước theo cách này), v.v., cách chỉ dẫn ở đó, về nghĩa thì chính là sự khuyên bảo (upadeso), nên nói "evaṃ te…pe… upadese" (như thế đối với con… trong sự khuyên bảo).

Tathā ‘‘evametaṃ bhagavā, evametaṃ sugatā’’ti ettha ca bhagavatā yathāvuttamatthaṃ aviparītato jānantehi kataṃ tattha saṃvijjamānaguṇānaṃ pakārehi haṃsanaṃ udaggatākaraṇaṃ sampahaṃsanaṃ.

Similarly, in "Thus it is, Blessed One; thus it is, Sugata," the rejoicing, exultation, and delight expressed by those who correctly understood the meaning spoken by the Blessed One, as it truly was, according to the various qualities present therein.

Tương tự, trong "evametaṃ bhagavā, evametaṃ sugatā" (Đúng vậy, bạch Thế Tôn! Đúng vậy, bạch Thiện Thệ!), đó là sự hoan hỷ, sự phấn khởi được thực hiện bởi những vị đã biết rõ ý nghĩa đã nói như vậy một cách không sai lệch, thông qua các cách thức của những phẩm chất hiện hữu ở đó.

Yo tattha sampahaṃsanākāroti yojetabbaṃ.

This should be construed as "the manner of delight there."

Cần phải ghép rằng đó là cách hoan hỷ ở đó.

95

Evamevaṃ panāyanti ettha garahaṇākāroti yojetabbaṃ, so ca garahaṇākāro ‘‘vasalī’’tiādikhuṃsanasaddasannidhānato idha evaṃ-saddena pakāsitoti viññāyati.

In evamevaṃ panāyaṃ, it should be construed as "the manner of censure," and it is understood that this manner of censure is expressed by the word evaṃ here due to its proximity to disparaging words like "outcaste woman."

Trong Evamevaṃ panāyaṃ (Và như thế này), cần ghép rằng đó là cách quở trách (garahaṇākāro). Và cách quở trách đó được biểu lộ bằng từ evaṃ ở đây, do sự hiện diện của các từ lăng mạ như "vasalī" (kẻ hạ tiện), v.v., nên được hiểu.

Yathā cettha, evaṃ upamākārādayopi upamādivasena vuttānaṃ puppharāsiādisaddānaṃ sannidhānato daṭṭhabbaṃ.

As it is here, similarly, the manners of simile and so forth should be understood from their proximity to words like "heap of flowers" and so forth, spoken in the sense of simile and so forth.

Như ở đây, tương tự, các cách so sánh, v.v., cần được thấy do sự hiện diện của các từ như "đống hoa", v.v., được nói theo nghĩa so sánh, v.v.

Evaṃ, bhanteti pana dhammassa sādhukaṃ savanamanasikāre sanniyojitehi bhikkhūhi attano tattha ṭhitabhāvassa paṭijānanavasena vuttattā ettha evaṃ-saddo vacanasampaṭicchanattho vutto.

However, evaṃ, bhante (Yes, Venerable Sir) is spoken by the monks, having been enjoined to listen and pay careful attention to the Dhamma, in acknowledgment of their presence there. Therefore, the word evaṃ here is said to mean "acceptance of a statement."

Tuy nhiên, "Evaṃ, bhante" (Vâng, bạch Thế Tôn!) đã được các tỳ khưu nói ra để xác nhận trạng thái của mình trong việc lắng nghe và tác ý chánh pháp một cách kỹ lưỡng, nên từ evaṃ ở đây được nói với nghĩa chấp nhận lời nói (vacanasampaṭicchanattho).

Tena evaṃ, bhante sādhu, bhante, suṭṭhu, bhanteti vuttaṃ hoti.

Thus, evaṃ, bhante means "Yes, Venerable Sir," "Good, Venerable Sir," "Excellent, Venerable Sir."

Do đó, "Evaṃ, bhante" có nghĩa là "Sādhu, bhante" (Lành thay, bạch Thế Tôn!), "Suṭṭhu, bhante" (Rất tốt, bạch Thế Tôn!).

Evañca vadehīti ‘‘yathāhaṃ vadāmi, evaṃ samaṇaṃ ānandaṃ vadehī’’ti yo evaṃ vadanākāro idāni vattabbo.

In evaṃ ca vadehī (And speak thus), the manner of speaking which is to be stated now, "Speak to the recluse Ānanda just as I speak,"

"Evañca vadehī" (Và hãy nói như thế này) có nghĩa là "yathāhaṃ vadāmi, evaṃ samaṇaṃ ānandaṃ vadehī" (Hãy nói với sa-môn Ānanda như Ta nói). Cách nói như vậy bây giờ cần được nói đến.

So evaṃsaddena nidassīyatīti ‘‘nidassane’’ti vuttoti.

is indicated by the word evaṃ. Therefore, it is said "in indication".

Cách đó được chỉ ra bằng từ evaṃ, nên nói "nidassane" (trong sự chỉ dẫn).

Evaṃ noti etthāpi tesaṃ yathāvuttadhammānaṃ ahitadukkhāvahabhāve sanniṭṭhānajananatthaṃ anumatigahaṇavasena ‘‘saṃvattanti vā no vā, kathaṃ vo ettha hotī’’ti pucchāya katāya ‘‘evaṃ no ettha hotī’’ti vuttattā tadākārasanniṭṭhānaṃ evaṃ-saddena vibhāvitanti viññāyati.

In evaṃ no (Thus for us), when the question "Do they conduce to harm and suffering for you or not? How is it for you in this regard?" was asked to ascertain the truth of those stated dhammas leading to harm and suffering, the reply "Thus it is for us in this regard" was given. Hence, it is understood that this manner of ascertainment is expressed by the word evaṃ.

Trong "Evaṃ no" (Như thế đối với chúng con) ở đây cũng vậy, sau khi câu hỏi "saṃvattanti vā no vā, kathaṃ vo ettha hotī" (Chúng có đưa đến hay không đưa đến, quý vị nghĩ sao về điều này?) được đặt ra để tạo ra sự xác quyết về việc những pháp đã nói đó có gây hại và đau khổ hay không, và để nhận được sự đồng thuận, thì "evaṃ no ettha hotī" (Chúng con nghĩ như thế này về điều này) đã được nói, nên được hiểu rằng sự xác quyết về cách thức đó được biểu lộ bằng từ evaṃ.

So pana tesaṃ dhammānaṃ ahitāya dukkhāya saṃvattanākāro niyamiyamāno avadhāraṇattho hotīti āha ‘‘evaṃ no ettha hotītiādīsu avadhāraṇe’’ti.

When this manner of those dhammas conducing to harm and suffering is precisely determined, it has the meaning of 'determination'. Therefore, it is said, "in phrases like evaṃ no ettha hotī (Thus it is for us in this regard) for determination".

Và cách thức những pháp đó đưa đến sự gây hại và đau khổ, khi được xác định, có nghĩa là sự xác định (avadhāraṇattho), nên nói "evaṃ no ettha hotītiādīsu avadhāraṇe" (trong các trường hợp như "Chúng con nghĩ như thế này về điều này", v.v., là trong sự xác định).

96

Nānānayanipuṇanti ekattanānattaabyāpāraevaṃdhammatāsaṅkhātā, nandiyāvattatipukkhalasīhavikkīḷitaaṅkusadisālocanasaṅkhātā vā ādhārādibhedavasena nānāvidhā nayā nānānayā, nayā vā pāḷigatiyo, tā ca paññattianupaññattiādivasena saṃkilesabhāgiyādilokiyāditadubhayavomissakādivasena kusalādivasena khandhādivasena saṅgahādivasena samayavimuttādivasena ṭhapanādivasena kusalamūlādivasena tikappaṭṭhānādivasena ca nānappakārāti nānānayā.

Skillful in various approaches means that various approaches, or nayā, are those designated as the such-a-nature of non-agency of oneness and manyness, or designated as the vision resembling the pleasure-producing turning-around, triple-lotus, lion's play, and hook, due to distinctions like basis, etc. Or, nayā are the ways of the Pāḷi (texts). And these are of various kinds, thus "various approaches," according to distinctions like designation and sub-designation, conducive to defilement, etc., mundane, etc., mixed with both, etc., wholesome, etc., aggregates, etc., comprehension, etc., liberated at certain times, etc., setting forth, etc., roots of skill, etc., and the basis of the tika (triads), etc.

Nānānayanipuṇanti (khéo léo trong nhiều phương pháp) có nghĩa là được gọi là tính tự nhiên của sự không can thiệp vào một hay nhiều thứ, hoặc được gọi là sự quán sát giống như cái móc của trò chơi sư tử ba lần xoay tròn. Hoặc các phương pháp đa dạng theo sự phân biệt về cơ sở v.v. là nhiều phương pháp ( nānānayā). Hoặc các phương pháp ( nayā) là các cách thức của kinh điển (Pāḷi). Và chúng (các cách thức) là đa dạng ( nānappakārā) theo sự phân biệt về paññatti (chế định), anupaññatti (phụ chế định) v.v.; theo sự phân biệt về saṃkilesabhāgiyā (thuộc phần ô nhiễm) v.v., lokiyā (thuộc thế gian) v.v., và sự pha trộn cả hai; theo sự phân biệt về kusalā (thiện) v.v.; theo sự phân biệt về khandhā (uẩn) v.v.; theo sự phân biệt về saṅgahā (tập hợp) v.v.; theo sự phân biệt về samayavimuttā (giải thoát theo thời gian) v.v.; theo sự phân biệt về ṭhapanā (sự thiết lập) v.v.; theo sự phân biệt về kusalamūlā (căn lành) v.v.; và theo sự phân biệt về tikappaṭṭhānā (căn bản ba loại) v.v. nên gọi là nhiều phương pháp ( nānānayā).

Tehi nipuṇaṃ saṇhaṃ sukhumanti nānānayanipuṇaṃ.

Skillful in various approaches means subtle, fine, and profound by means of these (various approaches).

Khéo léo, tinh tế, vi tế bởi chúng nên gọi là nānānayanipuṇaṃ.

Āsayova ajjhāsayo, te ca sassatādibhedena, tattha ca apparajakkhatādibhedena aneke, attajjhāsayādayo eva vā samuṭṭhānaṃ uppattihetu etassāti anekajjhāsayasamuṭṭhānaṃ.

Intention is indeed disposition; and these are many due to distinctions like eternalism, etc., and within that, due to distinctions like having little defilement, etc. Or, the self's dispositions, etc., are the origin of many dispositions, meaning they are its arising cause.

Tâm ý chính là ajjhāsayo (tâm ý). Và chúng (tâm ý) có nhiều loại theo sự phân biệt về thường kiến v.v., và trong đó có nhiều loại theo sự phân biệt về ít bụi trần v.v., hoặc chính các tâm ý của tự thân v.v. là nguồn gốc ( samuṭṭhānaṃ) của điều này, tức là nguyên nhân phát sinh, nên gọi là anekajjhāsayasamuṭṭhānaṃ (có nguồn gốc từ nhiều tâm ý).

Atthabyañjanasampannanti atthabyañjanaparipuṇṇaṃ upanetabbābhāvato, saṅkāsanapakāsana-vivaraṇa-vibhajana-uttānīkaraṇa-paññattivasena chahi atthapadehi, akkhara-padabyañjanākāraniruttiniddesavasena chahi byañjanapadehi ca samannāgatanti vā attho daṭṭhabbo.

Endowed with meaning and expression means complete in meaning and expression, as there is no need for further conveyance. Or, the meaning should be understood as being endowed with six categories of meaning—indicating, revealing, elucidating, analyzing, clarifying, and designating—and with six categories of expression—letters, words, expressions, forms, etymologies, and explanations.

Atthabyañjanasampannanti (đầy đủ ý nghĩa và văn tự) có nghĩa là đầy đủ ý nghĩa và văn tự vì không có gì cần phải thêm vào, hoặc ý nghĩa nên được hiểu là được trang bị sáu phương diện ý nghĩa: saṅkāsana (khai thị), pakāsana (làm sáng tỏ), vivaraṇa (giải thích), vibhajana (phân tích), uttānīkaraṇa (làm rõ ràng), paññatti (chế định); và sáu phương diện văn tự: akkhara (chữ cái), pada (từ), byañjana (văn tự), ākāra (hình thức), nirutti (ngữ nguyên), niddesa (chỉ dẫn).

97

Vividhapāṭihāriyanti ettha pāṭihāriyapadassa vacanatthaṃ (udā. aṭṭha. 1; itivu. aṭṭha. nidānavaṇṇanā; saṃ. ni. ṭī. 1.1.1 devatāsaṃyutta) ‘‘paṭipakkhaharaṇato, rāgādikilesāpanayanato ca pāṭihāriya’’nti vadanti, bhagavato pana paṭipakkhā rāgādayo na santi, ye haritabbā.

Regarding various marvels, the commentators state the verbal meaning of the term pāṭihāriya as (Ud.A. 1; Iti.A. Nidāna-vaṇṇanā; S.N.Ṭī. 1.1.1 Devatāsaṃyutta) " marvel (pāṭihāriya)" due to the removal of opponents and the dispelling of defilements like lust. However, the Blessed One has no opponents like lust, etc., that need to be removed.

Vividhapāṭihāriyanti (nhiều phép lạ) – ở đây, về ý nghĩa ngữ pháp của từ pāṭihāriya (phép lạ), người ta nói rằng: “ Pāṭihāriya là do loại bỏ đối thủ, và do loại bỏ các phiền não như tham ái v.v.” Tuy nhiên, Đức Thế Tôn không có đối thủ là tham ái v.v. để loại bỏ.

Puthujjanānampi vigatūpakkilese aṭṭhaguṇasamannāgate citte hatapaṭipakkhe iddhividhaṃ pavattati, tasmā tattha pavattavohārena ca na sakkā idha ‘‘pāṭihāriya’’nti vattuṃ.

Even for ordinary people, the psychic power (iddhividha) operates in a mind that is free from defilements and endowed with eight qualities, with opponents already overcome. Therefore, it is not possible to use the term " marvel" here in the sense of a phenomenon operating there.

Ngay cả đối với phàm phu, phép thần thông (iddhividha) cũng phát sinh trong tâm đã loại bỏ các phiền não phụ, được trang bị tám đức tính, đã loại bỏ đối thủ. Do đó, không thể nói “pāṭihāriya” ở đây theo cách nói thông thường về điều đó.

Sace pana mahākāruṇikassa bhagavato veneyyagatā ca kilesā paṭipakkhā, tesaṃ haraṇato ‘‘pāṭihāriya’’nti vuttaṃ, evaṃ sati yuttametaṃ.

If, however, the defilements of those who are to be trained by the Greatly Compassionate Blessed One are considered opponents, and the term " marvel" is used because of the removal of these, then this is appropriate.

Nhưng nếu các phiền não của chúng sanh có thể giáo hóa (veneyya) là đối thủ của Đức Thế Tôn đại bi, và việc loại bỏ chúng được gọi là “pāṭihāriya”, thì điều này là hợp lý.

Atha vā bhagavato ca sāsanassa ca paṭipakkhā titthiyā, tesaṃ haraṇato pāṭihāriyaṃ.

Alternatively, the opponents of the Blessed One and his Dispensation are the sectarians, and " marvel" means the removal of them.

Hoặc, các tà sư (titthiya) là đối thủ của Đức Thế Tôn và Giáo Pháp của Ngài, và việc loại bỏ họ chính là pāṭihāriya.

Te hi diṭṭhiharaṇavasena diṭṭhipakāsane asamatthabhāvena ca iddhiādesanānusāsanīhi haritā apanītā hontīti.

For they are removed and dispelled by psychic power, the power of prognostication, and the power of instruction, by means of dispelling their wrong views and by their inability to propagate their own views.

Thật vậy, họ bị loại bỏ, bị loại trừ bởi thần thông (iddhi), sự chỉ dẫn (ādesanā) và giáo huấn (anusāsanī) thông qua việc loại bỏ tà kiến và sự bất lực trong việc làm sáng tỏ chánh kiến.

‘‘Paṭī’’ti vā ayaṃ saddo ‘‘pacchā’’ti etassa atthaṃ bodheti ‘‘tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo’’tiādīsu (su. ni. 985; cūḷani. 4) viya, tasmā samāhite citte vigatūpakkilese ca katakiccena pacchā haritabbaṃ pavattetabbanti pāṭihāriyaṃ, attano vā upakkilesesu catutthajjhānamaggehi haritesu pacchā haraṇaṃ pāṭihāriyaṃ, iddhiādesanānusāsaniyo ca vigatūpakkilesena katakiccena ca sattahitatthaṃ puna pavattetabbā, haritesu ca attano upakkilesesu parasattānaṃ upakilesaharaṇāni hontīti pāṭihāriyāni bhavanti.

Or, the word "paṭi" indicates the meaning of "after," as in phrases like "When he had entered there, another brahmin came" (Sn. 985; Cūḷani. 4). Therefore, that which is to be accomplished afterwards by one who has accomplished their task in a concentrated mind free from defilements is a pāṭihāriya. Or, when one's own defilements have been removed by the paths of the fourth jhāna, the subsequent removal is a pāṭihāriya. The psychic power, the power of prognostication, and the power of instruction are to be brought forth again for the welfare of beings by one who is free from defilements and has accomplished their task. And when one's own defilements are removed, the defilements of other beings are also removed, thus they become pāṭihāriyas.

Hoặc từ “paṭi” này diễn tả ý nghĩa “sau”, như trong các câu “tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo” v.v. Do đó, điều cần được thực hiện sau khi tâm đã định tĩnh và các phiền não phụ đã được loại bỏ, đó là pāṭihāriya. Hoặc, sau khi các phiền não phụ của tự thân đã được loại bỏ bằng các đạo lộ thiền thứ tư, việc loại bỏ sau đó là pāṭihāriya. Và thần thông, sự chỉ dẫn, giáo huấn cần được thực hiện lại vì lợi ích của chúng sanh bởi người đã loại bỏ các phiền não phụ và đã hoàn thành công việc. Và khi các phiền não phụ của tự thân đã được loại bỏ, thì việc loại bỏ các phiền não của chúng sanh khác cũng xảy ra, nên chúng trở thành pāṭihāriya.

Pāṭihāriyameva pāṭihāriyaṃ, pāṭihāriye vā iddhiādesanānusāsanisamudāye bhavaṃ ekamekaṃ pāṭihāriyanti vuccati.

A marvel is indeed a marvel, or each individual item within the collection of marvels—psychic power, the power of prognostication, and the power of instruction—is called a marvel.

Chính phép lạ là pāṭihāriya; hoặc mỗi một cái trong tập hợp các phép lạ, sự chỉ dẫn và giáo huấn được gọi là pāṭihāriya.

Pāṭihāriyaṃ vā catutthajjhānaṃ maggo ca paṭipakkhaharaṇato, tattha jātaṃ, tasmiṃ vā nimittabhūte, tato vā āgatanti pāṭihāriyaṃ.

Or, the fourth jhāna and the path are a marvel because they remove opponents; that which arises therein, that which is taken as a sign therein, or that which comes from there, is a marvel.

Hoặc thiền thứ tư và đạo lộ là pāṭihāriya do loại bỏ đối thủ; điều phát sinh ở đó, hoặc trong đó là đối tượng, hoặc điều đến từ đó là pāṭihāriya.

Tassa pana iddhiādibhedena visayabhedena ca bahuvidhassa bhagavato desanāyaṃ labbhamānattā āha ‘‘vividhapāṭihāriya’’nti.

Since such a manifold marvel, categorized by psychic power, etc., and by distinctions of scope, is found in the Blessed One's teaching, he says "various marvels".

Vì điều đó, với nhiều loại theo sự phân biệt về thần thông v.v. và theo sự phân biệt về đối tượng, được tìm thấy trong lời dạy của Đức Thế Tôn, nên nói “vividhapāṭihāriya” (nhiều phép lạ).

98

Na aññathāti bhagavato sammukhā sutākārato na aññathāti attho, na pana bhagavato desitākārato.

Not otherwise means not otherwise than the manner in which it was heard directly from the Blessed One, but not otherwise than the manner in which it was taught by the Blessed One.

Na aññathā (không khác) có nghĩa là không khác với cách đã nghe trực tiếp từ Đức Thế Tôn, chứ không phải khác với cách Đức Thế Tôn đã thuyết giảng.

Acinteyyānubhāvā hi bhagavato desanā.

For the teachings of the Blessed One are of inconceivable power.

Thật vậy, lời dạy của Đức Thế Tôn có uy lực không thể nghĩ bàn.

Evañca katvā ‘‘sabbappakārena ko samattho viññātu’’nti idaṃ vacanaṃ samatthitaṃ bhavati, dhāraṇabaladassanañca na virujjhati sutākārāvirajjhanassa adhippetattā.

And having done so, the statement "Who is capable of knowing in every respect?" becomes substantiated, and the display of the power of retention does not contradict it, as the intention is that the manner of hearing should not be corrupted.

Và khi đã làm như vậy, câu nói “Ai có khả năng hiểu biết tất cả mọi phương diện?” này trở nên hợp lý, và việc thể hiện sức mạnh ghi nhớ cũng không mâu thuẫn vì ý định là không làm sai lệch những gì đã nghe.

Na hettha atthantaratāparihāro dvinnampi atthānaṃ ekavisayattā.

There is no avoidance of a different meaning here, as both meanings relate to the same object.

Ở đây không có sự khác biệt về ý nghĩa vì cả hai ý nghĩa đều cùng một đối tượng.

Itarathā thero bhagavato desanāya sabbathā paṭiggahaṇe samattho asamattho cāti āpajjeyyāti.

Otherwise, the elder would be both capable and incapable of accepting the Blessed One's teaching in all respects.

Nếu không, vị Trưởng lão sẽ trở nên vừa có khả năng vừa không có khả năng thấu hiểu hoàn toàn lời dạy của Đức Thế Tôn.

99

‘‘Yo paro na hoti, so attā’’ti evaṃ vuttāya niyakajjhattasaṅkhātāya sasantatiyā vattanato tividhopi me-saddo kiñcāpi ekasmiṃyeva atthe dissati, karaṇasampadānasāminiddesavasena pana vijjamānaṃ bhedaṃ sandhāyāha ‘‘me-saddo tīsu atthesu dissatī’’ti.

Though the word "me" appears in only one meaning—"He who is not another is the self," thus functioning in one's own continuity, meaning one's own self—the statement " the word 'me' appears in three meanings" is made with reference to the existing distinction based on instrument, recipient, and possessor.

Mặc dù từ “me” ba loại đều xuất hiện trong cùng một ý nghĩa, tức là “người không phải là người khác thì là tự ngã”, được gọi là dòng dõi tự thân, nhưng do có sự khác biệt hiện hữu theo cách chỉ định về công cụ, sở thuộc và chủ sở hữu, nên nói “từ ‘me’ xuất hiện trong ba ý nghĩa”.

100

Kiñcāpi upasaggo kiriyaṃ viseseti, jotakabhāvato pana satipi tasmiṃ sutasaddo eva taṃ tamatthaṃ vadatīti anupasaggassa sutasaddassa atthuddhāre saupasaggassa gahaṇaṃ na virujjhatīti dassento ‘‘saupasaggo ca anupasaggo cā’’tiādimāha.

Although a prefix specifies the verb, the word suta itself conveys those specific meanings due to its indicative nature, even when the prefix is present. Thus, in explaining the meaning of the word suta without a prefix, its inclusion with a prefix does not create a contradiction, as shown by the statement " with a prefix and without a prefix," etc.

Mặc dù giới từ bổ nghĩa cho động từ, nhưng vì nó có tính chất làm rõ, nên ngay cả khi có giới từ, chính từ “suta” vẫn nói lên ý nghĩa đó. Do đó, việc lấy từ có giới từ khi giải thích ý nghĩa của từ “suta” không có giới từ là không mâu thuẫn, nên nói “có giới từ và không có giới từ” v.v.

Assāti sutasaddassa.

Its refers to the word suta.

Assā là của từ “suta”.

Kammabhāvasādhanāni idha sutasadde sambhavantīti vuttaṃ ‘‘upadhāritanti vā upadhāraṇanti vā attho’’ti.

Since both objective and impersonal derivations are possible for the word suta here, it is said, " the meaning is 'that which has been understood' or 'the act of understanding'."

Các cách thành lập theo nghĩa hành động và trạng thái có thể có trong từ “suta” ở đây, nên nói “ý nghĩa là ‘đã được lắng nghe’ hoặc ‘sự lắng nghe’”.

Mayāti atthe satīti yadā me-saddassa kattuvasena karaṇaniddeso, tadāti attho.

When the meaning 'by me' is present refers to when the word "me" indicates the instrument.

Mayāti atthe satīti (khi có ý nghĩa là ‘bởi tôi’) có nghĩa là khi từ “me” chỉ định công cụ.

Mamāti atthe satīti yadā sambandhavasena sāminiddeso, tadā.

When the meaning 'mine' is present refers to when it indicates possession by way of relation.

Mamāti atthe satīti (khi có ý nghĩa là ‘của tôi’) có nghĩa là khi chỉ định chủ sở hữu theo quan hệ sở thuộc.

101

Suta-saddasannidhāne payuttena evaṃ-saddena savanakiriyājotakena bhavitabbanti vuttaṃ ‘‘evanti sotaviññāṇādiviññāṇakiccanidassana’’nti.

It is stated, " 'thus' signifies the function of ear-consciousness, etc.," meaning that the word evaṃ, used in conjunction with the word suta and indicating the act of hearing, should be understood in that way.

Với từ “evaṃ” được sử dụng gần từ “suta”, có tính chất làm rõ hành động lắng nghe, nên nói “‘evaṃ’ là sự biểu thị chức năng của thức nhĩ thức v.v.”.

Ādi-saddena sampaṭicchanādīnaṃ pañcadvārikaviññāṇānaṃ tadabhinīhaṭānañca manodvārikaviññāṇānaṃ gahaṇaṃ veditabbaṃ.

By the word " etc.," the inclusion of the five-door consciousnesses like receiving, etc., and the mind-door consciousnesses that are brought to mind from them, should be understood.

Với từ “ādi” (v.v.), nên hiểu là bao gồm các ngũ song thức như sampaṭicchana (tiếp thọ) v.v. và các ý thức được dẫn đến từ chúng.

Sabbesampi vākyānaṃ eva-kāratthasahitattā ‘‘suta’’nti etassa sutamevāti ayamattho labbhatīti āha ‘‘assavanabhāvapaṭikkhepato’’ti.

Since all sentences imply the meaning of the emphatic particle eva, the meaning "it was indeed heard" is obtained from "suta", thus it is said, " by rejecting the state of not having been heard."

Vì tất cả các câu đều có ý nghĩa của từ “eva”, nên ý nghĩa “sutaṃ eva” (chỉ là đã nghe) của từ “suta” được nắm bắt, nên nói “do phủ định trạng thái không nghe”.

Etena avadhāraṇena nirāsaṅkataṃ dasseti.

By this emphasizing particle, it shows certainty.

Bằng sự khẳng định này, điều đó cho thấy sự không nghi ngờ.

Yathā ca sutaṃ sutamevāti niyametabbaṃ, taṃ sammā sutaṃ hotīti āha ‘‘anūnānadhikāviparītaggahaṇanidassana’’nti.

And as what was heard must be understood as 'indeed heard', it is said to be correctly heard, hence " signifying an understanding that is neither deficient, excessive, nor perverted."

Và như điều đã nghe cần được xác định là chỉ là đã nghe, điều đó là đã nghe đúng đắn, nên nói “sự biểu thị việc nắm bắt không thiếu, không thừa, không sai lệch”.

Atha vā saddantaratthāpohanavasena saddo atthaṃ vadatīti sutanti asutaṃ na hotīti ayametassa atthoti vuttaṃ ‘‘assavanabhāvapaṭikkhepato’’ti.

Alternatively, since a word conveys meaning by eliminating the meaning of other words, the meaning of suta is that it is not unheard, thus it is said, " by rejecting the state of not having been heard."

Hoặc, vì từ diễn tả ý nghĩa bằng cách loại bỏ ý nghĩa của từ khác, nên ý nghĩa của từ “suta” này là “không phải là chưa nghe”, nên nói “do phủ định trạng thái không nghe”.

Iminā diṭṭhādivinivattanaṃ karoti.

By this, it sets aside what is seen, etc.

Bằng cách này, nó loại bỏ những gì đã thấy v.v.

Idaṃ vuttaṃ hoti ‘‘na idaṃ mayā diṭṭhaṃ, na sayambhuñāṇena sacchikataṃ, atha kho sutaṃ, tañca kho sammadevā’’ti.

This means: "This was not seen by me, nor realized by self-existent knowledge, but rather it was heard, and indeed it was heard correctly."

Điều này có nghĩa là: “Đây không phải là điều tôi đã thấy, không phải là điều đã được chứng ngộ bằng tự giác tuệ, mà là điều đã nghe, và điều đó là đã nghe đúng đắn.”

Tenevāha – ‘‘anūnānadhikāviparītaggahaṇanidassana’’nti.

Therefore, he says, " signifying an understanding that is neither deficient, excessive, nor perverted."

Chính vì vậy mà nói – “sự biểu thị việc nắm bắt không thiếu, không thừa, không sai lệch”.

Avadhāraṇatthe vā evaṃ-sadde ayamatthayojanā karīyatīti tadapekkhassa suta-saddassa ayamattho vutto ‘‘assavanabhāvapaṭikkhepato’’ti.

Or, this interpretation of meaning is made when the word evaṃ is in the sense of emphasis, and accordingly, the meaning of the word suta is given as " by rejecting the state of not having been heard."

Hoặc, khi từ “evaṃ” ở trong ý nghĩa khẳng định, thì sự kết nối ý nghĩa này được thực hiện, nên ý nghĩa này của từ “suta” liên quan đến nó được nói là “do phủ định trạng thái không nghe”.

Tenevāha ‘‘anūnānadhikāviparītaggahaṇanidassana’’nti.

Therefore, he says, " signifying an understanding that is neither deficient, excessive, nor perverted."

Chính vì vậy mà nói “sự biểu thị việc nắm bắt không thiếu, không thừa, không sai lệch”.

Savanasaddo cettha kammattho veditabbo ‘‘suyyatī’’ti.

And here, the word savana (hearing) should be understood in the objective sense, as in "it is heard."

Và từ “savana” ở đây nên được hiểu theo nghĩa hành động: “được nghe”.

102

Evaṃ savanahetusuṇantapuggalasavanavisesavasena padattayassa ekena pakārena atthayojanaṃ dassetvā idāni pakārantarehipi taṃ dassetuṃ ‘‘tathā eva’’ntiādi vuttaṃ.

Having thus shown one way of interpreting the meaning of the three words, based on the specific hearing of the person who hears due to the cause of hearing, now, in order to show it in other ways as well, "thus indeed" and so on was said.

Sau khi trình bày một cách giải thích ý nghĩa của ba từ (evaṃ, sutaṃ, me) theo cách nguyên nhân của việc nghe, người nghe và sự đặc thù của việc nghe, bây giờ, để trình bày theo những cách khác, câu “tathā eva” (như vậy) v.v. đã được nói đến.

Tattha tassāti yā sā bhagavato sammukhā dhammassavanākārena pavattā manodvāraviññāṇavīthi, tassā.

Therein, "of that" refers to that mind-door consciousness process (manodvāraviññāṇavīthi) which occurred in the presence of the Blessed One, in the manner of hearing the Dhamma; of that.

Trong đó, tassā (của cái đó) là của lộ trình tâm ý môn (manodvāraviññāṇavīthi) đã diễn ra trước mặt Đức Thế Tôn theo cách nghe Pháp.

Sā hi nānappakārena ārammaṇe pavattituṃ samatthā.

Indeed, that is capable of occurring in various ways concerning the object.

Thật vậy, lộ trình tâm đó có khả năng diễn ra trên đối tượng theo nhiều cách khác nhau.

Tathā ca vuttaṃ ‘‘sotadvārānusārenā’’ti.

And thus it was said, "according to the ear-door."

Và như vậy đã được nói “sotadvārānusārenā” (theo đường tai môn).

Nānappakārenāti vakkhamānānaṃ anekavihitānaṃ byañjanatthaggahaṇānaṃ nānākārena.

"In various ways" means in various manners of grasping the meaning and expression of the many kinds that will be spoken of.

Nānappakārenā (theo nhiều cách khác nhau) là theo nhiều cách của sự nắm bắt ý nghĩa của các biểu thức, vốn có nhiều loại sẽ được giải thích.

Etena imissā yojanāya ākārattho evaṃ-saddo gahitoti dīpeti.

By this, it is indicated that in this interpretation, the word evaṃ is taken to mean "manner."

Điều này cho thấy rằng trong cách giải thích này, từ evaṃ (như vậy) được hiểu theo nghĩa là 'cách thức' (ākāra).

Pavattibhāvappakāsananti pavattiyā atthibhāvappakāsanaṃ.

"The manifestation of the state of occurrence" is the manifestation of the existence of occurrence.

Pavattibhāvappakāsana (sự biểu lộ trạng thái diễn ra) là sự biểu lộ sự tồn tại của sự diễn ra.

Sutanti dhammappakāsananti yasmiṃ ārammaṇe vuttappakārā viññāṇavīthi nānappakārena pavattā, tassa dhammattā vuttaṃ, na sutasaddassa dhammatthattā.

"Suta is the manifestation of Dhamma" was said because of the nature of the Dhamma of that object in which the aforementioned consciousness process (viññāṇavīthi) occurred in various ways, not because the word suta itself means Dhamma.

Sutanti dhammappakāsana (chữ sutaṃ là sự biểu lộ Pháp) được nói đến vì đối tượng mà lộ trình tâm thức đã nói ở trên diễn ra theo nhiều cách khác nhau là Pháp, chứ không phải vì từ suta có nghĩa là Pháp.

Vuttassevatthassa pākaṭīkaraṇaṃ ‘‘ayañhetthā’’tiādi.

Making clear the very meaning that was stated is "this indeed" and so on.

Sự làm rõ ý nghĩa đã nói đến là “ayañhetthā” (đây là điều ở đây) v.v.

Tattha viññāṇavīthiyāti karaṇatthe karaṇavacanaṃ.

Therein, "by the consciousness process (viññāṇavīthiyā)" is the instrumental case in the sense of an instrument.

Trong đó, viññāṇavīthiyā (bởi lộ trình tâm thức) là từ chỉ công cụ trong nghĩa công cụ.

Mayāti kattuatthe.

"By me" is in the sense of an agent.

Mayā (bởi tôi) là trong nghĩa chủ ngữ.

103

Evanti niddisitabbappakāsananti nidassanatthaṃ evaṃ-saddaṃ gahetvā vuttaṃ nidassetabbassa niddisitabbattābhāvābhāvato.

"Thus is the manifestation of what is to be indicated" was said by taking the word evaṃ for the purpose of indication, because there is no non-existence of what is to be indicated (niddisitabbattābhāvato) as that which is to be denoted.

Evanti niddisitabbappakāsana (chữ evaṃ là sự biểu lộ điều cần chỉ định) được nói đến khi lấy từ evaṃ làm ví dụ, vì không có sự thiếu vắng của điều cần chỉ định (niddisitabba).

Tena evaṃ-saddena sakalampi suttaṃ paccāmaṭṭhanti dasseti.

By that, it is shown that the word evaṃ refers back to the entire Sutta.

Điều này cho thấy rằng từ evaṃ bao hàm toàn bộ bài kinh.

Suta-saddassa kiriyāsaddattā savanakiriyāya ca sādhāraṇaviññāṇapabandhapaṭibaddhattā tattha ca puggalavohāroti vuttaṃ ‘‘sutanti puggalakiccappakāsana’’nti.

Since the word suta is a verbal noun (kiriyāsadda), and the act of hearing (savanakiriyā) is connected to a continuum of ordinary consciousness (sādhāraṇaviññāṇapabandha), and there is the usage of "person" in that context, it was said, "Suta is the manifestation of a personal act."

Vì từ suta là một động từ, và hành động nghe (savanakiriyā) gắn liền với chuỗi tâm thức chung, và trong đó có sự quy ước về cá nhân, nên đã được nói “sutanti puggalakiccappakāsana” (chữ sutaṃ là sự biểu lộ hành động của cá nhân).

Na hi puggalavohārarahite dhammapabandhe savanakiriyā labbhatīti.

For indeed, the act of hearing is not obtained in a continuum of Dhamma devoid of the usage of "person."

Thật vậy, hành động nghe không thể có trong một chuỗi Pháp không có sự quy ước về cá nhân.

104

Yassa cittasantānassātiādipi ākāratthameva evaṃ-saddaṃ gahetvā purimayojanāya aññathā atthayojanaṃ dassetuṃ vuttaṃ.

"Of which mind-continuum (cittasantāna)" and so on was also said to show another interpretation of the word evaṃ in the previous explanation by taking it as meaning "manner."

Yassa cittasantānassā (của chuỗi tâm thức nào) v.v. cũng được nói đến để trình bày một cách giải thích ý nghĩa khác với cách giải thích trước, lấy từ evaṃ theo nghĩa cách thức.

Tattha ākārapaññattīti upādāpaññatti eva dhammānaṃ pavattiākārūpādānavasena tathā vuttā.

Therein, "designation of manner (ākārapaññatti)" refers to a dependent designation (upādāpaññatti) that is so called because it takes the mode of occurrence of phenomena as its basis.

Trong đó, ākārapaññattī (khái niệm về cách thức) là khái niệm phụ thuộc (upādāpaññatti), được gọi như vậy dựa trên sự phụ thuộc vào cách thức diễn ra của các Pháp.

Sutanti visayaniddesoti sotabbabhūto dhammo savanakiriyākattupuggalassa savanakiriyāvasena pavattiṭṭhānanti katvā vuttaṃ.

"Suta is the designation of the object" was said by considering that the Dhamma which is to be heard is the place of occurrence for the person who is the agent of the act of hearing, in terms of the act of hearing.

Sutanti visayaniddeso (chữ sutaṃ là sự chỉ định đối tượng) được nói đến khi coi Pháp cần nghe là nơi diễn ra hành động nghe của cá nhân thực hiện hành động nghe, theo cách hành động nghe.

Cittasantānavinimuttassa paramatthato kassaci kattu abhāvepi saddavohārena buddhiparikappitabhedavacanicchāya cittasantānato aññaṃ viya taṃsamaṅgiṃ katvā vuttaṃ ‘‘cittasantānena taṃsamaṅgino’’ti.

Even though there is no agent in the ultimate sense, separate from the mind-continuum (cittasantāna), it was said "of one endowed with that, by the mind-continuum" by conceptually postulating, through verbal usage, something other than the mind-continuum, as if it were an entity endowed with that.

Mặc dù không có chủ thể nào thực sự tồn tại ngoài chuỗi tâm thức, nhưng theo quy ước lời nói và ý muốn của trí tuệ phân biệt, nó được nói đến như thể là một cái gì đó khác với chuỗi tâm thức, như là người có chuỗi tâm thức đó, “cittasantānena taṃsamaṅgino” (của người có chuỗi tâm thức đó).

Savanakiriyāvisayopi sotabbadhammo savanakiriyāvasena pavattacittasantānassa idha paramatthato kattubhāvato, savanavasena cittappavattiyā eva vā savanakiriyābhāvato taṃkiriyākattu ca visayo hotīti vuttaṃ ‘‘taṃsamaṅgino kattuvisaye’’ti.

The Dhamma to be heard, being the object of the act of hearing, is also the object of the agent endowed with that (taṃsamaṅgi) because in this context, the mind-continuum that occurs due to the act of hearing is the agent in the ultimate sense, or because the act of hearing itself is the occurrence of consciousness through hearing. Thus it was said, "in the object of the agent endowed with that."

Pháp cần nghe, vốn là đối tượng của hành động nghe, cũng là đối tượng của chủ thể hành động đó, vì trong trường hợp này, chuỗi tâm thức diễn ra theo hành động nghe thực sự là chủ thể, hoặc vì hành động nghe chính là sự diễn ra của tâm thức theo cách nghe, nên đã được nói “taṃsamaṅgino kattuvisaye” (trong đối tượng của chủ thể có cái đó).

Sutākārassa ca therassa sammānicchitabhāvato āha ‘‘gahaṇasanniṭṭhāna’’nti.

And since the manner of hearing was correctly ascertained by the Elder, it says, "ascertainment of apprehension."

Và vì cách thức nghe đã được Trưởng lão xác định đúng đắn, nên đã nói “gahaṇasanniṭṭhāna” (sự xác định về việc nắm bắt).

Etena vā avadhāraṇatthaṃ evaṃ-saddaṃ gahetvā ayamatthayojanā katāti daṭṭhabbaṃ.

Or, by this, it should be understood that this interpretation was made by taking the word evaṃ in the sense of ascertainment (avadhāraṇattha).

Hoặc, điều này nên được hiểu là cách giải thích ý nghĩa này được thực hiện bằng cách lấy từ evaṃ theo nghĩa nhấn mạnh (avadhāraṇa).

105

Pubbe sutānaṃ nānāvihitānaṃ suttasaṅkhātānaṃ atthabyañjanānaṃ upadhāritarūpassa ākārassa nidassanassa, avadhāraṇassa vā pakāsanasabhāvo evaṃ-saddoti tadākārādiupadhāraṇassa puggalapaññattiyā upādānabhūtadhammapabandhabyāpāratāya vuttaṃ – ‘‘evanti puggalakiccaniddeso’’ti.

The word evaṃ is the nature of manifesting the indication or ascertainment of the understood manner of the various kinds of meaning and expression of the Suttas (suttasaṅkhāta) heard previously. Therefore, it was said "Evaṃ is the designation of a personal act (puggalakiccaniddeso)" due to the involvement of a continuum of Dhamma, which is the basis for the personal designation (puggalapaññatti) of such a manner and so forth, in the process of understanding.

Từ evaṃ là bản chất của sự biểu lộ sự chỉ định hoặc sự nhấn mạnh của cách thức đã được nhận thức của các ý nghĩa và biểu thức được gọi là suttas, đã được nghe trước đây theo nhiều cách khác nhau; và vì sự nhận thức cách thức đó v.v. là hoạt động của chuỗi Pháp làm nền tảng cho khái niệm cá nhân, nên đã được nói – “evanti puggalakiccaniddeso” (chữ evaṃ là sự chỉ định hành động của cá nhân).

Savanakiriyā pana puggalavādinopi viññāṇanirapekkhā natthīti visesato viññāṇabyāpāroti āha ‘‘sutanti viññāṇakiccaniddeso’’ti.

However, the act of hearing (savanakiriyā), even for those who speak of a "person," does not exist independently of consciousness; thus, it is specifically an activity of consciousness. Therefore, it says, "Suta is the designation of an act of consciousness (viññāṇakiccaniddeso)."

Tuy nhiên, hành động nghe, ngay cả đối với những người theo thuyết cá nhân (puggalavādī), cũng không thể không có tâm thức, nên nó là hoạt động đặc biệt của tâm thức, vì vậy đã nói “sutanti viññāṇakiccaniddeso” (chữ sutaṃ là sự chỉ định hành động của tâm thức).

‘‘Me’’ti saddappavattiyā ekanteneva sattavisayattā viññāṇakiccassa ca tattheva samodahitabbato ‘‘meti ubhayakiccayuttapuggalaniddeso’’ti vuttaṃ.

Because the occurrence of the word "me" is entirely concerned with sentient beings, and the act of consciousness is also contained therein, it was said, "Me is the designation of a person endowed with both acts."

Vì sự diễn ra của từ “me” (tôi) chắc chắn liên quan đến hữu tình, và hành động của tâm thức cũng được bao gồm trong đó, nên đã được nói “meti ubhayakiccayuttapuggalaniddeso” (chữ me là sự chỉ định cá nhân liên quan đến cả hai hành động).

Avijjamānapaññattivijjamānapaññattisabhāvā yathākkamaṃ evaṃ-sadda – suta-saddānaṃ atthāti te tathārūpa-paññatti-upādānabhūta-dhammapabandhabyāpārabhāvena dassento āha – ‘‘evanti puggalakiccaniddeso, sutanti viññāṇakiccaniddeso’’ti.

Showing that the meanings of the words evaṃ and suta are, respectively, designations of non-existent and existent natures, and demonstrating them through the involvement of a continuum of Dhamma which is the basis for such designations, it says, "Evaṃ is the designation of a personal act; Suta is the designation of an act of consciousness."

Các khái niệm không tồn tại và tồn tại lần lượt là ý nghĩa của từ evaṃ và từ suta; khi trình bày chúng như là hoạt động của chuỗi Pháp làm nền tảng cho khái niệm như vậy, đã nói – “evanti puggalakiccaniddeso, sutanti viññāṇakiccaniddeso” (chữ evaṃ là sự chỉ định hành động của cá nhân, chữ sutaṃ là sự chỉ định hành động của tâm thức).

Ettha ca karaṇakiriyākattukammavisesappakāsanavasena puggalabyāpāravisayapuggalabyāpāranidassanavasena gahaṇākāragāhakatabbisayavisesaniddesavasena kattukaraṇabyāpārakattuniddesavasena ca dutiyādayo catasso atthayojanā dassitāti daṭṭhabbaṃ.

And here, it should be understood that the second to fifth interpretations were shown in terms of manifesting specific instruments, actions, agents, and objects; in terms of indicating personal activities within the sphere of personal activity; in terms of indicating the specific manner of apprehension, the apprehender, and its object; and in terms of designating the agent of instrumental activity and the agent.

Ở đây, nên hiểu rằng bốn cách giải thích ý nghĩa thứ hai v.v. đã được trình bày theo cách biểu lộ sự đặc thù của hành động, chủ thể và đối tượng của hành động; theo cách chỉ định hoạt động của cá nhân liên quan đến đối tượng của hoạt động của cá nhân; theo cách chỉ định sự đặc thù của cách thức nắm bắt, người nắm bắt và đối tượng của nó; và theo cách chỉ định hoạt động của chủ thể và công cụ.

106

Sabbassapi saddādhigamanīyassa atthassa paññattimukheneva paṭipajjitabbattā sabbapaññattīnañca vijjamānādivasena chasu paññattibhedesu antogadhattā tesu ‘‘eva’’ntiādīnaṃ paññattīnaṃ sarūpaṃ niddhārento āha – ‘‘evanti ca meti cā’’tiādi.

Since all meanings accessible through words must be understood through designation (paññatti), and all designations fall within the six types of designations based on existence and so forth, determining the nature of these designations for evaṃ and so on, it says, "Evaṃ and Me" and so on.

Vì tất cả các ý nghĩa có thể hiểu được bằng lời nói đều phải được tiếp cận thông qua khái niệm, và tất cả các khái niệm đều nằm trong sáu loại khái niệm theo cách tồn tại v.v., nên khi xác định bản chất của các khái niệm “evaṃ” v.v. trong số đó, đã nói – “evanti ca meti cā” (chữ evaṃ và chữ me) v.v.

Tattha ‘‘eva’’nti ca ‘‘me’’ti ca vuccamānassatthassa ākārādino dhammānaṃ asallakkhaṇabhāvato avijjamānapaññattibhāvoti āha – ‘‘saccikaṭṭhaparamatthavasena avijjamānapaññattī’’ti.

Therein, as the meaning expressed by evaṃ and me, such as manner, etc., is not discernible among phenomena, it is a designation of non-existence (avijjamānapaññatti). Thus, it says, "a designation of non-existence in terms of ultimate true reality (saccikaṭṭhaparamattha)."

Trong đó, vì ý nghĩa được nói đến bởi “evaṃ” và “me” không thể được nhận biết như là Pháp theo cách thức v.v., nên nó là khái niệm không tồn tại, vì vậy đã nói – “saccikaṭṭhaparamatthavasena avijjamānapaññattī” (khái niệm không tồn tại theo nghĩa chân đế tối hậu).

Tattha saccikaṭṭhaparamatthavasenāti bhūtatthauttamatthavasena.

Therein, "in terms of ultimate true reality" means in terms of reality and the highest meaning.

Trong đó, saccikaṭṭhaparamatthavasena (theo nghĩa chân đế tối hậu) là theo nghĩa chân thực và tối thượng.

Idaṃ vuttaṃ hoti – yo māyāmarīciādayo viya abhūtattho, anussavādīhi gahetabbo viya anuttamattho ca na hoti, so rūpasaddādisabhāvo, ruppanānubhavanādisabhāvo vā attho saccikaṭṭho paramattho cāti vuccati, na tathā ‘‘evaṃ me’’ti padānaṃ atthoti.

This is what is meant: that which is not a non-existent meaning, like a mirage, etc., nor a non-highest meaning, like that which is to be grasped by hearsay, etc.—that meaning, whose nature is material form, sound, etc., or whose nature is affliction, experience, etc., is called ultimate true reality. The meanings of the words evaṃ and me are not like that.

Điều này có nghĩa là: cái không phải là ý nghĩa không thực như ảo ảnh v.v., và không phải là ý nghĩa không tối thượng như cái được nắm bắt bởi sự nghe truyền miệng v.v., ý nghĩa có bản chất là sắc, âm thanh v.v., hoặc bản chất là sự biến hoại, sự trải nghiệm v.v., được gọi là chân đế và tối hậu; ý nghĩa của các từ “evaṃ me” thì không như vậy.

Etamevatthaṃ pākaṭataraṃ kātuṃ ‘‘kiñhettha ta’’ntiādi vuttaṃ.

To make this very meaning clearer, "what indeed is there in this?" and so on was said.

Để làm rõ hơn ý nghĩa này, “kiñhettha ta” (cái gì ở đây) v.v. đã được nói đến.

Sutanti pana saddāyatanaṃ sandhāyāha ‘‘vijjamānapaññattī’’ti.

However, "Suta" refers to the sound object (saddāyatana); thus, it says, "a designation of existence (vijjamānapaññatti)."

Còn Suta (đã nghe) thì liên quan đến đối tượng âm thanh, nên đã nói “vijjamānapaññattī” (khái niệm tồn tại).

Teneva hi ‘‘yañhi taṃ ettha sotena upaladdha’’nti vuttaṃ, ‘‘sotadvārānusārena upaladdha’’nti pana vutte atthabyañjanādisabbaṃ labbhati.

Indeed, for that reason, it was said, "that which was perceived here by the ear"; but if it were said, "perceived according to the ear-door," then all meaning, expression, etc., would be included.

Chính vì vậy đã nói “yañhi taṃ ettha sotena upaladdha” (cái gì đã được nhận biết ở đây bằng tai), nhưng khi nói “sotadvārānusārena upaladdha” (đã được nhận biết theo đường tai môn) thì bao gồm tất cả các ý nghĩa và biểu thức v.v.

107

Taṃ taṃ upādāya vattabbatoti sotapathamāgate dhamme upādāya tesaṃ upadhāritākārādino paccāmasanavasena ‘‘eva’’nti, sasantatipariyāpanne khandhe upādāya ‘‘me’’ti vattabbattāti attho.

"Because it is to be spoken of by taking that as its basis" means that by taking the phenomena that have come into the path of hearing as a basis, it is referred to as "evaṃ" through recalling their ascertained manner and so forth; and by taking the aggregates (khandha) included in one's own continuum as a basis, it is referred to as "me."

Taṃ taṃ upādāya vattabbato (vì được nói đến dựa trên cái đó, cái đó) có nghĩa là: từ evaṃ được nói đến dựa trên các Pháp đã đến đường tai, theo cách hồi tưởng lại cách thức đã được nhận thức của chúng; và từ me được nói đến dựa trên các uẩn thuộc về dòng dõi của chính mình.

Diṭṭhādisabhāvarahite saddāyatane pavattamānopi sutavohāro ‘‘dutiyaṃ tatiya’’ntiādiko viya paṭhamādīni diṭṭhamutaviññāte apekkhitvāva pavattoti āha ‘‘diṭṭhādīni upanidhāya vattabbato’’ti asutaṃ na hotīti hi sutanti pakāsitoyamatthoti.

Even though the usage of suta (heard) occurs in the sound object, which is devoid of the nature of what is seen, etc., it occurs only by referring to what is seen, heard, and cognized, like "second, third," etc. Thus, it says, "because it is to be spoken of by referring to what is seen and so forth," for indeed, this meaning is made clear as that which is not unheard, that is, heard.

Mặc dù sự quy ước suta (đã nghe) diễn ra trên đối tượng âm thanh không có bản chất của cái đã thấy v.v., nhưng nó diễn ra dựa trên cái đã thấy, đã nghe, đã nhận biết ban đầu, giống như “thứ hai, thứ ba” v.v., nên đã nói “diṭṭhādīni upanidhāya vattabbato” (vì được nói đến dựa trên cái đã thấy v.v.); ý nghĩa này được biểu lộ là cái không phải là chưa nghe thì là đã nghe.

Attanā paṭividdhā suttassa pakāravisesā ‘‘eva’’nti therena paccāmaṭṭhāti āha ‘‘asammohaṃ dīpetī’’ti.

It says, "it indicates non-confusion," for the specific modes of the Sutta that were thoroughly understood by the Elder were referred to as "evaṃ."

Các cách thức đặc biệt của bài kinh đã được Trưởng lão tự mình thấu hiểu được hồi tưởng lại bằng từ evaṃ, nên đã nói “asammohaṃ dīpetī” (biểu lộ sự không lầm lẫn).

Nānappakārapaṭivedhasamattho hotīti etena vakkhamānassa suttassa nānappakārataṃ duppaṭivijjhatañca dasseti.

By "is capable of various kinds of penetration," it shows the variousness and difficulty of penetration of the Sutta that will be spoken of.

Nānappakārapaṭivedhasamattho hotī (có khả năng thấu hiểu theo nhiều cách khác nhau) điều này cho thấy sự đa dạng và khó thấu hiểu của bài kinh sẽ được giải thích.

Sutassa asammosaṃ dīpetīti sutākārassa yāthāvato dassiyamānattā vuttaṃ.

"It indicates the non-loss of what was heard" was said because the manner of hearing is shown as it truly is.

Sutassa asammosaṃ dīpetī (biểu lộ sự không lầm lẫn của cái đã nghe) được nói đến vì cách thức nghe được trình bày một cách chân thực.

Asammohenāti sammohābhāvena, paññāya eva vā savanakālasambhūtāya taduttarakālapaññāsiddhi.

Asammohena (by non-confusion) means by the absence of delusion, or indeed by the achievement of wisdom in the subsequent period, which arose at the time of hearing.

Không mê lầm có nghĩa là không có sự mê lầm, hoặc là sự thành tựu tuệ phát sinh vào lúc nghe và tuệ ở thời gian sau đó.

Evaṃ asammosenāti etthāpi vattabbaṃ.

Likewise, the same should be said regarding asammosena (by non-forgetfulness) here too.

Tương tự, điều này cũng nên được nói về không lãng quên.

Byañjanānaṃ paṭivijjhitabbo ākāro nātigambhīro, yathāsutadhāraṇameva tattha karaṇīyanti satiyā byāpāro adhiko, paññā tattha guṇībhūtāti vuttaṃ ‘‘paññāpubbaṅgamāyā’’tiādi ‘‘paññāya pubbaṅgamā’’ti katvā.

The mode of penetrating the expressions is not too profound; since merely retaining what has been heard is to be done there, the activity of mindfulness is greater, and wisdom there is subsidiary. Thus, it is said, "preceded by wisdom" and so on, making it "preceded by wisdom."

Cách thức thấu triệt các văn tự không quá sâu xa; việc cần làm ở đó chỉ là ghi nhớ đúng như đã nghe, do đó hoạt động của chánh niệm là chủ yếu, tuệ ở đó chỉ là phụ thuộc, nên đã nói “paññāpubbaṅgamā” (tuệ đi trước) v.v. bằng cách nói “tuệ đi trước”.

Pubbaṅgamatā cettha padhānatā ‘‘manopubbaṅgamā’’tiādīsu (dha. pa. 1, 2) viya.

Here, the meaning of being "preceded" is predominance, as in "mind preceded" and so on.

Ở đây, sự đi trước có nghĩa là sự chủ yếu, giống như trong “ý dẫn đầu” v.v.

Pubbaṅgamatāya vā cakkhuviññāṇādīsu āvajjanādīnaṃ viya appadhānatte paññā pubbaṅgamā etissāti ayampi attho yujjati.

Or, if "preceded by wisdom" implies a subordinate role, like attention in the case of eye-consciousness and so on, then this meaning is also fitting: "wisdom is that by which this is preceded."

Hoặc, nếu sự đi trước có nghĩa là không chủ yếu, giống như sự chú ý v.v. trong các thức nhãn v.v., thì ý nghĩa “tuệ đi trước cái này” cũng phù hợp.

Evaṃ satipubbaṅgamāyāti etthāpi vuttanayānusārena yathāsambhavamattho veditabbo.

Similarly, for "preceded by mindfulness," the meaning should be understood as appropriate, according to the method stated.

Tương tự, đối với “satipubbaṅgamā” (niệm đi trước), ý nghĩa cần được hiểu theo cách đã nói, tùy theo trường hợp.

Atthabyañjanasampannassāti atthabyañjanaparipuṇṇassa, saṅkāsanapakāsanavivaraṇavibhajanauttānīkaraṇapaññattivasena chahi atthapadehi, akkharapadabyañjanākāraniruttiniddesavasena chahi byañjanapadehi ca samannāgatassāti vā attho daṭṭhabbo.

Atthabyañjanasampannassa (endowed with meaning and expressions) means complete with meaning and expressions, or alternatively, the meaning should be understood as being endowed with six categories of meaning (teaching, elucidation, explanation, analysis, clarification, and designation) and six categories of expression (letters, words, syllables, modes, etymology, and demonstration).

Của sự đầy đủ ý nghĩa và văn tự có nghĩa là của sự đầy đủ ý nghĩa và văn tự, hoặc cần hiểu ý nghĩa là sự đầy đủ sáu phương diện ý nghĩa theo cách trình bày, giải thích, làm rõ, phân tích, làm cho dễ hiểu, và xác định; và sáu phương diện văn tự theo cách chữ, từ, văn tự, hình thức, ngữ nguyên, và chỉ dẫn.

108

Yonisomanasikāraṃ dīpeti evaṃ-saddena vuccamānānaṃ ākāranidassanāvadhāraṇatthānaṃ aviparītasaddhammavisayattāti adhippāyo.

Delineates proper attention (yonisomanasikāraṃ dīpeti) means that the meanings of mode, illustration, and ascertainment, which are indicated by the word "evaṃ" (thus), are concerned with the undistorted True Dhamma—this is the intention.

Chỉ rõ tác ý đúng đắn là điều muốn nói rằng các ý nghĩa về hình thức, sự chỉ dẫn và sự xác định được diễn đạt bằng từ “evaṃ” (như vầy) là đối tượng của Chánh Pháp không sai lệch.

Avikkhepaṃ dīpetīti ‘‘mūlapariyāyaṃ kattha bhāsita’’ntiādipucchāvasena pakaraṇappattassa vakkhamānassa suttassa savanaṃ samādhānamantarena na sambhavatīti katvā vuttaṃ.

Delineates non-distraction (avikkhepaṃ dīpeti) is stated because the hearing of the forthcoming Sutta, pertaining to the context through questions like "Where was the Mūlapariyāya Sutta spoken?" is not possible without concentration.

Chỉ rõ sự không tán loạn đã được nói vì việc lắng nghe bài kinh sắp được nói đến, là đối tượng của trường hợp này theo cách hỏi “Mūlapariyāya (Bài kinh về căn bản) được thuyết ở đâu?” v.v., không thể xảy ra nếu không có sự tập trung.

Vikkhittacittassātiādi tassevatthassa samatthanavasena vuttaṃ.

For one with a distracted mind (vikkhittacittassa) and so on, is said in support of that very meaning.

Của tâm tán loạn v.v. được nói để xác nhận ý nghĩa đó.

Sabbasampattiyāti atthabyañjanadesakapayojanādisampattiyā.

Of all perfections (sabbasampattiyā) means the perfection of meaning, expression, teaching, purpose, and so on.

Của mọi sự thành tựu có nghĩa là sự thành tựu về ý nghĩa, văn tự, người thuyết, mục đích v.v.

Aviparītasaddhammavisayehi viya ākāranidassanāvadhāraṇatthehi yonisomanasikārassa, saddhammassavanena viya ca avikkhepassa yathā yonisomanasikārena phalabhūtena attasammāpaṇidhipubbekatapuññatānaṃ siddhi vuttā tadavinābhāvato, evaṃ avikkhepena phalabhūtena kāraṇabhūtānaṃ saddhammassavanasappurisūpanissayānaṃ siddhi dassetabbā siyā assutavato sappurisūpanissayarahitassa ca tadabhāvato.

Just as the achievement of proper self-aspiration and past meritorious deeds, which are the fruits of yonisomanasikāra, is stated as being inseparable from it due to its association with meanings of mode, illustration, and ascertainment pertaining to the undistorted True Dhamma; similarly, the achievement of hearing the True Dhamma and associating with good persons, which are causes, should be shown as the fruits of non-distraction, because they are absent in one who has not heard or is without association with good persons.

Giống như sự thành tựu của sự tự nguyện ước nguyện đúng đắn và công đức đã làm trước đây được nói là do tác ý đúng đắn là quả, vì không thể thiếu nó; thì tương tự, sự thành tựu của việc lắng nghe Chánh Pháp và nương tựa bậc thiện trí là nhân, cần được chỉ rõ là do sự không tán loạn là quả, vì người chưa từng nghe và người không có sự nương tựa bậc thiện trí thì không có điều đó.

Na hi vikkhittacittotiādinā samatthanavacanena pana avikkhepena kāraṇabhūtena sappurisūpanissayena ca phalabhūtassa saddhammassavanassa siddhi dassitā.

However, by the supporting statement "for one with a distracted mind is not..." and so on, the achievement of hearing the True Dhamma, which is a fruit, is shown through non-distraction, which is a cause, and through association with good persons.

Tuy nhiên, với lời xác nhận “Tâm tán loạn không thể” v.v., sự thành tựu của việc lắng nghe Chánh Pháp là quả được chỉ rõ là do sự không tán loạn là nhân và sự nương tựa bậc thiện trí.

Ayaṃ panettha adhippāyo yutto siyā – saddhammassavanasappurisūpanissayā na ekantena avikkhepassa kāraṇaṃ bāhiraṅgattā, avikkhepo pana sappurisūpanissayo viya saddhammassavanassa ekantakāraṇanti.

This might be the appropriate intention here: hearing the True Dhamma and associating with good persons are not absolutely causes of non-distraction because they are external, but non-distraction, like association with good persons, is an absolute cause of hearing the True Dhamma.

Ở đây, ý nghĩa này có thể phù hợp: việc lắng nghe Chánh Pháp và nương tựa bậc thiện trí không phải là nhân tuyệt đối của sự không tán loạn vì chúng là bên ngoài; nhưng sự không tán loạn, giống như sự nương tựa bậc thiện trí, là nhân tuyệt đối của việc lắng nghe Chánh Pháp.

Evampi avikkhepena sappurisūpanissayasiddhijotanā na samatthitāva, no na samatthitā vikkhittacittānaṃ sappurisapayirupāsanābhāvassa atthasiddhattā.

Even so, the indication of the achievement of association with good persons through non-distraction is not fully supported; however, it is not unsupported, since the non-association of distracted individuals with good persons is an established fact.

Ngay cả như vậy, sự chỉ rõ sự thành tựu của sự nương tựa bậc thiện trí do sự không tán loạn vẫn chưa được xác nhận, nhưng không phải là chưa được xác nhận, vì sự không có sự phục vụ bậc thiện trí của những người có tâm tán loạn đã được xác lập.

Ettha ca purimaṃ phalena kāraṇassa siddhidassanaṃ nadīpūrena viya upari vuṭṭhisabbhāvassa, dutiyaṃ kāraṇena phalassa siddhidassanaṃ daṭṭhabbaṃ ekantavassinā viya meghavuṭṭhānena vuṭṭhippavattiyā.

Here, the first demonstration of the cause's achievement through the effect should be seen like the indication of rain above by the swelling of a river; the second, the demonstration of the effect's achievement through the cause, should be seen like the occurrence of rain by the rise of a cloud that always brings rain.

Ở đây, sự chỉ rõ sự thành tựu của nhân do quả trước tiên cần được xem như sự tồn tại của mưa ở phía trên do lũ sông, và sự chỉ rõ sự thành tựu của quả do nhân thứ hai cần được xem như sự xảy ra của mưa do đám mây chắc chắn sẽ mưa.

109

Bhagavato vacanassa atthabyañjanapabhedaparicchedavasena sakalasāsanasampattiogāhanākāro niravasesaparahitapāripūrikāraṇanti vuttaṃ ‘‘evaṃ bhaddako ākāro’’ti.

The manner of comprehending the entire dispensation, through the analysis of the divisions of meaning and expression in the Buddha's words, is the cause for the perfect fulfillment of welfare for all others. Therefore, it is said, "such a beautiful manner."

Cách thức thâm nhập vào mọi sự thành tựu của giáo pháp theo cách phân loại sự phân biệt ý nghĩa và văn tự của lời Đức Phật là nguyên nhân hoàn thành lợi ích cho người khác không còn sót lại, nên đã nói “cách thức tốt đẹp như vậy”.

Yasmā na hotīti sambandho.

The connection is that it does not happen.

Có sự liên kết “vì không có”.

Pacchimacakkadvayasampattinti attasammāpaṇidhipubbekatapuññatāsaṅkhātaṃ guṇadvayaṃ.

The perfection of the latter two wheels refers to the two qualities of proper self-aspiration and past meritorious deeds.

Sự thành tựu hai bánh xe sau là hai phẩm chất được gọi là sự tự nguyện ước nguyện đúng đắn và công đức đã làm trước đây.

Aparāparavuttiyā cettha cakkabhāvo, caranti etehi sattā sampattibhavesūti vā.

Here, they are called "wheels" because they function repeatedly, or because beings journey through realms of prosperity by means of them.

Ở đây, chúng là bánh xe vì sự diễn tiến liên tục, hoặc vì chúng sinh di chuyển trong các cõi thành tựu nhờ chúng.

Ye sandhāya vuttaṃ ‘‘cattārimāni, bhikkhave, cakkāni, yehi samannāgatānaṃ devamanussānaṃ catucakkaṃ vattatī’’tiādi (a. ni. 4.31).

Concerning these, it is said, "Bhikkhus, there are these four wheels, by being endowed with which the four-wheeled chariot of gods and humans rolls," and so on.

Điều đó được nói đến trong “Này các Tỳ-kheo, có bốn bánh xe này, nhờ đó mà bánh xe bốn bánh của chư thiên và loài người quay” v.v.

Purimapacchimabhāvo cettha desanākkamavasena daṭṭhabbo.

The order of prior and latter here should be understood according to the sequence of the teaching.

Ở đây, thứ tự trước sau cần được hiểu theo thứ tự thuyết giảng.

Pacchimacakkadvayasiddhiyāti pacchimacakkadvayassa atthitāya.

By the achievement of the latter two wheels means by the existence of the latter two wheels.

Do sự thành tựu hai bánh xe sau có nghĩa là do sự hiện hữu của hai bánh xe sau.

Sammāpaṇihitatto pubbe ca katapuñño suddhāsayo hoti tadasuddhihetūnaṃ kilesānaṃ dūrībhāvatoti āha – ‘‘āsayasuddhi siddhā hotī’’ti.

One whose self is properly aspired and who has performed meritorious deeds in the past has a pure disposition, because the defilements that are causes of impurity are far removed. Therefore, it is said, "purity of disposition is achieved."

Người có sự tự nguyện ước nguyện đúng đắn và đã làm công đức trước đây có tâm ý thanh tịnh vì các phiền não là nguyên nhân của sự không thanh tịnh đó đã được loại bỏ, nên đã nói – “sự thanh tịnh tâm ý được thành tựu”.

Tathā hi vuttaṃ ‘‘sammāpaṇihitaṃ cittaṃ, seyyaso naṃ tato kare’’ti (dha. pa. 43), ‘‘katapuññosi tvaṃ ānanda, padhānamanuyuñja, khippaṃ hohisi anāsavo’’ti (dī. ni. 2.207) ca.

Indeed, it is said, "A mind properly directed does for one a better thing," and "You are one who has performed meritorious deeds, Ānanda; devote yourself to exertion; quickly you will be free of taints."

Thật vậy, đã nói “Tâm được ước nguyện đúng đắn, từ đó làm cho nó tốt hơn” và “Này Ānanda, con đã làm công đức, hãy tinh tấn tu tập, con sẽ nhanh chóng trở thành người vô lậu”.

Tenevāha ‘‘āsayasuddhiyā adhigamabyattisiddhī’’ti.

For that very reason, it is said, "by purity of disposition, the achievement of penetration is attained."

Chính vì thế đã nói “sự thành tựu sự thấu hiểu do sự thanh tịnh tâm ý”.

Payogasuddhiyāti yonisomanasikārapubbaṅgamassa dhammassavanapayogassa visadabhāvena.

By purity of practice means by the clarity of the practice of hearing the Dhamma, which is preceded by proper attention.

Do sự thanh tịnh của sự thực hành có nghĩa là do sự trong sáng của sự thực hành lắng nghe Pháp đi trước bởi tác ý đúng đắn.

Tathā cāha ‘‘āgamabyattisiddhī’’ti.

Thus, he says, "the achievement of learning is attained."

Và đã nói “sự thành tựu sự thông hiểu giáo pháp”.

Sabbassa vā kāyavacīpayogassa niddosabhāvena.

Or, by the blamelessness of all bodily and verbal practice.

Hoặc do sự không lỗi lầm của mọi sự thực hành thân và khẩu.

Parisuddhakāyavacīpayogo hi vippaṭisārābhāvato avikkhittacitto pariyattiyaṃ visārado hotīti.

For one with pure bodily and verbal practice, being free from remorse, is not distracted and is skilled in the Pariyatti (learning).

Thật vậy, người có sự thực hành thân và khẩu thanh tịnh thì không hối tiếc, có tâm không tán loạn và thành thạo trong việc học tập.

110

Nānappakārapaṭivedhadīpakenātiādinā atthabyañjanesu therassa evaṃsaddasuta-saddānaṃ asammohāsammosadīpanato catupaṭisambhidāvasena atthayojanaṃ dasseti.

By the delineator of various kinds of penetration and so on, he shows the application of meaning in terms of the four analytical knowledges (paṭisambhidā), through the Elder's delineation of non-confusion and non-forgetfulness for the words "evaṃ" and "suta" in relation to meanings and expressions.

Với người chỉ rõ sự thấu triệt nhiều loại khác nhau v.v., vị Trưởng lão chỉ rõ sự sắp xếp ý nghĩa theo bốn tuệ phân tích, do sự chỉ rõ không mê lầm và không lãng quên của từ “evaṃ” và từ “suta” trong ý nghĩa và văn tự.

Tattha sotabbabhedapaṭivedhadīpakenāti etena ayaṃ suta-saddo evaṃ-saddasannidhānato, vakkhamānāpekkhāya vā sāmaññeneva sotabbadhammavisesaṃ āmasatīti dasseti.

There, by the delineator of the penetration of what is to be heard (sotabbabhedapaṭivedhadīpakenā) indicates that this word "suta" (heard), by its proximity to the word "evaṃ" (thus) or by its general sense with respect to what is to be stated, refers to a specific Dhamma that is to be heard.

Trong đó, với người chỉ rõ sự thấu triệt các loại đáng nghe, điều này chỉ rõ rằng từ “suta” này, do sự gần gũi với từ “evaṃ” hoặc do sự mong đợi điều sẽ được nói đến, chỉ đề cập đến các đặc điểm của pháp đáng nghe một cách chung chung.

Manodiṭṭhikaraṇā pariyattidhammānaṃ anupekkhanasuppaṭivedhā visesato manasikārapaṭibaddhāti te vuttanayena yonisomanasikāradīpakena evaṃsaddena yojetvā, savanadhāraṇavacīparicayā pariyattidhammānaṃ visesena sotāvadhānapaṭibaddhāti te avikkhepadīpakena suta-saddena yojetvā dassento sāsanasampattiyā dhammassavane ussāhaṃ janeti.

By connecting the Dhamma of Pariyatti that is to be mentally contemplated and well penetrated by understanding (manodiṭṭhikaraṇā), which is specifically dependent on attention, with the word "evaṃ" (thus) as the delineator of proper attention according to the stated method, and by connecting the Dhamma of Pariyatti that is to be heard, remembered, and verbally recited, which is specifically dependent on attentive hearing, with the word "suta" (heard) as the delineator of non-distraction, he inspires effort in hearing the Dhamma concerning the perfection of the dispensation.

Các pháp học được suy xét bằng ý và được thấu triệt đúng đắn bằng quan kiến đặc biệt gắn liền với tác ý, nên đã kết hợp chúng với từ “evaṃ” chỉ rõ tác ý đúng đắn theo cách đã nói; và việc lắng nghe, ghi nhớ, và thực hành bằng lời nói các pháp học đặc biệt gắn liền với sự chú ý lắng nghe, nên đã kết hợp chúng với từ “suta” chỉ rõ sự không tán loạn, do đó tạo ra sự nỗ lực trong việc lắng nghe Chánh Pháp để thành tựu giáo pháp.

Tattha dhammāti pariyattidhammā.

There, Dhamma means the Dhamma of Pariyatti.

Trong đó, các pháp là các pháp học.

Manasānupekkhitāti ‘‘idha sīlaṃ kathitaṃ, idha samādhi, idha paññā, ettakā ettha anusandhiyo’’tiādinā nayena manasā anu anu pekkhitā.

Mentally contemplated means contemplated repeatedly by mind according to the method, such as "here sīla is taught, here samādhi, here paññā, these are the connections here."

Được suy xét bằng ý có nghĩa là được suy xét từng chút một bằng ý theo cách “ở đây giới được nói, ở đây định, ở đây tuệ, có bấy nhiêu sự liên kết ở đây” v.v.

Diṭṭhiyā suppaṭividdhāti nijjhānakkhantibhūtāya, ñātapariññāsaṅkhātāya vā diṭṭhiyā tattha tattha vuttarūpārūpadhamme ‘‘iti rūpaṃ, ettakaṃ rūpa’’ntiādinā suṭṭhu vavatthapetvā paṭividdhā.

Well penetrated by understanding means well distinguished and penetrated by discernment, which is the tolerance of contemplation, or by understanding amounting to the comprehension of what is known, concerning the form and formless phenomena stated in various places, such as "this is form, this much is form."

Được thấu triệt đúng đắn bằng quan kiến có nghĩa là được thấu triệt đúng đắn bằng quan kiến là sự nhẫn nại trong sự quán sát, hoặc là sự hiểu biết đã được xác lập, sau khi đã phân định rõ ràng các pháp sắc và vô sắc được nói ở từng nơi theo cách “đây là sắc, sắc có bấy nhiêu” v.v.

111

Sakalena vacanenāti pubbe tīhi padehi visuṃ visuṃ yojitattā vuttaṃ.

By the entire statement is said because it was previously associated with the three terms separately.

Bằng toàn bộ lời nói được nói vì trước đó đã được kết hợp riêng lẻ với ba từ.

Attano adahantoti ‘‘mameda’’nti attani aṭṭhapento.

Not appropriating to oneself means not establishing in oneself with "this is mine."

Không chấp thủ cho mình có nghĩa là không đặt vào mình “cái này là của tôi”.

Asappurisabhūminti akataññutaṃ ‘‘idhekacco pāpabhikkhu tathāgatappaveditaṃ dhammavinayaṃ pariyāpuṇitvā attano dahatī’’ti (pārā. 195) evaṃ vuttaṃ anariyavohārāvatthaṃ, sā eva anariyavohārāvatthā asaddhammo.

The state of an ignoble person refers to ungratefulness, the ignoble expression described as "here a certain wicked bhikkhu, having learned the Dhamma and Vinaya taught by the Tathāgata, appropriates it to himself"; that very ignoble expression is unrighteousness.

Cõi của người không tốt là sự vô ơn được nói như “Ở đây, một số tỳ-kheo ác sau khi học thuộc Pháp và Luật do Đức Như Lai thuyết giảng, chấp thủ cho mình” là trạng thái của sự cư xử không cao thượng, và chính trạng thái cư xử không cao thượng đó là phi Chánh Pháp.

Nanu ca ānandattherassa ‘‘mamedaṃ vacana’’nti adhimānassa, mahākassapattherādīnañca tadāsaṅkāya abhāvato asappurisabhūmisamatikkamādivacanaṃ niratthakanti?

Would not the statement about transcending the ignoble stage, etc., be meaningless since there was no conceit in Venerable Ānanda, thinking, "This is my word," nor any such doubt in Venerable Mahākassapa and others at that time?

Chẳng phải lời nói về việc vượt qua cảnh giới của bậc bất thiện là vô nghĩa sao, vì Trưởng lão Ānanda không có sự kiêu mạn “Đây là lời của tôi,” và Trưởng lão Mahākassapa cùng những vị khác cũng không có sự nghi ngờ đó?

Nayidamevaṃ ‘‘evaṃ me suta’’nti vadantena ayampi attho vibhāvitoti dassanato.

It is not so, for it is seen that by saying "Thus have I heard," this meaning too is made clear.

Không phải vậy, bởi việc nói “Như vầy tôi nghe” cũng cho thấy ý nghĩa này đã được làm rõ.

Keci pana ‘‘devatānaṃ parivitakkāpekkhaṃ tathāvacananti edisī codanā anavakāsāvā’’ti vadanti.

But some say, "Such a question about the devas' reflections is not appropriate."

Tuy nhiên, một số người nói rằng “Sự chất vấn như vậy, rằng lời nói đó liên quan đến suy nghĩ của các vị trời, là không có cơ sở.”

Tasmiṃ kira khaṇe ekaccānaṃ devatānaṃ evaṃ cetaso parivitakko udapādi ‘‘bhagavā ca parinibbuto, ayañca āyasmā desanākusalo, idāni dhammaṃ deseti sakyakulappasuto tathāgatassa bhātā cūḷapituputto, kiṃ nu kho sayaṃ sacchikataṃ dhammaṃ deseti, udāhu bhagavatoyeva vacanaṃ yathāsuta’’nti.

Indeed, at that moment, a certain thought arose in the minds of some devas: "The Blessed One has attained parinibbāna, and this Venerable One is skilled in teaching. Now he teaches the Dhamma, having originated from the Sakya clan, the Tathāgata's brother, the son of his paternal uncle. Does he teach the Dhamma realized by himself, or is it merely the word of the Blessed One as he heard it?"

Vào khoảnh khắc đó, một số vị trời đã khởi lên suy nghĩ trong tâm như vầy: “Thế Tôn đã nhập Niết Bàn, và vị Tôn giả này là người khéo léo trong việc thuyết giảng. Ngài là người xuất thân từ dòng dõi Sakya, anh em họ của Như Lai (con của chú), bây giờ đang thuyết giảng Dhamma. Phải chăng ngài thuyết giảng Dhamma mà ngài tự chứng ngộ, hay đó chỉ là lời của Thế Tôn như đã được nghe?”

Evaṃ tadāsaṅkitappakārato asappurisabhūmisamokkamādito atikkamādi vibhāvitanti.

Thus, due to that kind of doubt, the transcending of the ignoble stage, etc., is made clear.

Như vậy, do sự nghi ngờ đó, việc vượt qua cảnh giới của bậc bất thiện đã được làm rõ.

Appetīti nidasseti.

Appeti demonstrates.

Appetī (dẫn đến) được chỉ ra.

Diṭṭhadhammikasamparāyikaparamatthesu yathārahaṃ satte netīti netti, dhammoyeva netti dhammanetti.

That which leads beings appropriately to welfare in this life, in the next, and to the ultimate good is a guide (netti); the Dhamma itself is the guide, hence dhammanetti.

Dẫn dắt chúng sanh một cách thích đáng đến các pháp lợi ích hiện tại, lợi ích đời sau và lợi ích tối thượng được gọi là netti (sự dẫn dắt); Dhamma chính là sự dẫn dắt, do đó là dhammanetti (sự dẫn dắt của Dhamma).

112

Daḷhataraniviṭṭhā vicikicchā kaṅkhā.

A firmly entrenched doubt is kaṅkhā.

Sự nghi ngờ đã ăn sâu vững chắc hơn là kaṅkhā (hoài nghi).

Nātisaṃsappanā matibhedamattā vimati.

A mere difference of opinion that does not spread excessively is vimati.

Sự khác biệt về quan điểm không quá sâu sắc là vimati (phân vân).

Assaddhiyaṃ vināseti bhagavatā desitattā, sammukhāvassa paṭiggahitattā, khalitaduruttādigahaṇadosābhāvato ca.

It destroys faith because it was taught by the Blessed One, because it was personally received by him, and because there were no faults of mishearing or mispronunciation, etc.

Assaddhiyaṃ vināseti (diệt trừ sự vô tín) vì được Thế Tôn thuyết giảng, vì được tiếp nhận trực tiếp, và vì không có lỗi lầm như sai sót hay lời nói bất thiện.

Ettha ca paṭhamādayo tisso atthayojanā ākārādiatthesu aggahitavisesameva evaṃ-saddaṃ gahetvā dassitā, tato parā catasso ākāratthameva evaṃ-saddaṃ gahetvā vibhāvitā, pacchimā pana tisso yathākkamaṃ ākāratthaṃ nidassanatthaṃ avadhāraṇatthañca evaṃ-saddaṃ gahetvā yojitāti daṭṭhabbaṃ.

Here, the first three interpretations of meaning are shown by taking the word evaṃ as having no special meaning regarding manner, etc.; the subsequent four are expounded by taking the word evaṃ as signifying only manner; and the last three are to be understood as applying the word evaṃ in order, to mean manner, exemplification, and ascertainment, respectively.

Ở đây, ba cách giải thích ý nghĩa đầu tiên được trình bày bằng cách lấy từ ‘evaṃ’ (như vầy) mà không nắm giữ sự đặc biệt trong các ý nghĩa như ‘cách thức’; bốn cách giải thích tiếp theo được làm rõ bằng cách chỉ lấy từ ‘evaṃ’ với ý nghĩa ‘cách thức’; còn ba cách giải thích cuối cùng được kết hợp bằng cách lấy từ ‘evaṃ’ theo thứ tự là ý nghĩa ‘cách thức’, ý nghĩa ‘chỉ ra’ và ý nghĩa ‘xác định’.

113

Eka-saddo aññaseṭṭhāsahāyasaṅkhyādīsu dissati.

The word eka is seen in the meanings of "other," "excellent," "alone," "number," and so on.

Từ ‘eka’ (một) được thấy trong các ý nghĩa như ‘khác’, ‘tối thượng’, ‘không có bạn’ và ‘số lượng’.

Tathā hesa ‘‘sassato attā ca loko ca, idameva saccaṃ moghamaññanti ittheke abhivadantī’’tiādīsu (ma. ni. 3.27) aññatthe dissati, ‘‘cetaso ekodibhāva’’ntiādīsu (dī. ni. 1.228) seṭṭhatthe, ‘‘eko vūpakaṭṭho’’tiādīsu (dī. ni. 1.405) asahāye, ‘‘ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu saṅkhyāyaṃ.

For instance, it is seen in the sense of "other" in phrases like "some here declare: 'The self and the world are eternal; this alone is true, all else is delusive'" (M.N. 3.27); in the sense of "excellent" in phrases like "oneness of mind" (D.N. 1.228); in the sense of "alone" in "one secluded" (D.N. 1.405); and in the sense of "number" in "there is indeed, bhikkhus, only one moment, one opportunity for living the holy life."

Thật vậy, nó được thấy với ý nghĩa ‘khác’ trong các đoạn như “Có những người tuyên bố rằng ‘Tự ngã và thế giới là thường hằng, đây là sự thật, những điều khác là sai lầm’” (Ma. Ni. 3.27); với ý nghĩa ‘tối thượng’ trong các đoạn như “sự nhất tâm” (Dī. Ni. 1.228); với ý nghĩa ‘không có bạn’ trong các đoạn như “một mình ẩn cư” (Dī. Ni. 1.405); và với ý nghĩa ‘số lượng’ trong các đoạn như “Này các tỳ khưu, chỉ có một khoảnh khắc, một thời điểm để sống Phạm hạnh” (Aṅ. Ni. 3.42).

Idhāpi saṅkhyāyanti dassento āha ‘‘ekanti gaṇanaparicchedaniddeso’’ti.

Here too, intending the sense of number, he says, "Eka is a designation for enumeration and demarcation."

Ở đây cũng vậy, khi chỉ ra ý nghĩa ‘số lượng’, vị ấy nói ‘‘ekanti gaṇanaparicchedaniddeso’’ (chữ ‘eka’ là sự chỉ định về số lượng).

Kālañca samayañcāti yuttakālañca paccayasāmaggiñca khaṇoti okāso.

Kālañca samayañcāti (a fitting time and a combination of conditions) khaṇo is an opportunity.

Kālañca samayañcā (thời gian và thời điểm) là thời điểm thích hợp và sự hội tụ của các điều kiện; khaṇo (khoảnh khắc) là cơ hội.

Tathāgatuppādādiko hi maggabrahmacariyassa okāso tappaccayapaṭilābhahetuttā.

For the arising of a Tathāgata, etc., is an opportunity for the path and holy life, being the cause for the acquisition of those conditions.

Thật vậy, sự xuất hiện của Như Lai và những điều tương tự là cơ hội cho Phạm hạnh của con đường, vì chúng là nguyên nhân để đạt được các điều kiện đó.

Khaṇo eva ca samayo.

A khaṇa is indeed a samaya.

Khoảnh khắc chính là thời điểm.

Yo ‘‘khaṇo’’ti ca ‘‘samayo’’ti ca vuccati, so ekovāti hi attho mahāsamayoti mahāsamūho.

The meaning is that what is called "khaṇa" and "samaya" is one, hence mahāsamayo (great assembly).

Ý nghĩa là điều được gọi là “khoảnh khắc” và “thời điểm” là một; mahāsamayo (đại hội) là một tập hợp lớn.

Samayopi khoti sikkhāpadapūraṇassa hetupi.

Samayopi khoti (and also samaya) is also a reason for completing the training rule.

Samayopi kho (thời điểm cũng vậy) là nguyên nhân để hoàn thành giới luật.

Samayappavādaketi diṭṭhippavādake.

Samayappavādaketi (the propounders of views).

Samayappavādake (những người tuyên bố quan điểm) là những người tuyên bố các tà kiến.

Tattha hi nisinnā titthiyā attano attano samayaṃ pavadantīti.

For there the sectarians, sitting, declare their respective views.

Ở đó, các ngoại đạo ngồi và tuyên bố các quan điểm của riêng họ.

Atthābhisamayāti hitapaṭilābhā.

Atthābhisamayāti (the realization of the meaning) is the acquisition of welfare.

Atthābhisamayā (sự chứng ngộ ý nghĩa) là sự đạt được lợi ích.

Abhisametabboti abhisamayo, abhisamayo attho abhisamayaṭṭhoti pīḷanādīni abhisametabbabhāvena ekībhāvaṃ upanetvā vuttāni.

That which is to be realized is abhisamaya; the meaning of abhisamaya is abhisamayaṭṭho. Thus, suffering and so on are spoken of as being unified by the state of being realizable.

Điều cần được chứng ngộ là abhisamayo (sự chứng ngộ); ý nghĩa của sự chứng ngộ là abhisamayaṭṭho (ý nghĩa của sự chứng ngộ) – các điều như sự bức bách được nói đến khi được hợp nhất thành một với tư cách là điều cần được chứng ngộ.

Abhisamayassa vā paṭivedhassa visayabhūto attho abhisamayaṭṭhoti.

Or, the meaning which is the object of realization or penetration is abhisamayaṭṭho.

Hoặc ý nghĩa là đối tượng của sự chứng ngộ hay sự thấu hiểu là abhisamayaṭṭho.

Tāneva tathā ekattena vuttāni.

Those very things are spoken of as a single entity in that way.

Chính những điều đó được nói đến như là một.

Tattha pīḷanaṃ dukkhasaccassa taṃsamaṅgino hiṃsanaṃ avipphārikatākaraṇaṃ.

Among these, pīḷanaṃ (oppression) is the harming of one who is endowed with the truth of suffering, making it not spread out.

Trong đó, pīḷanaṃ (sự bức bách) là sự làm hại, sự không làm cho lan rộng của Khổ đế và những gì tương ứng với nó.

Santāpo dukkhadukkhatādivasena santāpanaṃ paridahanaṃ.

Santāpo (affliction) is burning or tormenting in the sense of suffering of suffering, etc.

Santāpo (sự thiêu đốt) là sự làm cho nóng, sự thiêu đốt theo nghĩa khổ khổ, v.v.

114

Tattha sahakārīkāraṇaṃ sannijjhaṃ sameti samavetīti samayo, samavāyo.

There, the co-operative cause meets, comes together, and unites, hence samayo (concord), union.

Trong đó, nguyên nhân hỗ trợ hội tụ, hợp nhất được gọi là samayo (thời điểm, sự hội tụ), sự kết hợp.

Sameti samāgacchati maggabrahmacariyaṃ ettha tadādhārapuggalehīti samayo, khaṇo.

The path and holy life meet here, for the individuals who are its basis, hence samayo (occasion), moment.

Phạm hạnh của con đường hội tụ, đến với nhau ở đây, bởi những người dựa vào đó, nên được gọi là samayo, khoảnh khắc.

Sameti ettha, etena vā saṃgacchati satto, sabhāvadhammo vā sahajātādīhi uppādādīhi vāti samayo, kālo.

Herein or thereby, a being meets, or a natural phenomenon meets with co-arisen causes, etc., and with origination, etc., hence samayo (time).

Chúng sanh hợp nhất ở đây, hoặc bởi điều này, hoặc pháp tự nhiên hợp nhất với những điều đồng sanh, sự sanh khởi, v.v., nên được gọi là samayo, thời gian.

Dhammappavattimattatāya atthato abhūtopi hi kālo dhammappavattiyā adhikaraṇaṃ karaṇaṃ viya ca kappanāmattasiddhena rūpena voharīyatīti.

For time, though in essence unreal due to being merely the occurrence of phenomena, is spoken of as if it were the basis or instrument of the occurrence of phenomena by means of a conventionally established form.

Thật vậy, thời gian, dù không có thật về mặt ý nghĩa do chỉ là sự vận hành của các pháp, vẫn được dùng để chỉ định như là căn cứ hay công cụ của sự vận hành của các pháp, bằng một hình thức chỉ có được nhờ sự khái niệm.

Samaṃ, saha vā avayavānaṃ ayanaṃ pavatti avaṭṭhānanti samayo, samūho yathā ‘‘samudāyo’’ti.

The going or coming together of components, their occurrence or stability, is samayo (group), like "samudāyo" (collection).

Sự vận hành, sự tồn tại của các bộ phận một cách bình đẳng hay cùng nhau được gọi là samayo, tập hợp, giống như “samudāyo” (tập khởi).

Avayavasahāvaṭṭhānameva hi samūhoti.

For the stability together of components is indeed a group.

Thật vậy, sự tồn tại cùng nhau của các bộ phận chính là tập hợp.

Avasesapaccayānaṃ samāgame eti phalaṃ etasmā uppajjati pavattati cāti samayo, hetu yathā ‘‘samudayo’’ti.

When other conditions come together, the result comes from it, arises and occurs from it, hence samayo (cause), like "samudayo" (origin).

Khi các điều kiện còn lại hội tụ, quả phát sanh từ đó, vận hành từ đó, nên được gọi là samayo, nguyên nhân, giống như “samudayo” (tập khởi).

Sameti saṃyojanabhāvato sambandho eti attano visaye pavattati, daḷhaggahaṇabhāvato vā saṃyuttā ayanti pavattanti sattā yathābhinivesaṃ etenāti samayo, diṭṭhi; diṭṭhisaññojanena hi sattā ativiya bajjhantīti.

It meets by way of fettering, connection comes, it proceeds in its own sphere, or beings, being bound by strong clinging, come and proceed according to their inclinations through this, hence samayo (view); for beings are excessively bound by the fetter of views.

Do là kiết sử, sự liên kết vận hành trong phạm vi của nó; hoặc do là sự chấp thủ vững chắc, chúng sanh vận hành theo sự chấp thủ của mình bởi điều này, nên được gọi là samayo, tà kiến; thật vậy, chúng sanh bị trói buộc quá mức bởi kiết sử tà kiến.

Samiti saṅgati samodhānanti samayo, paṭilābho.

Coming together, meeting, converging, is samayo (attainment).

Sự hội tụ, sự kết hợp được gọi là samayo, sự đạt được.

Samayanaṃ, sammā vā ayanaṃ apagamoti samayo, pahānaṃ.

Coming together, or a right going away, is samayo (abandonment).

Sự đi đúng đắn, hay sự từ bỏ đúng đắn được gọi là samayo, sự đoạn trừ.

Abhimukhaṃ ñāṇena sammā etabbo abhisametabboti abhisamayo, dhammānaṃ aviparīto sabhāvo.

That which is to be truly approached and realized by knowledge is abhisamayo (realization), the unperverted true nature of phenomena.

Điều cần được đạt đến một cách đúng đắn bằng trí tuệ, cần được chứng ngộ, nên được gọi là abhisamayo, bản chất không sai lệch của các pháp.

Abhimukhabhāvena sammā eti gacchati bujjhatīti abhisamayo, dhammānaṃ aviparītasabhāvāvabodho.

That which truly approaches and understands by direct presence is abhisamayo (realization), the comprehension of the unperverted true nature of phenomena.

Do đi đến, hiểu biết đúng đắn theo cách đối diện, nên được gọi là abhisamayo, sự thấu hiểu bản chất không sai lệch của các pháp.

Evaṃ tasmiṃ tasmiṃ atthe samaya-saddassa pavatti veditabbā.

Thus, the occurrence of the word samaya in each specific meaning should be understood.

Như vậy, sự vận hành của từ samaya trong từng ý nghĩa đó cần được biết.

Samayasaddassa atthuddhāre abhisamayasaddassa udāharaṇaṃ vuttanayeneva veditabbaṃ.

In the explanation of the meanings of the word samaya, the example of the word abhisamaya should be understood in the manner stated.

Ví dụ về từ abhisamaya trong việc giải thích ý nghĩa của từ samaya cần được hiểu theo cách đã nói.

Assāti samayasaddassa.

Assāti (of this) refers to the word samaya.

Assā (của nó) là của từ samaya.

Kālo attho samavāyādīnaṃ atthānaṃ idha asambhavato, desadesakaparisānaṃ viya suttassa nidānabhāvena kālassa apadisitabbato ca.

Kālo attho (the meaning is time) because the meanings of concordance, etc., are impossible here, and because time is to be designated as the basis for the suttas, like places and assemblies.

Kālo attho (thời gian là ý nghĩa) vì các ý nghĩa như sự hội tụ không thể có ở đây, và vì thời gian được chỉ định như là nguyên nhân của kinh, giống như các hội chúng ở từng quốc độ.

115

Kasmā panettha aniyamitavaseneva kālo niddiṭṭho, na utusaṃvaccharādivasena niyametvāti?

Why is time designated here in an unspecified way, and not specified by season, year, etc.?

Tại sao ở đây thời gian được chỉ định một cách không cố định, mà không cố định theo mùa, năm, v.v.?

Āha – ‘‘tattha kiñcāpī’’tiādi.

He says – "tattha kiñcāpī" (although there, indeed), etc.

Vị ấy nói – ‘‘tattha kiñcāpī’’ (mặc dù ở đó) và tiếp theo.

Utusaṃvaccharādivasena niyamaṃ akatvā samayasaddassa vacanena ayampi guṇo laddho hotīti dassento ‘‘ye vā ime’’tiādimāha.

Showing that by expressing the word samaya without specifying season, year, etc., this benefit too is gained, he says "ye vā ime" (or these), etc.

Để chỉ ra rằng phẩm chất này cũng đạt được bằng cách nói từ samaya mà không cố định theo mùa, năm, v.v., vị ấy nói ‘‘ye vā ime’’ (hoặc những điều này) và tiếp theo.

Sāmaññajotanā hi visese avatiṭṭhatīti.

For a general illumination rests on particulars.

Thật vậy, sự chỉ rõ chung chung sẽ đứng vững trong các trường hợp đặc biệt.

Tattha diṭṭhadhammasukhavihārasamayo devasikaṃ jhānaphalasamāpattīhi vītināmanakālo, visesato sattasattāhāni.

Among these, diṭṭhadhammasukhavihārasamayo (the time of pleasant abiding in this very life) is the daily period of passing time with jhānic attainments and fruitions, especially the seven weeks.

Trong đó, diṭṭhadhammasukhavihārasamayo (thời điểm an trú hạnh phúc trong hiện tại) là thời gian trải qua mỗi ngày bằng các thiền định và quả vị thiền định, đặc biệt là bảy tuần lễ.

Suppakāsāti dasasahassilokadhātusaṃkampanaobhāsapātubhāvādīhi pākaṭā.

Suppakāsāti (well-shining) is manifest through the shaking of the ten-thousand-world-system, the appearance of radiance, etc.

Suppakāsā (được chiếu sáng rực rỡ) là rõ ràng do sự rung động của mười ngàn thế giới, sự xuất hiện của ánh sáng, v.v.

Yathāvuttabhedesu eva samayesu ekadesaṃ pakārantarehi saṅgahetvā dassetuṃ ‘‘yo cāya’’ntiādimāha.

To show a portion of the aforementioned types of samaya by gathering them in other ways, he says "yo cāya" (and that), etc.

Để tổng hợp một phần của các thời điểm đã nói ở trên bằng một cách khác, vị ấy nói ‘‘yo cāya’’ (và điều này) và tiếp theo.

Tathā hi ñāṇakiccasamayo attahitapaṭipattisamayo ca abhisambodhisamayo, ariyatuṇhībhāvasamayo diṭṭhadhammasukhavihārasamayo, karuṇākiccaparahitapaṭipattidhammikathāsamayo desanāsamayo eva.

Indeed, the time of the function of knowledge and the time of practice for one's own welfare are abhisambodhisamayo (the time of full awakening); the time of noble silence is diṭṭhadhammasukhavihārasamayo (the time of pleasant abiding in this very life); and the time of the function of compassion, practice for the welfare of others, and Dhamma talk is desanāsamayo (the time of teaching) itself.

Thật vậy, thời điểm của chức năng trí tuệ và thời điểm của sự thực hành vì lợi ích của bản thân là abhisambodhisamayo (thời điểm giác ngộ); thời điểm của sự im lặng cao quý là diṭṭhadhammasukhavihārasamayo; thời điểm của chức năng từ bi, thực hành vì lợi ích của người khác và thuyết pháp là desanāsamayo (thời điểm thuyết pháp).

116

Karaṇavacanena niddeso katoti sambandho.

It is connected by "the designation is made with the instrumental case."

Sự liên kết là sự chỉ định được thực hiện bằng cách dùng cách nói của công cụ (karaṇa).

Tatthāti abhidhammatadaññasuttapadavinayesu.

Tatthāti (therein) refers to Abhidhamma and other suttas and Vinaya terms.

Tatthā (ở đó) là trong Abhidhamma, các kinh điển khác và Luật tạng.

Tathāti bhummakaraṇehi.

Tathāti (likewise) refers to locative and instrumental cases.

Tathā (như vậy) là bằng cách dùng cách nói của vị trí (bhūmika) và công cụ (karaṇa).

Adhikaraṇattho ādhārattho.

Adhikaraṇattho (the meaning of substratum) is the meaning of support.

Adhikaraṇattho (ý nghĩa của căn cứ) là ý nghĩa của sự nương tựa.

Bhāvo nāma kiriyā, tāya kiriyantaralakkhaṇaṃ bhāvenabhāvalakkhaṇaṃ.

Bhāva means action; bhāvenabhāvalakkhaṇaṃ is a characteristic of another action by means of that action.

Bhāva (trạng thái) là hành động, bhāvenabhāvalakkhaṇaṃ (sự biểu thị trạng thái bằng trạng thái khác) là sự biểu thị một hành động bằng một hành động khác.

Tattha yathā kālo sabhāvadhammaparicchinno sayaṃ paramatthato avijjamānopi ādhārabhāvena paññāto taṅkhaṇappavattānaṃ tato pubbe parato ca abhāvato ‘‘pubbaṇhe jāto, sāyanhe gacchatī’’ti ca ādīsu, samūho ca avayavavinimutto avijjamānopi kappanāmattasiddho avayavānaṃ ādhārabhāvena paññāpīyati ‘‘rukkhe sākhā, yavarāsiyaṃ sambhūto’’tiādīsu, evaṃ idhāpīti dassento āha ‘‘adhikaraṇañhi…pe… dhammāna’’nti.

Just as time, though defined by its own nature and not ultimately existent in itself, is conceptualized as a basis (ādhāra), since things occurring at a specific moment do not exist before or after it, as in phrases like "born in the morning, goes in the evening"; and just as an aggregation, though non-existent apart from its constituents and merely established by concept, is conceptualized as a basis for its constituents, as in "branches on a tree, arisen in a heap of barley"; in the same way here, meaning to show this, it says: "For 'locus'...etc....of phenomena."

Giống như thời gian, dù được định rõ bởi các pháp tự tánh và tự thân không hiện hữu trong ý nghĩa tối hậu, nhưng lại được quy định là một nền tảng cho các pháp khởi lên trong khoảnh khắc đó, vì chúng không hiện hữu trước hay sau đó, như trong các câu "sinh vào buổi sáng, đi vào buổi chiều"; và giống như một tập hợp, dù không hiện hữu tách rời khỏi các thành phần của nó và chỉ thành tựu do sự giả định, nhưng lại được quy định là một nền tảng cho các thành phần của nó, như trong các câu "cành cây trên cây, sinh ra trong đống lúa mạch"; tương tự như vậy ở đây, để chỉ ra điều này,^* nói: "Thật vậy, đối cách sở y... (v.v.)... của các pháp."

Yasmiṃ kāle dhammapuñje vā kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃ eva kāle dhammapuñje ca phassādayopi hontīti ayañhi tattha attho.

The meaning there is this: "At which time, or in which aggregate of phenomena, a wholesome kāmāvacara citta arises, at that very time and in that very aggregate of phenomena, contact and other phenomena also exist."

Ý nghĩa ở đây là: Vào thời điểm nào, hoặc trong tập hợp các pháp nào mà tâm thiện dục giới khởi lên, thì chính vào thời điểm đó, hoặc trong tập hợp các pháp đó, xúc và các pháp khác cũng hiện hữu.

Yathā ca ‘‘gāvīsu duyhamānāsu gato, duddhāsu āgato’’ti dohanakiriyāya gamanakiriyā lakkhīyati, evaṃ idhāpi ‘‘yasmiṃ samaye, tasmiṃ samaye’’ti ca vutte ‘‘satī’’ti ayamattho viññāyamāno eva hoti padatthassa sattāvirahābhāvatoti samayassa sattākiriyāya cittassa uppādakiriyā phassādīnaṃ bhavanakiriyā ca lakkhīyati.

And just as in "he left while the cows were being milked, he arrived after they were milked," the action of going is indicated by the action of milking; similarly here, when "at which moment, at that moment" is stated, the meaning "when existing" (sati) is clearly understood, because the meaning of the word implies existence. Thus, the arising of citta and the existence of contact and other phenomena are indicated by the existence of the moment.

Và giống như khi nói "đi khi bò đang vắt sữa, đến khi bò đã vắt sữa xong" thì hành động đi được biểu thị bằng hành động vắt sữa, tương tự như vậy ở đây, khi nói "vào thời điểm nào, vào thời điểm đó" thì ý nghĩa "khi có" (satī) được hiểu rõ ràng, vì ý nghĩa của từ không thể thiếu sự hiện hữu; do đó, hành động khởi lên của tâm và hành động hiện hữu của xúc và các pháp khác được biểu thị bằng hành động hiện hữu của thời điểm.

Yasmiṃ samayeti yasmiṃ navame khaṇe, yasmiṃ yonisomanasikārādihetumhi, paccayasamavāye vā sati kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃyeva khaṇe, hetumhi, paccayasamavāye vā phassādayopi hontīti ubhayattha samayasadde bhummaniddeso kato lakkhaṇabhūtabhāvayuttoti dassento āha ‘‘khaṇa…pe… lakkhīyatī’’ti.

" At which moment" refers to which ninth moment, in which condition such as proper attention (yonisomanasikāra), or when there is a conjunction of causes (paccayasamavāya), a wholesome kāmāvacara citta arises. At that very moment, in that condition, or in that conjunction of causes, contact and other phenomena also exist. The locative case (bhummaniddesa) is used for the word "moment" (samaya) in both instances, indicating a concomitant condition. Thus, it states: " moment...etc....is indicated."

Yasmiṃ samaye (vào thời điểm nào) nghĩa là: vào khoảnh khắc thứ chín nào, hoặc khi có nhân duyên như tác ý đúng đắn, hoặc khi có sự kết hợp của các duyên mà tâm thiện dục giới khởi lên, thì chính vào khoảnh khắc đó, hoặc khi có nhân duyên, hoặc khi có sự kết hợp của các duyên đó, xúc và các pháp khác cũng hiện hữu. Để chỉ ra rằng ở cả hai nơi, từ "samaya" (thời điểm) được dùng ở cách sở y để biểu thị sự kiện được biểu thị bằng dấu hiệu,^* nói: "Khoảnh khắc... (v.v.)... được biểu thị."

117

Hetuattho karaṇattho ca sambhavati ‘‘annena vasati, ajjhenena vasati, pharasunā chindati, kudālena khaṇatī’’tiādīsu viya.

The meaning of cause (hetu) and the meaning of instrument (karaṇa) are possible, as in "he lives by food, he lives by studying, he cuts with an axe, he digs with a spade."

Ý nghĩa nhân duyên và ý nghĩa công cụ có thể xảy ra, giống như trong các câu "sống nhờ thức ăn, sống nhờ học tập, chặt bằng rìu, đào bằng cuốc."

Vītikkamañhi sutvā bhikkhusaṅghaṃ sannipātāpetvā otiṇṇavatthukaṃ puggalaṃ paṭipucchitvā vigarahitvā ca taṃ taṃ vatthuṃ otiṇṇakālaṃ anatikkamitvā teneva kālena sikkhāpadāni paññapento bhagavā viharati sikkhāpadapaññattihetuñca apekkhamāno tatiyapārājikādīsu viya.

For the Blessed One, upon hearing a transgression, having convened the Bhikkhu Saṅgha, questioned the individual who had committed the act, reprimanded him, and then, without exceeding the time when that act was committed, resided in the act of laying down the training rules (sikkhāpadāni) at that very time, also considering the cause for the promulgation of the training rules, as in the cases of the third Pārājika and others.

Thật vậy, sau khi nghe về một sự vi phạm, Đức Thế Tôn triệu tập Tăng đoàn, hỏi người đã phạm lỗi, khiển trách và sau đó chế định các học giới mà không vượt quá thời điểm phạm lỗi đó, Ngài an trú trong khi mong muốn nhân duyên chế định học giới, giống như trong các trường hợp về giới Ba-la-di thứ ba và các giới khác.

118

Accantameva ārambhato paṭṭhāya yāva desanāniṭṭhānaṃ parahitapaṭipattisaṅkhātena karuṇāvihārena.

Absolutely, from the beginning (ārambha) up to the completion of the teaching (desanāniṭṭhāna), with the abiding of compassion (karuṇāvihāra), which is characterized by practice for the welfare of others.

Hoàn toàn từ lúc bắt đầu cho đến khi kết thúc bài giảng, với sự an trú từ bi được gọi là thực hành vì lợi ích của người khác.

Tadatthajotanatthanti accantasaṃyogatthajotanatthaṃ.

For the purpose of illustrating that meaning (tadatthajotanatthaṃ) means for the purpose of illustrating the meaning of absolute conjunction.

Để làm sáng tỏ ý nghĩa đó nghĩa là để làm sáng tỏ ý nghĩa của sự liên tục tuyệt đối.

Upayogavacananiddeso kato yathā ‘‘māsaṃ ajjhetī’’ti.

The term of usage is stated, as in "he studies for a month."

Sự chỉ định bằng cách dùng từ chỉ sự liên tục đã được thực hiện, giống như "học suốt tháng."

119

Porāṇāti aṭṭhakathācariyā.

The ancients (porāṇā) refers to the Aṭṭhakathā teachers.

Porāṇā (các vị cổ đức) là các vị Luận sư.

Abhilāpamattabhedoti vacanamattena viseso.

Mere difference in utterance (abhilāpamattabhedo) means a distinction solely in wording.

Abhilāpamattabhedo (sự khác biệt chỉ về cách diễn đạt) là sự khác biệt chỉ về từ ngữ.

Tena suttavinayesu vibhattibyattayo katoti dasseti.

Thereby, it shows that variations in case endings (vibhattibyattayo) are made in the suttas and vinaya.

Điều này cho thấy rằng sự khác biệt về cách chia động từ đã được thực hiện trong các kinh và luật.

120

Seṭṭhanti seṭṭhavācakaṃ vacanaṃ ‘‘seṭṭha’’nti vuttaṃ seṭṭhaguṇasahacaraṇato.

"Seṭṭha" (best) refers to a word signifying "best," which is called "seṭṭha" due to its association with excellent qualities.

Seṭṭhaṃ (tối thượng) là từ chỉ sự tối thượng, được gọi là "seṭṭha" vì liên quan đến phẩm chất tối thượng.

Tathā uttamanti etthāpi.

Similarly, with "uttama" (supreme) here.

Tương tự như vậy ở đây uttama (tối cao) cũng vậy.

Gāravayuttoti garubhāvayutto garuguṇayogato, garukaraṇārahatāya vā gāravayutto.

"Gāravayutto" (endowed with reverence) means endowed with reverence due to possessing weighty qualities, or gāravayutto because he is worthy of reverence.

Gāravayutto (đáng kính) nghĩa là có phẩm chất đáng kính do sự kết hợp của các phẩm chất đáng kính, hoặc gāravayutto do đáng được tôn kính.

Vuttoyeva, na pana idha vattabbo visuddhimaggassa imissā aṭṭhakathāya ekadesabhāvatoti adhippāyo.

It has already been stated, and it is not to be spoken of here, because it is a part of this commentary on the Visuddhimagga; this is the intention.

Ý nghĩa là: đã được nói rồi, và không cần phải nói ở đây, vì đây là một phần của Visuddhimagga (Thanh Tịnh Đạo) này.

121

Aparo nayo (saṃ. ni. ṭī. 1.1.1; sārattha. ṭī. 1.vinayānisaṃsakathāvaṇṇanā; visuddhi. mahāṭī. 1.144; itivu. aṭṭha. ganthārambhakathā) – bhāgavāti bhagavā, bhatavāti bhagavā, bhāge vanīti bhagavā, bhage vanīti bhagavā, bhattavāti bhagavā, bhage vamīti bhagavā, bhāge vamīti bhagavā.

Another method: Bhāgavā means Bhagavā; bhatavā means Bhagavā; bhāge vanī means Bhagavā; bhage vanī means Bhagavā; bhattavā means Bhagavā; bhage vamī means Bhagavā; bhāge vamī means Bhagavā.

Một phương pháp khác (Saṃ. Ni. Ṭī. 1.1.1; Sārattha. Ṭī. 1. Vinayānisaṃsakathāvaṇṇanā; Visuddhi. Mahāṭī. 1.144; Itivu. Aṭṭha. Ganthārambhakathā) – Bhagavā là bhāgavā, Bhagavā là bhatavā, Bhagavā là bhāge vanī, Bhagavā là bhage vanī, Bhagavā là bhattavā, Bhagavā là bhage vamī, Bhagavā là bhāge vamī.

122

Bhagavā bhatavā bhāge, bhage ca vani bhattavā;

Bhagavā, he ate portions, and he desired portions; he bore portions,

Bhagavā là bhatavā trong các phần, và vanī trong các phần; bhattavā;

123

Bhage vami tathā bhāge, vamīti bhagavā jino.

And he vomited portions, and he vomited portions; thus is Bhagavā, the Conqueror.

Bhage vami, cũng như bhāge, vamīti Bhagavā, vị Chiến Thắng.

124

Tattha kathaṃ bhāgavāti bhagavā?

Among these, how is "bhāgavā" Bhagavā?

Trong đó, làm thế nào để bhāgavā là Bhagavā?

Ye te sīlādayo dhammakkhandhā guṇabhāgā guṇakoṭṭhāsā, te anaññasādhāraṇā niratisayā tathāgatassa atthi upalabbhanti.

Those aggregates of phenomena, such as morality, which are portions of qualities (guṇabhāgā), are found existing in the Tathāgata, being uncommon and unsurpassed.

Những uẩn pháp phẩm chất như giới và các pháp khác, những phần phẩm chất, những khía cạnh phẩm chất đó, không ai khác có được và không thể vượt trội, chúng hiện hữu và được tìm thấy nơi Đức Như Lai.

Tathā hissa sīlaṃ, samādhi, paññā, vimutti, vimuttiñāṇadassanaṃ, hirī, ottappaṃ, saddhā, vīriyaṃ, sati sampajaññaṃ, sīlavisuddhi, diṭṭhivisuddhi, samatho, vipassanā, tīṇi kusalamūlāni, tīṇi sucaritāni, tayo sammāvitakkā, tisso anavajjasaññā, tisso dhātuyo, cattāro satipaṭṭhānā, cattāro sammappadhānā, cattāro iddhipādā, cattāro ariyamaggā, cattāri ariyaphalāni, catasso paṭisambhidā, catuyonipaṭicchedakañāṇaṃ, cattāro ariyavaṃsā, cattāri vesārajjañāṇāni, pañca padhāniyaṅgāni, pañcaṅgiko sammāsamādhi, pañcañāṇiko sammāsamādhi, pañcindriyāni, pañca balāni, pañca nissāraṇīyā dhātuyo, pañca vimuttāyatanañāṇāni, pañca vimuttiparipācanīyā saññā, cha anussatiṭṭhānāni, cha gāravā, cha nissāraṇīyā dhātuyo, cha satatavihārā, cha anuttariyāni, cha nibbedhabhāgiyā saññā, cha abhiññā, cha asādhāraṇañāṇāni, satta aparihāniyā dhammā, satta ariyadhammā, satta ariyadhanāni, satta bojjhaṅgā, satta sappurisadhammā, satta nijjaravatthūni, satta saññā, satta dakkhiṇeyyapuggaladesanā, satta khīṇāsavabaladesanā, aṭṭha paññāpaṭilābhahetudesanā, aṭṭha sammattāni, aṭṭha lokadhammātikkamā, aṭṭha ārambhavatthūni, aṭṭha akkhaṇadesanā, aṭṭha mahāpurisavitakkā, aṭṭha abhibhāyatanadesanā, aṭṭha vimokkhā, nava yonisomanasikāramūlakā dhammā, nava pārisuddhipadhāniyaṅgāni, nava sattāvāsadesanā, nava āghātapaṭivinayā, nava saññā, nava nānattā, nava anupubbavihārā, dasa nāthakaraṇā dhammā, dasa kasiṇāyatanāni, dasa kusalakammapathā, dasa sammattāni, dasa ariyavāsā, dasa asekkhadhammā, dasa tathāgatabalāni, ekādasa mettānisaṃsā, dvādasa dhammacakkākārā, terasa dhutaguṇā, cuddasa buddhañāṇāni, pañcadasa vimuttiparipācanīyā dhammā, soḷasavidhā ānāpānassati, soḷasa aparantapanīyā dhammā, aṭṭhārasa buddhadhammā, ekūnavīsati paccavekkhaṇañāṇāni, catucattālīsa ñāṇavatthūni, paññāsa udayabbayañāṇāni, paropaṇṇāsa kusaladhammā, sattasattati ñāṇavatthūni, catuvīsatikoṭisatasahassasaṅkhāsamāpattisañcārimahāvajirañāṇaṃ, anantanayasamantapaṭṭhānapavicayapaccavekkhaṇadesanāñāṇāni tathā anantāsu lokadhātūsu anantānaṃ sattānaṃ āsayādivibhāvanañāṇāni cāti evamādayo anantāparimāṇabhedā anaññasādhāraṇā niratisayā guṇabhāgā guṇakoṭṭhāsā saṃvijjanti upalabbhanti, tasmā yathāvuttavibhāgā guṇabhāgā assa atthīti ‘‘bhāgavā’’ti vattabbe ā-kārassa rassattaṃ katvā ‘‘bhagavā’’ti vutto.

Thus, his morality (sīla), concentration (samādhi), wisdom (paññā), liberation (vimutti), knowledge and vision of liberation (vimuttiñāṇadassana), shame (hirī), dread of wrongdoing (ottappa), faith (saddhā), energy (vīriya), mindfulness (sati) and clear comprehension (sampajañña), purification of morality (sīlavisuddhi), purification of view (diṭṭhivisuddhi), tranquility (samatha), insight (vipassanā), the three wholesome roots, the three good conduct, the three right thoughts, the three blameless perceptions, the three elements (dhātu), the four foundations of mindfulness (satipaṭṭhāna), the four right exertions (sammappadhāna), the four bases of psychic power (iddhipāda), the four noble paths (ariyamagga), the four noble fruits (ariyaphala), the four analytical knowledges (paṭisambhidā), the knowledge that cuts off the four origins of existence, the four noble lineages (ariyavaṃsa), the four knowledges of fearlessness (vesārajjañāṇa), the five factors of striving (padhāniyaṅga), the five-factored right concentration, the five-knowledge right concentration, the five faculties (indriya), the five powers (bala), the five elements of escape (nissāraṇīyā dhātu), the five knowledges of freedom's sphere (vimuttāyatanañāṇa), the five perceptions conducive to the ripening of freedom (vimuttiparipācanīyā saññā), the six objects of recollection (anussatiṭṭhāna), the six forms of reverence (gārava), the six elements of escape, the six constant abidings, the six supreme things (anuttariya), the six perceptions conducive to penetration (nibbedhabhāgiyā saññā), the six higher knowledges (abhiññā), the six uncommon knowledges, the seven conditions of non-decline (aparihāniyā dhamma), the seven noble qualities (ariyadhamma), the seven noble treasures (ariyadhana), the seven factors of awakening (bojjhaṅga), the seven qualities of a good person (sappurisadhamma), the seven bases of wearing away (nijjaravatthu), the seven perceptions, the teaching of the seven persons worthy of offerings (dakkhiṇeyyapuggala), the teaching of the seven powers of an Arahant (khīṇāsavabala), the teaching of the eight causes for the attainment of wisdom (paññāpaṭilābhahetu), the eight forms of rightness (sammatta), the eight transcendences of worldly conditions (lokadhammātikkama), the eight bases of effort (ārambhavatthu), the teaching of the eight un-opportune moments (akkhaṇa), the eight thoughts of a great person (mahāpurisavitakka), the teaching of the eight spheres of mastery (abhibhāyatana), the eight liberations (vimokkha), the nine phenomena rooted in proper attention, the nine factors of purity and striving (pārisuddhipadhāniyaṅga), the teaching of the nine abodes of beings (sattāvāsa), the nine ways of subduing resentment (āghātapaṭivinaya), the nine perceptions, the nine varieties (nānattā), the nine successive abidings (anupubbavihāra), the ten qualities that make one a protector (nāthakaraṇa), the ten spheres of kasina (kasiṇāyatana), the ten courses of wholesome action (kusalakammapatha), the ten forms of rightness, the ten noble abidings (ariyavāsa), the ten qualities of a trainee (asekkha), the ten Tathāgata powers, the eleven benefits of loving-kindness (mettānisaṃsa), the twelve aspects of the Wheel of Dhamma, the thirteen ascetic practices (dhutaguṇa), the fourteen Buddha knowledges, the fifteen phenomena conducive to the ripening of freedom, the sixteen kinds of mindfulness of breathing (ānāpānassati), the sixteen phenomena to be removed from the future, the eighteen Buddha qualities (buddhadhamma), the nineteen knowledges of reviewing (paccavekkhaṇañāṇa), the forty-four knowledge-objects (ñāṇavatthu), the fifty knowledges of rise and fall (udayabbayañāṇa), the fifty-nine wholesome phenomena, the seventy-seven knowledge-objects, the great adamantine knowledge (mahāvajirañāṇa) extending to one hundred thousand twenty-four crores of attainments, the knowledges for the teaching of the investigation and reflection of the infinite methods of dependent origination (samantapaṭṭhānapavicaya), and the knowledges for discerning the dispositions of infinite beings in infinite world-systems, and so on—thus, infinite and immeasurable distinctions, uncommon and unsurpassed portions of qualities (guṇabhāgā), portions of qualities (guṇakoṭṭhāsā) exist and are found in him. Therefore, because he possesses the aforementioned distinguished portions of qualities, when it should be said "bhāgavā," the 'ā' vowel is shortened, and he is called "Bhagavā."

Thật vậy, nơi Ngài có: giới, định, tuệ, giải thoát, giải thoát tri kiến, tàm, quý, tín, tinh tấn, niệm và tuệ tri, giới thanh tịnh, kiến thanh tịnh, định, tuệ quán, ba căn lành, ba thiện hành, ba chánh tư duy, ba tưởng không lỗi, ba giới, bốn niệm xứ, bốn chánh cần, bốn thần túc, bốn thánh đạo, bốn thánh quả, bốn vô ngại giải, trí cắt đứt bốn loại sinh, bốn thánh chủng, bốn trí vô sở úy, năm chi phần tinh tấn, chánh định có năm chi, chánh định có năm trí, năm căn, năm lực, năm giới giải thoát, năm trí về xứ giải thoát, năm tưởng làm cho giải thoát chín muồi, sáu niệm xứ, sáu sự cung kính, sáu giới giải thoát, sáu sự an trú liên tục, sáu vô thượng, sáu tưởng hướng đến sự thấu triệt, sáu thắng trí, sáu trí không chung với ai khác, bảy pháp không thoái chuyển, bảy thánh pháp, bảy thánh tài, bảy giác chi, bảy pháp của bậc chân nhân, bảy sự đoạn trừ, bảy tưởng, sự giảng dạy về bảy hạng người đáng cúng dường, sự giảng dạy về bảy lực của bậc lậu tận, sự giảng dạy về tám nhân để đạt được tuệ, tám chánh tính, tám sự siêu việt thế gian pháp, tám sự khởi đầu, sự giảng dạy về tám thời không, tám đại nhân tư duy, sự giảng dạy về tám thắng xứ, tám giải thoát, chín pháp có gốc từ tác ý đúng đắn, chín chi phần tinh tấn thanh tịnh, sự giảng dạy về chín trú xứ của chúng sinh, chín sự đoạn trừ oán hận, chín tưởng, chín sự sai khác, chín thứ lớp an trú, mười pháp làm chỗ nương tựa, mười xứ biến xứ, mười nghiệp đạo thiện, mười chánh tính, mười thánh trú, mười pháp vô học, mười lực của Như Lai, mười một lợi ích của tâm từ, mười hai phương diện của bánh xe Pháp, mười ba hạnh đầu đà, mười bốn trí Phật, mười lăm pháp làm cho giải thoát chín muồi, mười sáu loại quán niệm hơi thở, mười sáu pháp không còn sự kết thúc, mười tám Phật pháp, mười chín trí quán xét, bốn mươi bốn trí sở y, năm mươi trí sinh diệt, năm mươi bốn pháp thiện, bảy mươi bảy trí sở y, trí kim cương vĩ đại vận hành trong các thiền định với số lượng một trăm ngàn vạn hai mươi bốn triệu, trí giảng dạy về sự quán xét các phương diện vô tận và sự khởi đầu của mọi thứ, cũng như trí phân biệt các khuynh hướng của vô số chúng sinh trong vô số thế giới và các trí khác; như vậy, vô số và vô lượng các phần phẩm chất, các khía cạnh phẩm chất không ai khác có được và không thể vượt trội, chúng hiện hữu và được tìm thấy. Do đó, vì Ngài có các phần phẩm chất như đã nói trên, nên khi đáng lẽ phải nói "bhāgavā" thì chữ "ā" đã được rút ngắn thành "a", và Ngài được gọi là "Bhagavā."

Evaṃ tāva bhāgavāti bhagavā.

Thus, first, 'possessed of shares' (bhāgavā) means Bhagavā.

Như vậy, Bhagavā (Thế Tôn) là bậc có phước báu.

125

Yasmā sīlādayo sabbe, guṇabhāgā asesato;

Because all shares of virtues, such as sīla, without remainder,

Vì tất cả các phần công đức,

126

Vijjanti sugate tasmā, bhagavāti pavuccatīti.

Are found in the Fortunate One, therefore he is called Bhagavā.

Như giới v.v... đều hiện hữu nơi Thiện Thệ không sót, do đó Ngài được gọi là Bhagavā (Thế Tôn).

127

Kathaṃ bhatavāti bhagavā?

How is 'sustained' (bhatavā) Bhagavā?

Thế nào là Bhagavā (Thế Tôn) vì Ngài là bhatavā (người đã tích lũy)?

Ye te sabbalokahitāya ussukkamāpannehi manussattādike aṭṭha dhamme samodhānetvā sammāsambodhiyā katamahābhinīhārehi mahābodhisattehi paripūritabbā dānapāramī, sīla, nekkhamma, paññā, vīriya, khanti, sacca, adhiṭṭhāna, mettā, upekkhāpāramīti dasa pāramiyo dasa upapāramiyo dasa paramatthapāramiyoti samatiṃsa pāramiyo, dānādīni cattāri saṅgahavatthūni, saccādīni cattāri adhiṭṭhānāni, aṅgapariccāgo nayanadhanarajjaputtadārapariccāgoti pañca mahāparicāgā, pubbayogo, pubbacariyā, dhammakkhānaṃ, ñātatthacariyā, lokatthacariyā, buddhicariyāti evamādayo, saṅkhepato vā sabbe puññañāṇasambhārā buddhakaradhammā, te mahābhinīhārato paṭṭhāya kappānaṃ satasahassādhikāni cattāri asaṅkheyyāni yathā hānabhāgiyā saṃkilesabhāgiyā ṭhitibhāgiyā vā na honti, atha kho uttaruttari visesabhāgiyāva honti, evaṃ sakkaccaṃ nirantaraṃ anavasesato bhatā sambhatā assa atthīti ‘‘bhatavā’’ti vattabbe ‘‘bhagavā’’ti vutto niruttinayena ta-kārassa ga-kāraṃ katvā.

Those thirty perfections—the ten perfections of giving, moral conduct, renunciation, wisdom, energy, patience, truthfulness, determination, loving-kindness, and equanimity; the ten minor perfections; and the ten ultimate perfections—which had to be fulfilled by the great Bodhisattas, who, striving for the welfare of all beings, having gathered the eight qualities such as human existence, and made great aspirations for Perfect Self-Awakening; and the four bases of attraction such as giving; the four determinations such as truth; the five great renunciations, such as the sacrifice of one's limbs, eyes, wealth, kingdom, children, and wife; previous connection, previous practice, exposition of the Dhamma, working for the good of relatives, working for the good of the world, and working for the good of Awakening—these and similar, or in brief, all the accumulations of merit and knowledge, the qualities that make one a Buddha—from the time of his great aspiration for four incalculables and a hundred thousand aeons, these did not become subject to decline, defilement, or stagnation, but rather became increasingly excellent. In this way, because they were diligently, continuously, and completely sustained (bhatā) and accumulated (sambhatā), he is called Bhagavā, which is said as 'bhatavā' but, by the rule of etymology, the 'ta' sound is changed to 'ga'.

Những gì là ba mươi Ba-la-mật: mười Ba-la-mật, mười Upapāramī (Ba-la-mật thứ yếu), mười Paramatthapāramī (Ba-la-mật tối thượng) – đó là bố thí Ba-la-mật, giới, xuất ly, trí tuệ, tinh tấn, nhẫn nại, chân thật, kiên định, từ bi, xả Ba-la-mật – mà các vị Đại Bồ-tát đã viên mãn bằng những lời đại nguyện chân chánh giác ngộ, sau khi đã hội đủ tám pháp như nhân loại v.v... với ý chí cao cả vì lợi ích của tất cả chúng sinh; bốn pháp nhiếp sự như bố thí v.v...; bốn sự kiên định như chân thật v.v...; năm sự đại hy sinh: hy sinh thân thể, hy sinh mắt, tài sản, vợ con; sự tu tập trong quá khứ, sự thực hành trong quá khứ, sự thuyết pháp, sự thực hành vì lợi ích người thân, sự thực hành vì lợi ích thế gian, sự thực hành vì trí tuệ v.v...; hoặc nói tóm lại, tất cả các tư lương phước đức và trí tuệ, các pháp làm nên một vị Phật. Kể từ khi phát đại nguyện, trong suốt bốn a-tăng-kỳ và một trăm ngàn đại kiếp, những pháp ấy không phải là pháp suy giảm, pháp ô nhiễm, hay pháp an trụ, mà chỉ là pháp ngày càng tăng trưởng và thù thắng hơn. Vì Ngài đã tích lũy (bhatā sambhatā) một cách kỹ lưỡng, liên tục và không sót những pháp ấy, nên lẽ ra phải gọi là ‘‘bhatavā’’, nhưng theo quy tắc ngữ nguyên, chữ ‘‘ta’’ đã được đổi thành ‘‘ga’’, nên Ngài được gọi là ‘‘Bhagavā’’.

Atha vā bhatavāti teyeva yathāvutte buddhakaradhamme vuttanayeneva bhari sambhari, paripūresīti attho.

Alternatively, 'bhatavā' means that he nourished (bhari) and accumulated (sambhari) those very qualities that make one a Buddha, as mentioned, and brought them to completion.

Hoặc, bhatavā có nghĩa là Ngài đã gánh vác (bhari sambhari), đã viên mãn các pháp làm nên một vị Phật đã nói trên theo cách đã trình bày.

Evampi bhatavāti bhagavā.

Thus, 'bhatavā' (sustained) is also Bhagavā.

Như vậy, Bhagavā (Thế Tôn) là người đã tích lũy.

128

Sammāsambodhiyā sabbe, dānapāramiādike;

Because the Protector accumulated all the requisites for Perfect Self-Awakening,

Vì vị Đạo Sư đã tích lũy

129

Sambhāre bhatavā nātho, tenāpi bhagavā matoti.

Such as the perfection of giving, for that reason too he is considered Bhagavā.

Tất cả các tư lương như bố thí Ba-la-mật v.v... để đạt đến Chánh Đẳng Giác, do đó Ngài cũng được xem là Bhagavā (Thế Tôn).

130

Kathaṃ bhāge vanīti bhagavā?

How is 'one who delights in shares' (bhāge vanī) Bhagavā?

Thế nào là Bhagavā (Thế Tôn) vì Ngài là bhāge vanī (người đã thực hành các phần)?

Ye te catuvīsatikoṭisatasahassasaṅkhā devasikaṃ vaḷañjanakasamāpattibhāgā, te anavasesato lokahitatthaṃ attano ca diṭṭhadhammasukhavihāratthaṃ niccakappaṃ vani bhaji sevi bahulamakāsīti bhāge vanīti bhagavā.

Because he constantly delighted in (vani), frequented, and extensively cultivated (bahulamakāsī) those shares of attainment—numbering twenty-four hundred thousand million daily—for the welfare of the world and for his own comfortable dwelling in this very life, he is Bhagavā as 'one who delights in shares' (bhāge vanī).

Những phần thiền định hàng ngày có số lượng một trăm ngàn hai mươi bốn mươi triệu (240.000.000), Ngài đã thực hành (vani bhaji sevi bahulamakāsi) không sót, thường xuyên, vì lợi ích thế gian và vì sự an lạc trong hiện tại của chính mình. Do đó, Ngài là Bhagavā (Thế Tôn) vì Ngài đã thực hành các phần.

Atha vā abhiññeyyadhammesu kusalādīsu khandhādīsu ca ye te pariññeyyādivasena saṅkhepato vā catubbidhā abhisamayabhāgā, vitthārato pana ‘‘cakkhu pariññeyyaṃ sotaṃ…pe… jarāmaraṇaṃ pariññeyya’’ntiādinā (paṭi. ma. 1.21) aneke pariññeyyabhāgā, ‘‘cakkhussa samudayo pahātabbo…pe… jarāmaraṇassa samudayo pahātabbo’’tiādinā pahātabbabhāgā, ‘‘cakkhussa nirodho…pe… jarāmaraṇassa nirodho sacchikātabbo’’tiādinā sacchikātabbabhāgā, ‘‘cakkhussa nirodhagāminī paṭipadā’’tiādinā, ‘‘cattāro satipaṭṭhānā’’tiādinā ca anekabhedā bhāvetabbabhāgā ca dhammā, te sabbe vani bhaji yathārahaṃ gocarabhāvanāsevanānaṃ vasena sevi.

Alternatively, regarding the knowable phenomena, such as wholesome qualities, and the aggregates, those shares of realization (abhisamayabhāgā), which are of four kinds in brief (such as to be fully understood), and extensively, many shares to be fully understood, such as "the eye is to be fully understood, the ear... old age and death are to be fully understood" (Paṭis. 1.21); shares to be abandoned, such as "the origin of the eye is to be abandoned... the origin of old age and death is to be abandoned"; shares to be realized, such as "the cessation of the eye... the cessation of old age and death is to be realized"; and many varied shares to be developed, such as "the path leading to the cessation of the eye" and "the four establishments of mindfulness"; all these phenomena he delighted in (vani) and cultivated (sevi) by way of appropriate objects of meditation and practice.

Hoặc, trong các pháp cần phải hiểu biết, như các pháp thiện v.v... và các uẩn v.v..., có những phần cần phải hiểu biết v.v... hoặc nói tóm lại là bốn loại phần của sự chứng ngộ. Tuy nhiên, nói rộng ra, có nhiều phần cần phải hiểu biết như ‘‘nhãn cần phải hiểu biết, nhĩ…v.v… già chết cần phải hiểu biết’’ v.v...; các phần cần phải đoạn trừ như ‘‘sự tập khởi của nhãn cần phải đoạn trừ…v.v… sự tập khởi của già chết cần phải đoạn trừ’’ v.v...; các phần cần phải chứng ngộ như ‘‘sự diệt của nhãn…v.v… sự diệt của già chết cần phải chứng ngộ’’ v.v...; và các phần cần phải tu tập với nhiều loại khác nhau như ‘‘con đường đưa đến sự diệt của nhãn’’ v.v..., ‘‘bốn niệm xứ’’ v.v... Ngài đã thực hành (vani bhaji sevi) tất cả những pháp ấy một cách thích đáng, theo cách thực hành đối tượng và tu tập.

Evampi bhāge vanīti bhagavā.

Thus, 'one who delights in shares' (bhāge vanī) is also Bhagavā.

Như vậy, Bhagavā (Thế Tôn) là người đã thực hành các phần.

Atha vā ‘‘ye ime sīlādayo dhammakkhandhā sāvakehi sādhāraṇā guṇabhāgā guṇakoṭṭhāsā, kinti nu kho te vineyyasantānesu patiṭṭhapeyya’’nti mahākaruṇāya vani abhipatthayi, sā cassa abhipatthanā yathādhippetaphalāvahā ahosi.

Alternatively, with great compassion he desired (vani) to establish these Dhamma aggregates of virtues, which are common to disciples—these shares of virtue, portions of virtue—in the minds of those to be trained, saying: "How might I establish them?" And his aspiration bore the desired fruit.

Hoặc, với đại bi tâm, Ngài đã mong muốn (vani abhipatthayi) rằng: ‘‘Làm sao để những pháp uẩn như giới v.v... là những phần công đức, những phần phẩm chất chung với các đệ tử, có thể được an lập trong dòng tâm thức của những người cần được giáo hóa?’’ Và sự mong muốn ấy của Ngài đã mang lại kết quả như ý.

Evampi bhāge vanīti bhagavā.

Thus, 'one who delights in shares' (bhāge vanī) is also Bhagavā.

Như vậy, Bhagavā (Thế Tôn) là người đã mong muốn các phần.

131

Yasmā ñeyyasamāpattiguṇabhāge asesato;

Because he cultivated and desired for the welfare of beings

Vì Ngài đã thực hành và mong muốn

132

Bhaji patthayi sattānaṃ, hitāya bhagavā tatoti.

All the shares of virtue pertaining to knowable attainments, therefore he is Bhagavā.

Tất cả các phần công đức của thiền định và các pháp cần phải hiểu biết vì lợi ích của chúng sinh, do đó Ngài là Bhagavā (Thế Tôn).

133

Kathaṃ bhage vanīti bhagavā?

How is 'one who delighted in good fortune' (bhage vanī) Bhagavā?

Thế nào là Bhagavā (Thế Tôn) vì Ngài là bhage vanī (người đã hưởng thụ các phước báu)?

Samāsato tāva katapuññehi payogasampannehi yathāvibhavaṃ bhajīyantīti bhagā, lokiyalokuttarā sampattiyo.

In brief, 'good fortunes' (bhagā) are worldly and supramundane achievements, which are enjoyed by those who have performed meritorious deeds and possess successful exertion.

Nói tóm lại, các phước báu (bhagā) là những thành tựu thế gian và siêu thế mà những người đã tạo công đức và có sự tinh tấn đã hưởng thụ (bhajīyanti) tùy theo khả năng.

Tattha lokiye tāva tathāgato sambodhito pubbe bodhisattabhūto paramukkaṃsagate vani bhaji sevi, yattha patiṭṭhāya niravasesato buddhakaradhamme samannānento buddhadhamme paripācesi, buddhabhūto pana te niravajjasukhūpasaṃhite anaññasādhāraṇe lokuttarepi vani bhaji sevi, vitthārato pana padesarajjaissariyacakkavattisampatti-devarajjasampattiādivasena- jhānavimokkhasamādhisamāpattiñāṇadassana-maggabhāvanāphalasacchi- kiriyādi-uttarimanussadhammavasena ca anekavihite anaññasādhāraṇe bhage vani bhaji sevi.

Among these, the Tathāgata, as a Bodhisatta before his Awakening, delighted in (vani), frequented, and cultivated the highest worldly achievements, by establishing himself in which he cultivated the qualities that make one a Buddha completely without remainder and brought the Buddha-qualities to maturity. After becoming a Buddha, he delighted in (vani), frequented, and cultivated these unblemished, blissful, and unique supramundane achievements. More extensively, he delighted in (vani), frequented, and cultivated various unique achievements in terms of provincial sovereignty, imperial rule, divine kingship, and so on; and in terms of supramundane states, such as jhāna, liberation, concentration, attainment, knowledge-and-vision, the cultivation of the path, and the realization of fruition.

Trong đó, về phước báu thế gian, trước khi giác ngộ, khi còn là Bồ-tát, Như Lai đã hưởng thụ (vani bhaji sevi) những phước báu tối thượng, nơi Ngài an trụ và viên mãn các pháp làm nên một vị Phật mà không bỏ sót, và đã làm chín muồi các Phật pháp. Khi đã thành Phật, Ngài cũng đã hưởng thụ (vani bhaji sevi) những phước báu siêu thế vô tội, an lạc, không ai sánh bằng. Nói rộng ra, Ngài đã hưởng thụ (vani bhaji sevi) nhiều loại phước báu không ai sánh bằng, như thành tựu vương quyền địa phương, quyền lực, địa vị chuyển luân vương; thành tựu thiên vương; và các pháp siêu nhân như thiền định, giải thoát, định, nhập định, tri kiến, sự tu tập đạo, sự chứng đắc quả v.v...

Evampi bhage vanīti bhagavā.

Thus, 'one who delighted in good fortune' (bhage vanī) is also Bhagavā.

Như vậy, Bhagavā (Thế Tôn) là người đã hưởng thụ các phước báu.

134

Yā tā sampattiyo loke, yā ca lokuttarā puthu;

Because the Perfectly Awakened One cultivated all the achievements that exist in the world

Vì Đức Phật Toàn Giác đã hưởng thụ

135

Sabbā tā bhaji sambuddho, tasmāpi bhagavā matoti.

And the diverse supramundane ones, for that reason too he is considered Bhagavā.

Tất cả những thành tựu thế gian và những thành tựu siêu thế rộng lớn, do đó Ngài cũng được xem là Bhagavā (Thế Tôn).

136

Kathaṃ bhattavāti bhagavā?

How is 'one who has many devotees' (bhattavā) Bhagavā?

Thế nào là Bhagavā (Thế Tôn) vì Ngài là bhattavā (người có nhiều đệ tử trung thành)?

Bhattā daḷhabhattikā assa bahū atthīti bhattavā.

He has many devotees (bhattā) who are firmly devoted to him, hence 'bhattavā'.

Vì Ngài có nhiều người trung thành (daḷhabhattikā), nên Ngài là bhattavā.

Tathāgato hi mahākaruṇāsabbaññutaññāṇādiaparimitanirupamapabhāvaguṇavisesasamaṅgibhāvato sabbasattuttamo, sabbānatthaparihārapubbaṅgamāya niravasesahitasukhavidhānatapparāya niratisayāya payogasampattiyā sadevamanussāya pajāya accantūpakāritāya dvattiṃsamahāpurisalakkhaṇa-asītianubyañjana-byāmappabhādianaññasādhāraṇa- visesapaṭimaṇḍita-rūpakāyatāya yathābhucca-guṇādhigatena ‘‘itipi so bhagavā’’tiādinayappavattena lokattayabyāpinā suvipulena suvisuddhena ca thutighosena samannāgatattā ukkaṃsapāramippattāsu appicchatāsantuṭṭhiādīsu suppatiṭṭhitabhāvato dasabalacatuvesārajjādiniratisayaguṇavisesa-samaṅgibhāvato ca rūpappamāṇo rūpappasanno, ghosappamāṇo ghosappasanno, lūkhappamāṇo lūkhappasanno, dhammappamāṇo dhammappasannoti evaṃ catuppamāṇike lokasannivāse sabbathāpi pasādāvahabhāvena samantapāsādikattā aparimāṇānaṃ sattānaṃ sadevamanussānaṃ ādarabahumānagāravāyatanatāya paramapemasambhattiṭṭhānaṃ.

Indeed, the Tathāgata is the supreme among all beings because he is endowed with immeasurable and incomparable power and distinguished qualities such as great compassion and omniscience; because he is supremely beneficial to the world of gods and humans through his unsurpassed successful exertion, which precedes the avoidance of all harm and is intent on providing all benefit and happiness without remainder; because his physical body is adorned with unique distinguishing features, such as the thirty-two marks of a Great Man, the eighty minor characteristics, and the fathom-wide aura; because he is endowed with a vast and very pure chorus of praise pervading the three worlds, proceeding according to the true acquisition of qualities, such as "Thus indeed is that Blessed One..."; and because he is firmly established in supreme perfections such as paucity of wants and contentment, and is endowed with unsurpassed distinguished qualities such as the ten powers and the four kinds of self-confidence. Therefore, he is supremely lovable to immeasurable beings, both gods and humans, being a source of reverence, esteem, and respect, and being all-pleasing in every way within the four kinds of people in the world (those pleased by appearance, pleased by sound, pleased by austerity, and pleased by Dhamma).

Thật vậy, Như Lai là bậc tối thượng trong tất cả chúng sinh vì Ngài đầy đủ các phẩm chất đặc biệt vô lượng, vô song, uy nghi như đại bi, nhất thiết trí v.v...; vì Ngài là bậc vô cùng hữu ích cho chúng sinh hữu thần và nhân loại, với sự tinh tấn vô thượng, luôn tận tâm mang lại mọi lợi ích và an lạc, đi trước mọi sự tránh xa tai họa; vì Ngài có thân tướng được trang điểm bằng ba mươi hai tướng đại nhân, tám mươi tướng tùy hình và ánh hào quang một tầm không ai sánh bằng; vì Ngài được ban tặng tiếng ca ngợi rộng lớn, thanh tịnh, lan tỏa khắp ba cõi theo cách đã được chứng đắc các phẩm chất chân thật như ‘‘Đức Thế Tôn ấy là bậc A-la-hán’’ v.v...; vì Ngài an trụ vững chắc trong các Ba-la-mật đạt đến đỉnh cao như thiểu dục, tri túc v.v...; và vì Ngài đầy đủ các phẩm chất đặc biệt vô thượng như mười lực, bốn vô úy v.v... Do đó, Ngài là nơi đáng tôn kính, ngưỡng mộ, kính trọng và là đối tượng của tình yêu thương và sự trung thành tối thượng của vô lượng chúng sinh hữu thần và nhân loại, vì Ngài có khả năng làm cho tất cả mọi người trong thế gian bốn loại (những người tin vào hình tướng, những người tin vào tiếng nói, những người tin vào sự khắc khổ, những người tin vào giáo pháp) đều có đức tin, vì Ngài toàn diện đáng kính.

Ye tassa ovāde patiṭṭhitā aveccappasādena samannāgatā honti, kenaci asaṃhāriyā tesaṃ pasādabhatti samaṇena vā brāhmaṇena vā devena vā mārena vā brahmunā vā.

Those who are established in his teaching and endowed with unwavering faith—their faith and devotion cannot be shaken by any ascetic, brahmin, deity, Māra, or Brahmā.

Những ai an trụ trong lời giáo huấn của Ngài, có niềm tin bất động, thì niềm tin và sự trung thành của họ không thể bị lay chuyển bởi bất kỳ vị sa-môn, bà-la-môn, chư thiên, ma vương hay Phạm thiên nào.

Tathā hi te attano jīvitapariccāgepi tattha pasādaṃ na pariccajanti, tassa vā āṇaṃ daḷhabhattibhāvato.

For they do not abandon their faith in him, even at the cost of their own lives, because of their firm devotion to him or his command.

Thật vậy, họ không từ bỏ niềm tin vào Ngài, ngay cả khi phải hy sinh mạng sống, hoặc vì sự trung thành kiên cố với mệnh lệnh của Ngài.

Tenevāha –

That is why it is said:

Chính vì thế mà Ngài đã nói:

137

‘‘Yo ve kataññū katavedi dhīro;

"Indeed, one who is grateful, who knows gratitude, wise;

‘‘Người biết ơn, đền ơn, bậc trí;

138

Kalyāṇamitto daḷhabhatti ca hotī’’ti.(jā. 2.17.78);

A good friend and firmly devoted." (Jā. 2.17.78)

Là bạn lành và có lòng trung thành kiên cố.’’

139

‘‘Seyyathāpi, bhikkhave, mahāsamuddo ṭhitadhammo velaṃ nātivattati, evameva kho, bhikkhave, yaṃ mayā sāvakānaṃ sikkhāpadaṃ paññattaṃ, taṃ mama sāvakā jīvitahetupi nātikkamantī’’ti (a. ni. 8.20; udā. 45; cūḷava. 385) ca.

And: "Just as, monks, the great ocean is constant in nature and does not transgress its shore, even so, monks, the training rule laid down by me for my disciples is not transgressed by my disciples even for the sake of their lives." (A.N. 8.20; Ud. 45; Cūḷava. 385)

‘‘Này các Tỳ-kheo, ví như đại dương có bản chất đứng yên, không vượt quá bờ của nó, cũng vậy, này các Tỳ-kheo, giới luật mà Ta đã chế định cho các đệ tử, các đệ tử của Ta không vượt qua, ngay cả vì mạng sống.’’

140

Evaṃ bhattavāti bhagavā niruttinayena ekassa ta-kārassa lopaṃ katvā itarassa ga-kāraṃ katvā.

Thus, 'bhattavā' (one who has many devotees) is Bhagavā, by the rule of etymology, dropping one 'ta' and changing the other to 'ga'.

Như vậy, bhattavā là Bhagavā (Thế Tôn) theo quy tắc ngữ nguyên, bằng cách bỏ đi một chữ ‘‘ta’’ và đổi chữ ‘‘ta’’ còn lại thành ‘‘ga’’.

141

Guṇātisayayuttassa, yasmā lokahitesino;

Because of his exceptional qualities, and because he is a benefactor of the world;

Bởi vì Ngài có những đức tính siêu việt, là người làm lợi ích cho thế gian;

142

Sambhattā bahavo satthu, bhagavā tena vuccatīti.

Many revere the Teacher, therefore he is called Bhagavā.

Nhiều người đã phụng sự bậc Đạo Sư, do đó Ngài được gọi là Bhagavā (Thế Tôn).

143

Kathaṃ bhage vamīti bhagavā?

How is it that he vomited 'bhaga' (fortune), hence Bhagavā?

Thế nào là Bhagavā (Thế Tôn) là người đã từ bỏ (vami) những điều tốt lành (bhage)?

Yasmā tathāgato bodhisattabhūtopi purimāsu jātīsu pāramiyo pūrento bhagasaṅkhātaṃ siriṃ issariyaṃ yasañca vami, uggiri, kheḷapiṇḍaṃ viya anapekkho chaḍḍayi; pacchimattabhāvepi hatthāgataṃ cakkavattisiriṃ devalokādhipaccasadisaṃ catudīpissariyaṃ cakkavattisampattisannissayaṃ sattaratanasamujjalaṃ yasañca tiṇāyapi amaññamāno nirapekkho pahāya abhinikkhamitvā sammāsambodhiṃ abhisambuddho, tasmā ime siriādike bhage vamīti bhagavā.

Because the Tathāgata, even when he was a Bodhisatta in previous existences, while fulfilling the Pāramīs, vomited, ejected, and cast away 'bhaga'—which is glory, power, and fame—without attachment, like a lump of spittle; and in his last existence, regarding the accessible glory of a universal monarch (Cakkavatti), the sovereignty over the four continents resembling dominion over a divine realm, and the fame resplendent with the seven jewels—all associated with the Cakkavatti's fortune—as not even worth a blade of grass, he abandoned them without attachment and went forth, and attained Perfect Self-Awakening. Therefore, he is called Bhagavā because he vomited these glories and so forth (these 'bhaga').

Bởi vì Như Lai, khi còn là Bồ Tát, trong những kiếp trước, trong khi viên mãn các Ba-la-mật, đã từ bỏ (vami), đã nhả ra (uggiri), đã vứt bỏ (chaḍḍayi) không chút tiếc nuối như cục đờm dãi, những điều tốt lành (bhaga) được gọi là vinh quang (siri), quyền lực (issariya) và danh tiếng (yasa); và ngay cả trong kiếp cuối cùng này, Ngài đã từ bỏ không chút tiếc nuối, xem thường như cỏ rác, sự vinh quang của Chuyển Luân Vương trong tầm tay, quyền lực của bốn châu lục tương tự như quyền thống trị cõi trời, và danh tiếng rực rỡ với bảy báu, rồi xuất gia và chứng đắc Chánh Đẳng Giác. Do đó, vì Ngài đã từ bỏ những điều tốt lành như vinh quang nói trên, nên Ngài là Bhagavā (Thế Tôn).

Atha vā bhāni nāma nakkhattāni, tehi samaṃ gacchanti pavattantīti bhagā, sineruyugandharauttarakuruhimavantādibhājanalokavisesasannissayā sobhā kappaṭṭhiyabhāvato, tepi bhage vami tannivāsisattāvāsasamatikkamanato, tappaṭibaddhachandarāgapahānena pajahīti.

Alternatively, bhā means constellations; 'bhaga' are those that move in conjunction with them. Or, they are the beauties associated with specific cosmic realms such as Sineru, Yugandhara, Uttarakuru, and Himavanta, which are permanent for an eon. He also vomited these 'bhaga' by transcending the abodes of beings residing therein, abandoning and forsaking the desire and attachment connected to them.

Hoặc, các vì sao (nakkhattāni) được gọi là bhā (bha), chúng vận hành cùng với các vì sao đó, nên được gọi là bhaga. Sự huy hoàng (sobhā) liên quan đến các loại thế giới khác nhau như núi Tu Di, Yugandhara, Uttarakuru, Hy Mã Lạp Sơn, v.v., do tính trường tồn của kiếp (kappaṭṭhiyabhāvato). Ngài cũng đã từ bỏ những điều tốt lành (bhage) đó bằng cách vượt qua sự cư trú của chúng sinh sống ở đó, bằng cách từ bỏ tham ái và dục vọng gắn liền với chúng.

Evampi bhage vamīti bhagavā.

Thus also, he vomited 'bhaga', hence Bhagavā.

Theo cách này, vì Ngài đã từ bỏ những điều tốt lành (bhage), nên Ngài là Bhagavā (Thế Tôn).

144

Cakkavattisiriṃ yasmā, yasaṃ issariyaṃ sukhaṃ;

Because he forsook the glory of a Cakkavatti, fame, power, and happiness,

Bởi vì Ngài đã từ bỏ sự vinh quang của Chuyển Luân Vương,

145

Pahāsi lokacittañca, sugato bhagavā tatoti.

And the worldly mind, therefore the Sugata is Bhagavā.

Danh tiếng, quyền lực, hạnh phúc và tâm thế gian, nên bậc Thiện Thệ là Bhagavā (Thế Tôn).

146

Kathaṃ bhāge vamīti bhagavā?

How is it that he vomited 'bhāga' (portions), hence Bhagavā?

Thế nào là Bhagavā (Thế Tôn) là người đã từ bỏ (vamīti) các phần (bhāge)?

Bhāgā nāma sabhāgadhammakoṭṭhāsā, te khandhāyatanadhātādivasena, tatthāpi rūpavedanādivasena, pathaviyādiatītādivasena ca anekavidhā.

The word 'bhāga' means constituent portions of phenomena. These are manifold, such as in terms of aggregates (khandhā), sense bases (āyatanā), and elements (dhātū); and even within those, such as form and feeling; and earth and past, and so on.

Các phần (bhāgā) là các phần của pháp tương đồng (sabhāgadhammakoṭṭhāsā), chúng có nhiều loại khác nhau theo các uẩn, xứ, giới, v.v., và trong đó cũng theo sắc, thọ, v.v., và theo đất, nước, quá khứ, v.v.

Te bhagavā sabbaṃ papañcaṃ sabbaṃ yogaṃ sabbaṃ ganthaṃ sabbaṃ saṃyojanaṃ samucchinditvā amataṃ dhātuṃ samadhigacchanto vami uggiri, anapekkho chaḍḍayi na paccāgami.

Bhagavā, having eradicated all proliferation, all bondage, all ties, all fetters, and attaining the Deathless Element, vomited, ejected, and cast away these 'bhāga' without attachment, and did not return to them.

Thế Tôn, sau khi đoạn trừ tất cả hý luận (papañca), tất cả trói buộc (yoga), tất cả triền phược (gantha), tất cả kiết sử (saṃyojana), và đạt được yếu tố bất tử (amataṃ dhātuṃ), đã từ bỏ (vami), đã nhả ra (uggiri) các phần đó, đã vứt bỏ (chaḍḍayi) không chút tiếc nuối, không quay trở lại.

Tathā hesa ‘‘sabbatthameva pathaviṃ āpaṃ tejaṃ vāyaṃ, cakkhuṃ sotaṃ ghānaṃ jivhaṃ kāyaṃ manaṃ, rūpe sadde gandhe rase phoṭṭhabbe dhamme, cakkhuviññāṇaṃ…pe… manoviññāṇaṃ, cakkhusamphassaṃ…pe… manosamphassaṃ, cakkhusamphassajaṃ vedanaṃ…pe… manosamphassajaṃ vedanaṃ, cakkhusamphassajaṃ saññaṃ…pe… manosamphassajaṃ saññaṃ, cakkhusamphassajaṃ cetanaṃ…pe… manosamphassajaṃ cetanaṃ, rūpataṇhaṃ…pe… dhammataṇhaṃ, rūpavitakkaṃ…pe… dhammavitakkaṃ, rūpavicāraṃ…pe… dhammavicāra’’ntiādinā anupadadhammavibhāgavasenapi sabbeva dhammakoṭṭhāse anavasesato vami uggiri, anapekkhapariccāgena chaḍḍayi.

Indeed, he, in this way, also completely vomited and ejected all constituent portions of phenomena without remainder, by abandoning them without attachment, as stated: "Earth, water, fire, wind; eye, ear, nose, tongue, body, mind; forms, sounds, odours, tastes, tangibles, mental objects; eye-consciousness… mind-consciousness; eye-contact… mind-contact; feeling born of eye-contact… feeling born of mind-contact; perception born of eye-contact… perception born of mind-contact; volition born of eye-contact… volition born of mind-contact; craving for forms… craving for mental objects; thinking about forms… thinking about mental objects"—and so forth, through the method of distinguishing phenomena step by step.

Thật vậy, Ngài đã từ bỏ (vami), đã nhả ra (uggiri) tất cả các phần của pháp đó một cách không còn sót lại, bằng cách từ bỏ không chút tiếc nuối, như đã nói: “Này Ānanda, tất cả đất, nước, lửa, gió; mắt, tai, mũi, lưỡi, thân, ý; sắc, thanh, hương, vị, xúc, pháp; nhãn thức… cho đến… ý thức; nhãn xúc… cho đến… ý xúc; thọ do nhãn xúc sinh… cho đến… thọ do ý xúc sinh; tưởng do nhãn xúc sinh… cho đến… tưởng do ý xúc sinh; tư do nhãn xúc sinh… cho đến… tư do ý xúc sinh; tham sắc… cho đến… tham pháp; tầm sắc… cho đến… tầm pháp; tứ sắc… cho đến… tứ pháp,” v.v., theo cách phân tích pháp từng phần.

Vuttaṃ hetaṃ ‘‘yaṃ taṃ, ānanda, cattaṃ vantaṃ muttaṃ pahīnaṃ paṭinissaṭṭhaṃ, taṃ tathāgato puna paccāgamissatīti netaṃ ṭhānaṃ vijjatī’’ti (dī. ni. 2.183).

For it is said: "That which, Ānanda, has been spat out, vomited, released, abandoned, renounced—for the Tathāgata to return to that, such a possibility does not exist."

Điều này đã được nói: “Này Ānanda, Như Lai sẽ không bao giờ quay trở lại những gì đã được từ bỏ (cattaṃ), đã được nhả ra (vantaṃ), đã được buông bỏ (muttaṃ), đã được xả ly (pahīnaṃ), đã được loại bỏ (paṭinissaṭṭhaṃ).”

Evampi bhāge vamīti bhagavā.

Thus also, he vomited 'bhāga', hence Bhagavā.

Theo cách này, vì Ngài đã từ bỏ các phần (bhāge), nên Ngài là Bhagavā (Thế Tôn).

Atha vā bhāge vamīti sabbepi kusalākusale sāvajjānavajje hīnapaṇīte kaṇhasukkasappaṭibhāge dhamme ariyamaggañāṇamukhena vami uggiri anapekkho pariccaji pajahi, paresañca tathattāya dhammaṃ desesi.

Alternatively, he vomited 'bhāga' means that through the wisdom-eye of the Noble Path, he vomited, ejected, and without attachment renounced and abandoned all wholesome and unwholesome, blameworthy and blameless, inferior and excellent, dark and bright contrasting phenomena, and taught the Dhamma for others to achieve the same state.

Hoặc, vì Ngài đã từ bỏ các phần (bhāge), tức là Ngài đã từ bỏ (vami), đã nhả ra (uggiri) tất cả các pháp thiện và bất thiện, có tội và không tội, thấp kém và cao thượng, các phần đen và trắng, thông qua trí tuệ của Đạo Thánh, đã từ bỏ không chút tiếc nuối, và đã thuyết pháp để người khác cũng đạt được trạng thái đó.

Vuttampi cetaṃ ‘‘dhammāpi vo, bhikkhave, pahātabbā, pageva adhammā (ma. ni. 1.240), kullūpamaṃ vo, bhikkhave, dhammaṃ desessāmi nittharaṇatthāya, no gahaṇatthāyā’’tiādi (ma. ni. 1.240).

And it is also said: "Even the Dhamma, Bhikkhus, is to be abandoned, let alone what is not Dhamma. I shall teach you the Dhamma, Bhikkhus, as a raft for crossing over, not for grasping," and so forth.

Điều này cũng đã được nói: “Này các Tỳ-kheo, các pháp cũng phải được từ bỏ, huống hồ là phi pháp (Ma. Ni. 1.240), này các Tỳ-kheo, Ta sẽ thuyết pháp cho các ông như chiếc bè, để vượt qua, không phải để nắm giữ,” v.v. (Ma. Ni. 1.240).

Evampi bhāge vamīti bhagavā.

Thus also, he vomited 'bhāga', hence Bhagavā.

Theo cách này, vì Ngài đã từ bỏ các phần (bhāge), nên Ngài là Bhagavā (Thế Tôn).

147

Khandhāyatanadhātādi-dhammabhāgāmahesinā;

Because the great seer vomited the Dhamma-portions of aggregates, sense bases, elements, and so forth,

Vì Đấng Đại Hiền đã từ bỏ các phần pháp như uẩn, xứ, giới, v.v.,

148

Kaṇhasukkā yato vantā, tatopi bhagavā matoti.

And the dark and bright phenomena, therefore also he is called Bhagavā.

Và các pháp đen trắng, nên Ngài cũng được gọi là Bhagavā (Thế Tôn).

149

Tena vuttaṃ –

Therefore it is said:

Do đó đã nói –

150

‘‘Bhāgavā bhatavā bhāge, bhage ca vani bhattavā;

“He is endowed with fortune, nourished, he nourishes portions,

“Là người có phúc, là người đã phụng sự, đã từ bỏ những điều tốt lành;

151

Bhage vami tathā bhāge, vamīti bhagavā jino’’ti.

And having been nourished, he vomited fortunes. He vomited fortunes, and likewise portions; thus the Conqueror is Bhagavā.”

Là người đã từ bỏ những điều tốt lành, là người đã từ bỏ các phần; Đấng Chiến Thắng Bhagavā là người đã từ bỏ (vamīti).”

152

Dhammasarīraṃ paccakkhaṃ karotīti ‘‘yo vo, ānanda, mayā dhammo ca vinayo ca desito paññatto, so vo mamaccayena satthā’’ti (dī. ni. 2.216) vacanato dhammassa satthubhāvapariyāyo vijjatīti katvā vuttaṃ.

He makes the Dhamma-body manifest—this is said because, as per the saying, "The Dhamma and Vinaya taught and promulgated by me, Ānanda, shall be your Teacher after my passing," the quality of the Dhamma as a Teacher exists.

Làm cho pháp thân hiển lộ là câu nói được đưa ra dựa trên sự tồn tại của một cách nói về Pháp là bậc Đạo Sư, như đã nói: “Này Ānanda, Pháp và Luật mà Ta đã giảng dạy và chế định cho các ông, sau khi Ta diệt độ, sẽ là bậc Đạo Sư của các ông.”

Vajirasaṅghātasamānakāyo parehi abhejjasarīrattā.

His body is like a diamond-mass because his body is indestructible by others.

Thân thể cứng chắc như kim cương là do thân thể không thể bị phá hủy bởi người khác.

Na hi bhagavato rūpakāye kenaci sakkā antarāyo kātunti.

For no one can cause harm to the physical body of Bhagavā.

Thật vậy, không ai có thể gây hại cho sắc thân của Thế Tôn.

153

Desanāsampattiṃ niddisati vakkhamānassa sakalassa suttassa ‘‘eva’’nti nidassanato.

It indicates the perfection of the teaching because the entire Sutta to be spoken is introduced with "evaṃ".

Chỉ ra sự thành tựu của giáo pháp là do toàn bộ bài kinh sắp được nói được bắt đầu bằng từ “evaṃ” (như vầy).

Sāvakasampattiṃ niddisati paṭisambhidāppattena pañcasu ṭhānesu bhagavatā etadagge ṭhapitena mayā mahāsāvakena sutaṃ, tañca kho mayāva sutaṃ, na anussutikaṃ, na paramparābhatanti imassa atthassa dīpanato.

It indicates the perfection of the audience because it expresses the meaning that "I, the great disciple, endowed with the four analytical knowledges (Paṭisambhidā) and designated by Bhagavā as foremost in five respects, have heard it; and indeed, I myself have heard it, not by hearsay, nor by tradition."

Chỉ ra sự thành tựu của thính chúng là do sự làm rõ ý nghĩa của câu này: “Tôi, một vị đại đệ tử, người đã đạt được Tứ Vô Ngại Giải, người được Thế Tôn đặt vào vị trí tối thượng trong năm trường hợp, đã nghe điều đó, và chính tôi đã nghe, không phải nghe lại, không phải nghe truyền miệng.”

Kālasampattiṃ niddisati bhagavā-saddasannidhāne payuttassa samaya-saddassa kālassa buddhuppādapaṭimaṇḍitabhāvadīpanato.

It indicates the perfection of time because the word "samaya" (time), used in conjunction with the word "Bhagavā", signifies the time adorned by the Buddha's arising.

Chỉ ra sự thành tựu của thời gian là do sự làm rõ trạng thái thời gian được tô điểm bởi sự xuất hiện của chư Phật, từ “samaya” (thời gian) được sử dụng gần từ Bhagavā (Thế Tôn).

Buddhuppādaparamā hi kālasampadā.

Indeed, the highest perfection of time is the arising of a Buddha.

Thật vậy, sự xuất hiện của chư Phật là sự thành tựu tối thượng của thời gian.

Tenetaṃ vuccati –

Therefore, it is said:

Do đó, điều này đã được nói –

154

‘‘Kappakasāye kaliyuge, buddhuppādo aho mahacchariyaṃ;

“In a corrupted eon, in an age of strife, oh, the arising of a Buddha is a great wonder!

“Trong kiếp suy tàn, trong thời kỳ đen tối, sự xuất hiện của chư Phật thật kỳ diệu biết bao;

155

Hutāvahamajjhe jātaṃ, samuditamakarandamaravinda’’nti.(dī. ni. ṭī. 1.1; saṃ. ni. ṭī. 1.1.1; a. ni. ṭī. 1.1.1 rūpādivaggavaṇṇanā);

Like a lotus born in the midst of fire, its nectar blooming forth.”

Như hoa sen nở rộ giữa lửa dữ, hương mật tràn đầy.”

156

Bhagavāti desakasampattiṃ niddisati guṇavisiṭṭhasattuttamagarugāravādhivacanabhāvato.

Bhagavā indicates the perfection of the teacher because it is an address of reverence for the supreme being endowed with distinguished qualities.

Bhagavā (Thế Tôn) chỉ ra sự thành tựu của bậc thuyết pháp vì đó là danh xưng tôn kính đối với bậc tối thượng trong số các chúng sinh có phẩm chất siêu việt.

157

Maṅgaladivaso sukhaṇo sunakkhattanti ajja maṅgaladivaso, tasmā sunakkhattaṃ, tatthāpi ayaṃ sukhaṇo.

Auspicious day, good moment, good constellation means "today is an auspicious day, therefore a good constellation, and specifically, this is a good moment."

Ngày cát tường, giờ tốt, sao tốt có nghĩa là hôm nay là ngày cát tường, do đó là sao tốt, và trong đó, đây là giờ tốt.

Mā atikkamīti mā rattivibhāyanaṃ anudikkhantānaṃ ratti atikkamīti evaṃ sambandho veditabbo.

"May it not pass"—the connection should be understood as: "May the night not pass for those awaiting the dawn."

Mā atikkamī (đừng để vượt qua) có nghĩa là đừng để đêm trôi qua đối với những người đang chờ đợi bình minh, sự liên kết này cần được hiểu.

Ukkāsu ṭhitāsu ṭhitāti ukkaṭṭhā (dī. ni. ṭī. 1.255; a. ni. ṭī. 2.4.36).

Standing firm amidst the torches (ukkāsu ṭhitāsu ṭhitā), hence Ukkāṭṭhā.

Ukkāsu ṭhitāsu ṭhitā (đứng trên những ngọn đuốc đang cháy) là ukkaṭṭhā (tối thượng).

Ukkāsu vijjotalantīsu ṭhitā patiṭṭhitāti mūlavibhūjādipakkhepena (pāṇini 3.2.5) saddasiddhi veditabbā.

The grammatical derivation should be understood through the dropping of the root verb (as in Pāṇini 3.2.5), meaning "established, standing firm amidst illuminating torches."

Sự thành lập của từ này cần được hiểu bằng cách rút gọn (pakkhepena) gốc từ (mūlavibhūjādipakkhepena) cho từ “đứng vững trên những ngọn đuốc đang cháy rực rỡ.”

Niruttinayena vā ukkāsu ṭhitāsu ṭhitā āsīti ukkaṭṭhā.

Or, according to the method of etymology, Ukkāṭṭhā means "it was established, standing firm amidst torches."

Hoặc, theo phương pháp ngữ nguyên, ukkaṭṭhā là “đã đứng trên những ngọn đuốc đang cháy.”

Apare pana bhaṇanti ‘‘bhūmibhāgasampattiyā manussasampattiyā upakaraṇasampattiyā ca sā nagarī ukkaṭṭhaguṇayogato ‘ukkaṭṭhā’ti nāmaṃ labhī’’ti.

Others, however, say: "That city acquired the name 'Ukkāṭṭhā' due to its superlative qualities in terms of its land, human populace, and resources."

Những người khác lại nói: “Thành phố đó đã có tên là ‘Ukkāṭṭhā’ do sự kết hợp của những phẩm chất tối thượng về sự thành tựu của vùng đất, sự thành tựu của con người và sự thành tựu của các phương tiện.”

158

Avisesenāti na visesena, vihārabhāvasāmaññenāti attho.

"Without distinction" means not specifically, but generally as a dwelling.

Avisesenā (không đặc biệt) có nghĩa là không đặc biệt, mà là theo nghĩa chung của một trú xứ.

Iriyāpatha…pe… vihāresūti iriyāpathavihāro dibbavihāro brahmavihāro ariyavihāroti etesu catūsu vihāresu.

"In the postures… abodes" refers to these four abodes: the abode of postures (iriyāpatha-vihāro), the divine abode (dibba-vihāro), the Brahma abode (brahma-vihāro), and the noble abode (ariya-vihāro).

Iriyāpatha…pe… vihāresu (trong các trú xứ về oai nghi… v.v.) là trong bốn loại trú xứ này: trú xứ oai nghi, trú xứ chư thiên, trú xứ Phạm thiên, trú xứ Thánh.

Samaṅgiparidīpananti samaṅgībhāvaparidīpanaṃ.

"Showing completeness" means showing the state of being complete.

Samaṅgiparidīpanaṃ (sự làm rõ về sự đầy đủ) là sự làm rõ về trạng thái đầy đủ.

Etanti ‘‘viharatī’’ti etaṃ padaṃ.

"This" refers to the word "viharatī" (dwells).

Etaṃ (này) là từ “viharatī” (trú ngụ).

Tathā hi taṃ ‘‘idhekacco gihīhi saṃsaṭṭho viharati sahanandī sahasokī’’tiādīsu (saṃ. ni. 4.241) iriyāpathavihāre āgataṃ; ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehi…pe… paṭhamaṃ jhānaṃ upasampajja viharatī’’tiādīsu (dha. sa. 160; vibha. 624) dibbavihāre; ‘‘so mettāsahagatena cetasā ekaṃ disaṃ pharitvā viharatī’’tiādīsu (dī. ni. 1.556; 3.308; ma. ni. 1.77; 2.309; 3.230) brahmavihāre; ‘‘so kho ahaṃ aggivessana tassāyeva kathāya pariyosāne tasmiṃ eva purimasmiṃ samādhinimitte ajjhattameva cittaṃ saṇṭhapemi sannisādemi ekodiṃ karomi samādahāmi, yena sudaṃ niccakappaṃ viharāmī’’tiādīsu (ma. ni. 1.387) ariyavihāre.

Indeed, it appears in (descriptions of) iriyāpathavihāra (abiding in postures), such as in ‘Here, some individual dwells associated with householders, rejoicing with them, sorrowing with them’ and so on; in dibbavihāra (divine abiding), such as in ‘Bhikkhus, when a bhikkhu, quite secluded from sensual pleasures… attains and dwells in the first jhāna’ and so on; in brahmavihāra (sublime abiding), such as in ‘He dwells pervading one direction with a mind imbued with loving-kindness’ and so on; and in ariyavihāra (noble abiding), such as in ‘Aggivessana, at the conclusion of that very talk, I established, settled, made one-pointed, and concentrated my mind internally on that same former meditation-object, by which I constantly dwelled’ and so on.

Thật vậy, nó được đề cập trong các trường hợp về oai nghi trú (iriyāpathavihāra) như: “Ở đây, một số người sống chung đụng với các gia chủ, cùng vui cùng buồn” (Saṃ. Ni. 4.241); trong các trường hợp về thiên trú (dibbavihāra) như: “Này các tỳ khưu, khi nào tỳ khưu ly dục… (v.v.)… chứng đạt và an trú sơ thiền” (Dha. Sa. 160; Vibha. 624); trong các trường hợp về phạm trú (brahmavihāra) như: “Vị ấy an trú, trải tâm từ đến một phương” (Dī. Ni. 1.556; 3.308; Ma. Ni. 1.77; 2.309; 3.230); trong các trường hợp về thánh trú (ariyavihāra) như: “Này Aggivessana, sau khi kết thúc câu chuyện ấy, tôi đã an định tâm, làm cho tâm lắng xuống, tập trung lại, làm cho tâm định tĩnh ngay trong định tướng ban đầu ấy, nhờ đó tôi thường an trú” (Ma. Ni. 1.387).

159

Tattha iriyanaṃ vattanaṃ iriyā, kāyappayogo.

Among these, iriyā is the movement, the deportment, the bodily application.

Trong đó, sự cử động, sự vận hành là iriyā, tức sự vận dụng thân.

Tassā pavattanupāyabhāvato ṭhānādi iriyāpatho.

From its being a means of effecting movement, standing and so forth constitute iriyāpatha.

Vì đứng (ṭhāna) v.v. là phương tiện cho sự vận hành ấy, nên gọi là iriyāpatha (oai nghi).

Ṭhānasamaṅgī vā hi kāyena kiñci kareyya gamanādīsu aññatarasamaṅgī vā.

For one might do something with the body while standing or while engaged in one of the other postures such as walking.

Vì thân có thể làm bất cứ điều gì khi đang đứng, hoặc khi đang đi v.v.

Atha vā iriyati pavattati etena attabhāvo, kāyakiccaṃ vāti iriyā, tassā pavattiyā upāyabhāvato pathoti iriyāpatho, ṭhānādi eva.

Alternatively, iriyā means ‘the self moves or proceeds by it’, or ‘it is bodily action’; and from its being a means for that movement, it is a path, thus iriyāpatha (posture), which is standing and so forth.

Hoặc giả, tự thân vận hành, vận chuyển nhờ cái này, hay là hành động của thân, nên gọi là iriyā; vì là phương tiện cho sự vận hành ấy nên gọi là patha (con đường), tức iriyāpatha, chỉ là đứng v.v.

So ca atthato gatinivattiādiākārena pavatto catusantatirūpapabandho eva.

And that, in essence, is merely the continuous stream of the four kinds of rūpa (matter) that proceeds in the form of movement, cessation, and so forth.

Và điều đó, về mặt ý nghĩa, chỉ là sự liên tục của bốn loại sắc pháp diễn ra dưới dạng vận hành và dừng lại v.v.

Viharaṇaṃ, viharati etenāti vā vihāro, iriyāpatho eva vihāro iriyāpathavihāro.

Viharaṇaṃ (dwelling), or that by which one dwells, is vihāra; the iriyāpatha itself is vihāra, thus iriyāpathavihāra (dwelling in postures).

Sự an trú, hoặc an trú nhờ cái này, nên gọi là vihāra. Iriyāpathavihāra (oai nghi trú) tức là oai nghi chính là sự an trú.

Divi bhavoti dibbo.

That which exists in the heavens is dibba (divine).

Sự hiện hữu trong cõi trời là dibba (thiên).

Tattha bahulappavattiyā brahmapārisajjādidevaloke bhavoti attho.

Here, the meaning is that it exists in the realms of the devas, such as the retinues of Brahmā, due to frequent occurrence there.

Ở đây, có nghĩa là sự hiện hữu trong cõi trời của chư thiên như Phạm chúng v.v. do sự thường xuyên diễn ra ở đó.

Tattha yo dibbānubhāvo, tadatthāya saṃvattatīti vā dibbo, abhiññābhinīhāravasena mahāgatikattā vā dibbo, dibbo ca so vihāro cāti dibbavihāro, catasso rūpāvacarasamāpattiyo.

Or that which conduces to divine power (dibbānubhāva) is dibba; or it is dibba due to its great efficacy by way of psychic powers and resolve. And it is a dibba dwelling, thus dibbavihāra (divine abiding), which refers to the four rūpāvacara samāpattis (absorptions of the fine-material sphere).

Hoặc là, cái gì có thần thông, cái đó hướng đến mục đích ấy nên gọi là dibba (thiên), hoặc vì có sự vận chuyển lớn theo cách phát triển thần thông nên gọi là dibba. Dibbavihāra (thiên trú) tức là cái đó là thiên và là trú, đó là bốn thiền chứng sắc giới.

Āruppasamāpattiyopi ettheva saṅgahaṃ gacchanti.

The āruppasamāpattis (absorptions of the immaterial sphere) are also included herein.

Các thiền chứng vô sắc giới cũng được bao gồm trong đây.

Brahmūnaṃ, brahmāno vā vihārā brahmavihārā, catasso appamaññāyo.

The dwellings of the Brahmās, or that which the Brahmās dwell in, are brahmavihārā (sublime abodes), which are the four appamaññā (immeasurables).

Sự an trú của các Phạm thiên, hoặc sự an trú của Phạm thiên là brahmavihārā (phạm trú), đó là bốn vô lượng tâm.

Ariyānaṃ, ariyā vā vihārā ariyavihārā, cattāri sāmaññaphalāni.

The dwellings of the Noble Ones (ariyā), or that which the Noble Ones dwell in, are ariyavihārā (noble abodes), which are the four sāmaññaphalā (fruits of recluseship).

Sự an trú của các bậc Thánh, hoặc sự an trú của các bậc Thánh là ariyavihārā (thánh trú), đó là bốn quả Sa-môn.

So hi bhagavā ekaṃ iriyāpathabādhanantiādi yadipi bhagavā ekenapi iriyāpathena cirataraṃ kālaṃ attabhāvaṃ pavattetuṃ sakkoti, tathāpi ‘‘upādinnakasarīrassa nāma ayaṃ sabhāvo’’ti dassetuṃ vuttaṃ.

Even though the Blessed One could maintain his body for a very long time in a single iriyāpatha, ‘‘So hi Bhagavā ekaṃ iriyāpathabādhanaṃ’’ (‘‘Indeed, the Blessed One, one posture…’’) was said to show that ‘‘this is the nature of an assumed body’’.

Đức Thế Tôn bị một oai nghi làm trở ngại (so hi bhagavā ekaṃ iriyāpathabādhana) v.v. Mặc dù Đức Thế Tôn có thể duy trì thân mình trong một oai nghi lâu hơn, nhưng điều này được nói ra để chỉ rõ: “Đây là bản chất của một thân thể bị chấp thủ.”

Yasmā vā bhagavā yattha katthaci vasanto veneyyānaṃ dhammaṃ desento, nānāsamāpattīhi ca kālaṃ vītināmento vasatīti veneyyasattānaṃ attano ca vividhaṃ hitasukhaṃ harati upaneti uppādeti, tasmā vividhaṃ haratīti evamettha attho veditabbo.

Or, since the Blessed One, dwelling anywhere, teaches the Dhamma to those to be tamed, and passes time in various samāpattis (attainments), thereby bringing, presenting, and generating various kinds of welfare and happiness for the beings to be tamed and for himself, the meaning here should be understood as ‘He brings forth various things’.

Hoặc vì Đức Thế Tôn, khi an trú ở bất cứ nơi nào, thuyết pháp cho những người có thể được hóa độ, và trải qua thời gian bằng nhiều định chứng khác nhau, nên Ngài mang lại, cống hiến, tạo ra nhiều lợi ích và hạnh phúc cho chúng sinh có thể được hóa độ và cho chính Ngài. Do đó, ở đây cần hiểu ý nghĩa là “mang lại nhiều điều.”

160

Subhagattāti sirīkāmānavasena sobhanattā.

Subhagattā means ‘because of being excellent, in the sense of desiring prosperity’.

Subhagattā có nghĩa là do sự tốt đẹp về mặt mong muốn sự thịnh vượng.

Tenevāha ‘‘sundarasirikattā sundarakāmattā cā’’ti.

For this reason, it is said: ‘‘sundarasirikattā sundarakāmattā cā’’ (‘‘because of having beautiful glory and desiring beauty’’).

Vì thế, có nói: “do có vẻ đẹp và do có sự mong muốn tốt đẹp.”

Chaṇasamajjaussaveti ettha chaṇaṃ nāma phaggunamāsādīsu uttaraphaggunādi-abhilakkhitadivasesu saparijanānaṃ manussānaṃ maṅgalakaraṇaṃ.

In chaṇasamajjaussave (at festivals, gatherings, and celebrations), chaṇaṃ refers to the auspicious activities of people with their retinues on specific days, such as the Uttaraphagguni star days in the month of Phagguna.

Trong chaṇasamajjaussave, chaṇa là sự tổ chức lễ hội cho mọi người cùng với gia đình vào những ngày đặc biệt như ngày trăng tròn cuối tháng Phagguna v.v.

Samajjaṃ nāma naṭasamajjādi.

Samajjaṃ refers to gatherings of actors and so forth.

Samajja là các buổi biểu diễn của diễn viên v.v.

Ussavo nakkhattaṃ.

Ussavo (celebration) is a nakkhatta (constellation festival).

Ussava là lễ hội.

Yattha gāmanigamavāsino tayo satta vā divase nakkhattaghosanaṃ katvā yathāvibhavaṃ alaṅkatapaṭiyattā bhoge paribhuñjantā nakkhattakīḷanaṃ kīḷanti.

During which, residents of villages and market towns celebrate for three or seven days, making a proclamation of the nakkhatta, and enjoying their possessions, adorned and prepared according to their means, they play nakkhatta games.

Nơi mà cư dân làng xã tổ chức lễ hội trong ba hoặc bảy ngày, trang hoàng và chuẩn bị tùy theo khả năng, hưởng thụ của cải và vui chơi lễ hội.

Tesaṃ taṃ tatheva hotīti tesaṃ manussānaṃ taṃ patthanaṃ tannivāsidevatānubhāvena yebhuyyena tatheva hoti, patthanā samijjhatīti attho.

Tesaṃ taṃ tatheva hotīti means, for those people, that wish mostly comes true through the power of the deities residing there; that is, the wish is fulfilled.

Tesaṃ taṃ tatheva hoti có nghĩa là sự mong ước đó của những người này thường trở thành hiện thực nhờ oai lực của các vị thiên trú ngụ ở đó, tức là sự mong ước được thành tựu.

Bahujanakantatāyāti iminā ‘‘sundarakāmattā’’ti etasseva padassa pakārantarena atthaṃ vibhāveti.

By bahujanakantatāyā (because of being beloved by many people), the meaning of the word ‘‘sundarakāmattā’’ (desiring beauty) is explained in another way.

Với bahujanakantatāyā, giải thích ý nghĩa của từ “sundarakāmattā” theo một cách khác.

Tatrāyaṃ vacanattho – kamanīyaṭṭhena suṭṭhu bhajīyatīti subhagaṃ, subhā agā rukkhā etthāti vā subhagaṃ, sundarakittiyogato vā ‘‘subhaga’’nti evampettha atthaṃ vaṇṇenti.

Here is the etymology: that which is well-served due to desirability is subhagaṃ; or that in which there are beautiful trees is subhagaṃ; or it is described as ‘‘subhagaṃ’’ due to its connection with beautiful fame.

Ở đây, ý nghĩa của từ là: do đáng yêu nên được nhiều người ưa thích, đó là subhagaṃ (may mắn); hoặc vì có cây cối tốt đẹp ở đó nên là subhagaṃ; hoặc do có danh tiếng tốt đẹp nên là “subhaga”. Họ giải thích ý nghĩa ở đây như vậy.

Keci pana ‘‘subhāgavane’’ti paṭhanti, ‘‘sundarabhūmibhāge vane’’ti cassa atthaṃ vadanti.

However, some read ‘‘subhāgavane’’ and explain its meaning as ‘‘in a beautiful part of the forest’’.

Một số người khác đọc là “subhāgavane” (trong rừng Subhāga), và nói rằng ý nghĩa của nó là “trong khu rừng có địa hình đẹp.”

Subhagassa nāma yakkhassa vanaṃ tena pariggahitattāti ‘‘subhagavana’’nti aññe.

Others say ‘‘subhagavana’’ means the forest of a Yakkha named Subhaga, because it is owned by him.

Những người khác nói rằng đó là “subhagavana” (rừng Subhaga) vì đó là khu rừng của một dạ xoa tên Subhaga, do dạ xoa đó sở hữu.

Vananaṃ bhattītiatthe taṃ vananaṃ kāretīti etasmiṃ atthe vanayatīti padasiddhi veditabbā.

In the sense of ‘desiring devotion,’ the word vanayati (desires) should be understood as established in the sense of ‘causes that desiring’.

Trong ý nghĩa “mong muốn là sự yêu thích”, cần hiểu rằng sự thành lập của từ vanayati (mong muốn) là trong ý nghĩa “làm cho mong muốn đó xảy ra”.

Tenevāha ‘‘attani sinehaṃ uppādetī’’ti.

For this reason, it is said: ‘‘attani sinehaṃ uppādetī’’ (‘‘generates affection for oneself’’).

Vì thế, có nói: “tạo ra tình cảm trong mình.”

Yācanatthe vanute iti vananti upacārakappanāvasena vana-saddo veditabbo.

In the sense of asking, vanute iti vanaṃ (desires, therefore vana) refers to the word vana understood by way of metaphorical designation.

Trong ý nghĩa cầu xin, từ vana (rừng) cần được hiểu theo cách ẩn dụ là “vanute” (cầu xin).

161

Ujuvaṃsāti ujubhūtaviṭapā.

Ujuvaṃsā means ‘having straight branches’.

Ujuvaṃsā có nghĩa là những cành cây thẳng.

Mahāsālāti mahārukkhā.

Mahāsālā means ‘great trees’.

Mahāsālā có nghĩa là những cây lớn.

Aññatarasmiṃ sālamūleti aññatarassa rukkhassa mūle.

Aññatarasmiṃ sālamūle means ‘at the root of a certain tree’.

Aññatarasmiṃ sālamūle có nghĩa là dưới gốc một cây sāla nào đó.

Vanappatijeṭṭhakarukkhoti vanappatibhūto jeṭṭhakarukkho.

Vanappatijeṭṭhakarukkho means ‘a chief tree that is a lord of the forest’.

Vanappatijeṭṭhakarukkho có nghĩa là cây chủ yếu trong số các loài cây rừng.

Tameva jeṭṭhakabhāvanti vanappatibhāvenāgataṃ seṭṭhabhāvaṃ padhānabhāvaṃ.

Tameva jeṭṭhakabhāvaṃ means ‘that very chief state, the supreme state, the principal state, which comes from being a lord of the forest’.

Tameva jeṭṭhakabhāvaṃ có nghĩa là địa vị tối thượng, địa vị chủ yếu đạt được do là loài cây rừng.

Tena hi so ‘‘sālarājā’’ti vutto.

Indeed, it is called a ‘‘Sāla King’’.

Vì thế, nó được gọi là “Sālarājā” (Vua Sāla).

Upagatānaṃ rañjanaṭṭhena rājā, aññasmimpi tādise rukkhe rājavohāraṃ dassetuṃ ‘‘supatiṭṭhitassā’’tiādi vuttaṃ.

It is a king because it delights those who approach it. To show that the designation ‘king’ applies also to any other such tree, it is said ‘‘supatiṭṭhitassā’’ (‘‘of a well-established one’’) and so forth.

Vua (rājā) vì làm cho những người đến gần được vui thích. Để chỉ ra cách gọi “vua” cũng được dùng cho những cây tương tự khác, nên nói “supatiṭṭhitassā” v.v.

Tattha brāhmaṇa dhammikāti ālapanaṃ.

There, brāhmaṇa dhammikā is an address.

Trong đó, brāhmaṇa dhammikā là lời gọi.

Nippariyāyena sākhādimato saṅghātassa suppatiṭṭhitabhāvasādhane avayavavisese pavattamāno mūla-saddo.

The word mūla (root) is used directly for a specific component of the aggregate (of a tree) possessing branches and so forth, in substantiating its well-established nature.

Từ mūla (gốc) được dùng để chỉ một phần đặc biệt của một tổng thể có cành v.v., không phải theo nghĩa ẩn dụ, trong việc chứng minh sự vững chắc của nó.

Yasmā taṃsadisesu tannissaye padese ca ruḷhīvasena pariyāyato pavattati, tasmā ‘‘mūlāni uddhareyyā’’ti ettha nippariyāyamūlaṃ adhippetanti ekena mūla-saddena visesetvā āha ‘‘mūlamūle dissatī’’ti yathā ‘‘dukkhadukkhaṃ (saṃ. ni. 4.327), rūparūpa’’nti (visuddhi. 2.449) ca.

Because it is used figuratively for similar things and the location depending on them by way of convention, to indicate that in ‘‘mūlāni uddhareyyā’’ (one should extract the roots), the direct root is intended, it is specified with one word mūla and said ‘‘mūlamūle dissatī’’ (‘‘it is seen in the root-root’’), just as in ‘‘dukkhadukkhaṃ’’ (suffering of suffering) and ‘‘rūparūpaṃ’’ (form of form).

Vì nó được dùng theo nghĩa ẩn dụ, theo thói quen, cho những nơi tương tự và những nơi phụ thuộc vào nó, nên khi nói “mūlāni uddhareyyā” (nhổ bỏ các gốc rễ), ý muốn nói đến gốc rễ theo nghĩa không ẩn dụ. Do đó, sau khi đặc biệt hóa bằng một từ mūla, Ngài nói “mūlamūle dissatī” (được thấy ở tận gốc rễ), giống như “dukkhadukkhaṃ” (khổ khổ) (Saṃ. Ni. 4.327) và “rūparūpa” (sắc sắc) (Visuddhi. 2.449).

Asādhāraṇahetumhīti asādhāraṇakāraṇe.

Asādhāraṇahetumhī means ‘in an uncommon cause’.

Asādhāraṇahetumhī có nghĩa là do nguyên nhân không chung.

Lobhasahagatacittuppādānaṃ eva āveṇike nesaṃ suppatiṭṭhitabhāvasādhanato mūlaṭṭhena upakārake paccayadhamme dissatīti attho.

The meaning is that it is seen in the causal phenomena that are unique to the thought-moments accompanied by greed, and are helpful in the sense of being a root in substantiating their well-established nature.

Ý nghĩa là: được thấy trong các pháp duyên hỗ trợ, có vai trò là gốc rễ, vì chúng chứng minh sự vững chắc đặc thù của các tâm sở đồng sanh với tham ái.

162

Tatthāti ‘‘ekaṃ samayaṃ bhagavā ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle’’ti yaṃ vuttaṃ vākyaṃ, tatta.

Tatthā (there) refers to the statement, ‘‘At one time the Blessed One dwelled in Ukkaṭṭhā, in Subhaga Forest, at the root of the Sāla King’’.

Tatthā có nghĩa là trong câu nói: “Một thời Đức Thế Tôn an trú tại Ukkaṭṭhā, trong rừng Subhaga, dưới gốc cây Sālarāja.”

Siyāti kassaci evaṃ parivitakko siyā, vakkhamānākārena kadāci codeyya vāti attho.

Siyā means ‘such a thought might occur to someone’, or ‘one might question in the manner to be stated’.

Siyā có nghĩa là có thể có một số người suy nghĩ như vậy, hoặc có thể có ai đó chất vấn theo cách sẽ được nói đến.

Atha tattha viharatīti yadi subhagavane sālarājamūle viharati.

Atha tattha viharatī (‘‘But he dwells there’’) means ‘if he dwells in Subhaga Forest, at the root of the Sāla King’.

Atha tattha viharatī có nghĩa là nếu Ngài an trú tại Subhagavana, dưới gốc cây Sālarāja.

Na vattabbanti nānāṭhānabhūtattā ukkaṭṭhāsubhagavanānaṃ, ekaṃ samayanti ca vuttattāti adhippāyo.

Na vattabbaṃ (‘‘it should not be said’’) means that Ukkaṭṭhā and Subhaga Forest are different places, and it was also said ‘at one time’.

Na vattabba có nghĩa là không nên nói như vậy, vì Ukkaṭṭhā và Subhagavana là những địa điểm khác nhau, và cũng vì đã nói “một thời” (ekaṃ samayaṃ).

Idāni codako tameva attano adhippāyaṃ ‘‘na hi sakkā’’tiādinā vivarati.

Now, the questioner explains his own intention with ‘‘na hi sakkā’’ (‘‘for it is not possible’’) and so forth.

Bây giờ, người chất vấn giải thích ý định của mình bằng “na hi sakkā” v.v.

Itaro sabbametaṃ aviparītaṃ atthaṃ ajānantena vuttanti dassento ‘‘na kho panetaṃ evaṃ daṭṭhabba’’nti āha.

The other (speaker), indicating that all this was said by one who did not know the correct meaning, says ‘‘na kho panetaṃ evaṃ daṭṭhabba’’ (‘‘But this should not be seen thus’’).

Người kia, cho rằng tất cả điều này được nói ra bởi người không hiểu đúng ý nghĩa, nên nói “na kho panetaṃ evaṃ daṭṭhabba”.

Tattha etanti ‘‘ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle’’ti etaṃ vacanaṃ.

There, etaṃ refers to the statement, ‘‘the Blessed One dwells in Ukkaṭṭhā, in Subhaga Forest, at the root of the Sāla King’’.

Trong đó, etaṃ là câu nói: “An trú tại Ukkaṭṭhā, trong rừng Subhaga, dưới gốc cây Sālarāja.”

Evanti ‘‘yadi tāva bhagavā’’tiādinā yaṃ taṃ bhavatā coditaṃ, taṃ atthato evaṃ na kho pana daṭṭhabbaṃ, na ubhayattha apubbaacarimaṃ vihāradassanatthanti attho.

Evaṃ means that ‘‘what you questioned, beginning with ‘If indeed the Blessed One…’ should not be seen as such in meaning, nor as indicating dwelling in both places without precedence or sequence.’’

Evanti: “Nếu Đức Thế Tôn…” v.v., điều mà ngài đã chất vấn, thì về mặt ý nghĩa, không nên hiểu như vậy. Không phải là để chỉ ra sự an trú đồng thời ở cả hai nơi.

163

Idāni attano yathādhippetaṃ aviparītaṃ atthaṃ, tassa ca paṭikacceva vuttabhāvaṃ, tena ca appaṭividdhattaṃ pakāsento ‘‘nanu avocumha…pe… sālarājamūle’’ti āha.

Now, making clear the unperverted meaning as intended by oneself, and the fact that it was stated beforehand, and that it has not been fully penetrated by others, it is said: 'Did we not declare... etc. ... at the root of the Sāla king tree?'

Bây giờ, để làm sáng tỏ ý nghĩa không sai lệch như mình đã mong muốn, việc đã được nói trước đó, và việc chưa được thấu hiểu bởi điều đó, ngài nói: “Chẳng phải chúng ta đã nói… (vân vân)… dưới gốc cây sala vương”.

Evampi ‘‘subhagavane sālarājamūle viharatī’’cceva vattabbaṃ, na ‘‘ukkaṭṭhāya’’nti codanaṃ manasi katvā vuttaṃ ‘‘gocaragāmanidassanattha’’ntiādi.

Even so, 'He dwells in Subhaga Grove, at the root of the Sāla king tree' should be said. The statement, 'for the purpose of indicating the alms-resort village' and so on, was made with the objection in mind that 'not for Ukkaṭṭhā'.

Ngay cả như vậy, đáng lẽ phải nói “trú tại rừng Subhaga, dưới gốc cây sala vương”, không phải vì đã nghĩ đến lời phê bình “tại Ukkaṭṭhā” mà đã nói “để chỉ ra làng khất thực” và những điều tương tự.

164

Avassaṃ cettha gocaragāmakittanaṃ kātabbaṃ.

Here, the mention of the alms-resort village must necessarily be made.

Và ở đây, việc nêu tên làng khất thực là điều bắt buộc phải làm.

Tathā hi taṃ yathā subhagavanādikittanaṃ pabbajitānuggahakaraṇādianekappayojanaṃ, evaṃ gahaṭṭhānuggahakaraṇādivividhappayojananti dassento ‘‘ukkaṭṭhākittanenā’’tiādimāha.

For just as the mention of Subhaga Grove and so on serves many purposes, such as assisting monastics, so too, indicating that the mention of Ukkaṭṭhā serves various purposes, such as assisting householders, he states: 'by the mention of Ukkaṭṭhā' and so on.

Thật vậy, để chỉ ra rằng điều đó, cũng như việc nêu tên rừng Subhaga và những điều tương tự, có nhiều mục đích như giúp đỡ những người xuất gia, thì việc nêu tên làng khất thực cũng có nhiều mục đích như giúp đỡ những người tại gia, ngài nói “bằng cách nêu tên Ukkaṭṭhā” và những điều tương tự.

Tattha paccayaggahaṇena upasaṅkamanapayirupāsanānaṃ okāsadānena dhammadesanāya saraṇesu sīlesu ca patiṭṭhāpanena yathūpanissayaṃ uparivisesādhigamāvahanena ca gahaṭṭhānaggahakaraṇaṃ, uggahaparipucchānaṃ kammaṭṭhānānuyogassa ca anurūpavasanaṭṭhānapariggahenettha pabbajitānuggahakaraṇaṃ veditabbaṃ.

Herein, assisting householders should be understood as: by receiving requisites, by providing an opportunity for approaching and attending upon, by teaching the Dhamma, by establishing them in the refuges and precepts, and by leading them to higher attainments according to their dispositions. And assisting monastics here should be understood as: by the acquisition of a suitable dwelling place for study, inquiry, and devotion to meditation subjects.

Ở đây, việc giúp đỡ người tại gia nên được hiểu là thông qua việc thọ nhận vật dụng, tạo cơ hội cho việc đến gần và phụng sự, thuyết pháp, thiết lập họ vào Tam quy và Ngũ giới, và giúp họ đạt được các đặc biệt cao hơn tùy theo căn duyên của họ; còn việc giúp đỡ người xuất gia ở đây nên được hiểu là thông qua việc tìm một nơi ở phù hợp cho việc học hỏi, tra vấn và thực hành thiền định.

Karuṇāya upagamanaṃ, na lābhādinimittaṃ, paññāya apagamanaṃ, na virodhādinimittanti upagamanāpagamanānaṃ nirupakkilesataṃ vibhāveti.

He explains the purity of going forth and returning: 'approaching out of compassion,' not for gain and so on; 'departing out of wisdom,' not due to aversion and so on.

Ngài làm sáng tỏ sự vô nhiễm của việc đến và đi: việc đến là do lòng bi mẫn, không phải vì lợi lộc hay những điều tương tự; việc đi là do trí tuệ, không phải vì sự bất đồng hay những điều tương tự.

Dhammikasukhaṃ nāma anavajjasukhaṃ.

Righteous pleasure is blameless pleasure.

Hạnh phúc hợp Pháp có nghĩa là hạnh phúc không có lỗi lầm.

Devānaṃ upakārabahulatā janavivittatāya.

The frequent benefit for devas is due to the solitude of the place.

Chư thiên giúp đỡ nhiều là do nơi đó vắng vẻ ít người.

Pacurajanavivittaṃ hi ṭhānaṃ devā upasaṅkamitabbaṃ maññanti.

For devas deem a place secluded from many people as worthy of being approached.

Thật vậy, chư thiên nghĩ rằng một nơi vắng vẻ nhiều người là nơi đáng đến.

Tadatthaparinipphādananti lokatthanipphādanaṃ, buddhakiccasampādananti attho.

Accomplishment of that purpose means the accomplishment of the world's welfare, that is, the fulfillment of the Buddha's duties.

Việc hoàn thành mục đích đó có nghĩa là hoàn thành mục đích của thế gian, tức là hoàn thành Phật sự.

Evamādināti ādi-saddena ukkaṭṭhākittanato rūpakāyassa anuggaṇhanaṃ dasseti, subhagavanādikittanato dhammakāyassa.

By 'thus and so forth': the word 'and so forth' indicates the fostering of the physical body by the mention of Ukkaṭṭhā, and that of the Dhamma body by the mention of Subhaga Grove and so on.

Bằng cách này và những điều tương tự, với từ “và những điều tương tự”, ngài chỉ ra việc hỗ trợ thân sắc bằng cách nêu tên Ukkaṭṭhā, và hỗ trợ pháp thân bằng cách nêu tên rừng Subhaga và những điều tương tự.

Tathā purimena parādhīnakiriyākaraṇaṃ, dutiyena attādhīnakiriyākaraṇaṃ.

Similarly, by the former, dependent action is performed; by the latter, independent action.

Cũng vậy, với điều trước là hành động phụ thuộc vào người khác, với điều sau là hành động tự chủ.

Purimena vā karuṇākiccaṃ, itarena paññākiccaṃ.

Or, by the former, the act of compassion; by the latter, the act of wisdom.

Hoặc với điều trước là hành động của lòng bi mẫn, với điều kia là hành động của trí tuệ.

Purimena cassa paramāya anukampāya samannāgamaṃ, pacchimena paramāya upekkhāya samannāgamaṃ dīpeti.

By the former, it shows his endowment with supreme compassion; by the latter, his endowment with supreme equanimity.

Với điều trước, ngài chỉ ra sự thành tựu lòng bi mẫn tối thượng của Ngài; với điều sau, ngài chỉ ra sự thành tựu sự xả ly tối thượng của Ngài.

Bhagavā hi sabbasatte paramāya anukampāya anukampati, na ca tattha sinehadosānupatito paramupekkhakabhāvato, upekkhako ca na ca parahitasukhakaraṇe apposukko mahākāruṇikabhāvato.

For the Blessed One is compassionate towards all beings with supreme compassion, yet he is not swayed by attachment or aversion due to his state of supreme equanimity; and though he is equipoised, he is not indifferent to doing what is beneficial and conducive to happiness for others, due to his great compassion.

Thật vậy, Đức Thế Tôn thương xót tất cả chúng sinh với lòng bi mẫn tối thượng, nhưng không bị ảnh hưởng bởi tình cảm hay lỗi lầm vì Ngài có sự xả ly tối thượng; và Ngài có sự xả ly nhưng không thờ ơ trong việc mang lại lợi ích và hạnh phúc cho người khác vì Ngài có lòng đại bi.

165

Tassa mahākāruṇikatāya lokanāthatā, upekkhakatāya attanāthatā.

His great compassion makes him a saviour of the world, his equanimity makes him a saviour of himself.

Do lòng đại bi của Ngài mà Ngài là bậc nương tựa của thế gian, do sự xả ly của Ngài mà Ngài là bậc tự nương tựa.

Tathā hesa bodhisattabhūto mahākaruṇāya sañcoditamānaso sakalalokahitāya ussukkamāpanno mahābhinīhārato paṭṭhāya tadatthanipphādanatthaṃ puññañāṇasambhāre sampādento aparimitaṃ kālaṃ anappakaṃ dukkhamanubhosi, upekkhakatāya sammā patitehi dukkhehi na vikampi.

For as a Bodhisatta, with his mind impelled by great compassion, striving for the welfare of the entire world, from the time of his Great Vow, he accumulated perfections of merit and wisdom to accomplish that purpose, enduring immeasurable suffering for an immeasurable time; yet, due to his equanimity, he was not shaken by the sufferings that rightly befell him.

Cũng vậy, khi còn là Bồ tát, với tâm được thúc đẩy bởi lòng đại bi, Ngài đã nỗ lực vì lợi ích của toàn thể thế gian, từ khi phát đại nguyện, Ngài đã tích lũy các Ba-la-mật về phước đức và trí tuệ để hoàn thành mục đích đó, trải qua vô lượng thời gian và chịu đựng vô vàn khổ đau; do sự xả ly, Ngài không hề nao núng trước những khổ đau đã xảy đến một cách đúng đắn.

Tathā mahākāruṇikatāya saṃsārābhimukhatā, upekkhakatāya tato nibbindanā.

Likewise, his great compassion leads him towards saṃsāra, while his equanimity leads him to dispassion from it.

Cũng vậy, do lòng đại bi mà Ngài hướng về luân hồi, do sự xả ly mà Ngài chán ghét luân hồi.

Tathā upekkhakatāya nibbānābhimukhatā, mahākāruṇikatāya tadadhigamo.

Similarly, his equanimity leads him towards Nibbāna, while his great compassion leads to its attainment.

Cũng vậy, do sự xả ly mà Ngài hướng về Nibbāna, do lòng đại bi mà Ngài đạt được Nibbāna.

Tathā mahākāruṇikatāya paresaṃ abhiṃsāpanaṃ, upekkhakatāya sayaṃ parehi abhāyanaṃ.

Likewise, his great compassion involves not harming others, while his equanimity involves not being harmed by others himself.

Cũng vậy, do lòng đại bi mà Ngài không làm hại người khác, do sự xả ly mà Ngài không bị người khác làm hại.

Mahākāruṇikatāya paraṃ rakkhato attano rakkhaṇaṃ, upekkhakatāya attānaṃ rakkhato paresaṃ rakkhaṇaṃ.

Through great compassion, by protecting others, he protects himself; through equanimity, by protecting himself, he protects others.

Do lòng đại bi mà Ngài tự bảo vệ mình khi bảo vệ người khác, do sự xả ly mà Ngài bảo vệ người khác khi tự bảo vệ mình.

Tenassa attahitāya paṭipannādīsu catutthapuggalabhāvo siddho hoti.

Thus, his status as the fourth type of person among those dedicated to their own welfare and so forth is established.

Do đó, Ngài được chứng minh là người thứ tư trong số những người thực hành vì lợi ích của bản thân và những người khác.

Tathā mahākāruṇikatāya saccādhiṭṭhānassa cāgādhiṭṭhānassa ca pāripūri, upekkhakatāya upasamādhiṭṭhānassa paññādhiṭṭhānassa ca pāripūri.

Similarly, through great compassion, the perfections of the Adhiṭṭhāna of Truth and the Adhiṭṭhāna of Renunciation are fulfilled; through equanimity, the perfections of the Adhiṭṭhāna of Tranquility and the Adhiṭṭhāna of Wisdom are fulfilled.

Cũng vậy, do lòng đại bi mà Ngài hoàn thành sự quyết định về sự thật và sự quyết định về sự bố thí; do sự xả ly mà Ngài hoàn thành sự quyết định về sự an tịnh và sự quyết định về trí tuệ.

Evaṃ parisuddhāsayapayogassa mahākāruṇikatāya lokahitatthameva rajjasampadādibhavasampattiyā upagamanaṃ, upekkhakatāya tiṇāyapi amaññamānassa tato apagamanaṃ.

Thus, for one whose intention and application are purified, out of great compassion, he approached the attainment of sovereign power and other existences solely for the welfare of the world; out of equanimity, he departed from them, not valuing them even as a blade of grass.

Như vậy, với ý định và sự nỗ lực thanh tịnh, do lòng đại bi mà Ngài chấp nhận sự giàu sang của vương quốc và sự thịnh vượng của các cõi chỉ vì lợi ích của thế gian; do sự xả ly mà Ngài từ bỏ chúng như không coi trọng ngay cả một cọng cỏ.

Iti suvisuddhaupagamāpagamassa mahākāruṇikatāya lokahitatthameva dānavasena sampattīnaṃ pariccajanā, upekkhakatāya cassa phalassa attano apaccāsīsanā.

Thus, for one whose approaching and departing are utterly pure, out of great compassion, he renounced his possessions in the form of giving solely for the welfare of the world; out of equanimity, he himself did not expect the fruit thereof.

Như vậy, với sự đến và đi vô cùng thanh tịnh, do lòng đại bi mà Ngài từ bỏ tài sản bằng cách bố thí chỉ vì lợi ích của thế gian; do sự xả ly mà Ngài không mong cầu quả báo cho chính mình.

Evaṃ samudāgamanato paṭṭhāya acchariyabbhutaguṇasamannāgatassa mahākāruṇikatāya paresaṃ hitasukhatthaṃ atidukkarakāritā, upekkhakatāya kāyampi analaṃkāritā.

Thus, for one endowed with astonishing and wonderful qualities from the very beginning of his emergence, out of great compassion, he performed extremely difficult deeds for the welfare and happiness of others; out of equanimity, he did not adorn even his body.

Như vậy, từ khi phát nguyện, Ngài đã thành tựu những phẩm chất kỳ diệu và phi thường, do lòng đại bi mà Ngài đã làm những việc cực kỳ khó khăn vì lợi ích và hạnh phúc của người khác; do sự xả ly mà Ngài không hề trang sức cho thân mình.

166

Tathā mahākāruṇikatāya carimattabhāve jiṇṇāturamatadassanena sañjātasaṃvego, upekkhakatāya uḷāresu devabhogasadisesu bhogesu nirapekkho mahābhinikkhamanaṃ nikkhami.

Likewise, out of great compassion, he was aroused by seeing the aged, sick, and dead in his last existence; out of equanimity, he undertook the Great Renunciation, being unconcerned about opulent enjoyments similar to divine pleasures.

Cũng vậy, do lòng đại bi mà trong kiếp cuối cùng, Ngài đã sinh khởi sự xúc động khi thấy người già, người bệnh, người chết; do sự xả ly mà Ngài đã xuất gia đại nạn, không còn vướng bận vào những tài sản cao quý giống như của chư thiên.

Tathā mahākāruṇikatāya ‘‘kicchaṃ vatāyaṃ loko āpanno’’tiādinā (dī. ni. 2.57; saṃ. ni. 2.4, 10) karuṇāmukheneva vipassanārambho, upekkhakatāya buddhabhūtassa satta sattāhāni vivekasukheneva vītināmanaṃ.

Likewise, out of great compassion, he began insight meditation with a compassionate thought, saying, "Indeed, this world has fallen into distress" (Dī. Ni. 2.57; Saṃ. Ni. 2.4, 10); out of equanimity, as a Buddha, he spent seven times seven days in the bliss of seclusion.

Cũng vậy, do lòng đại bi mà Ngài bắt đầu thực hành thiền quán với lòng bi mẫn, nói rằng “Ôi, thế gian này thật khổ sở biết bao!”; do sự xả ly mà sau khi thành Phật, Ngài đã trải qua bảy tuần lễ trong niềm hạnh phúc của sự độc cư.

Mahākāruṇikatāya dhammagambhīrataṃ paccavekkhitvā dhammadesanāya apposukkataṃ āpajjitvāpi mahābrahmuno ajjhesanāpadesena okāsakaraṇaṃ, upekkhakatāya pañcavaggiyādi veneyyānaṃ ananurūpasamudācārepi anaññathābhāvo.

Out of great compassion, after reflecting on the profundity of the Dhamma and becoming disinclined to teach it, he created an opportunity through the entreaty of Brahmā Sahampati; out of equanimity, even with the unseemly conduct of the group of five ascetics and other trainees, there was no change in him.

Do lòng đại bi mà sau khi quán xét sự thâm sâu của Pháp và trở nên thờ ơ với việc thuyết Pháp, Ngài đã tạo cơ hội thuyết Pháp theo lời thỉnh cầu của Đại Phạm Thiên; do sự xả ly mà Ngài không hề thay đổi thái độ dù cho các đệ tử như nhóm năm vị tỳ-khưu có cách cư xử không phù hợp.

Mahākāruṇikatāya katthaci paṭighātābhāvenassa sabbattha amittasaññāya abhāvo, upekkhakatāya katthacipi anurodhābhāvena sabbattha sinehasanthavābhāvo.

Out of great compassion, there was no hostility in him anywhere, hence no perception of enemies anywhere; out of equanimity, there was no partiality in him anywhere, hence no attachment or affection anywhere.

Do lòng đại bi mà Ngài không có sự thù ghét ở bất cứ đâu, nên không có nhận thức về kẻ thù ở bất cứ nơi nào; do sự xả ly mà Ngài không có sự ràng buộc ở bất cứ đâu, nên không có tình cảm hay sự thân mật ở bất cứ nơi nào.

Mahākāruṇikatāya gāmādīnaṃ āsannaṭṭhāne vasantassapi upekkhakatāya araññaṭṭhāne eva viharaṇaṃ.

Out of great compassion, even while dwelling near villages and so on, out of equanimity, he dwelled only in forest places.

Do lòng đại bi mà Ngài sống gần các làng mạc, v.v.; do sự xả ly mà Ngài sống ở nơi rừng sâu.

Tena vuttaṃ ‘‘purimena cassa paramāya annukampāya samannāgamaṃ, pacchimena paramāya upekkhāya samannāgamaṃ dīpetī’’ti.

Therefore, it is said, "By the former, it shows his endowment with supreme compassion; by the latter, his endowment with supreme equanimity."

Vì thế, đã nói rằng “Với điều trước, ngài chỉ ra sự thành tựu lòng bi mẫn tối thượng của Ngài; với điều sau, ngài chỉ ra sự thành tựu sự xả ly tối thượng của Ngài”.

167

Tanti ‘‘tatrā’’ti padaṃ.

That refers to the word "there".

“Tatra” là từ “ở đó”.

Desakālaparidīpananti ye desakālā idha viharaṇakiriyāvisesanabhāvena vuttā, tesaṃ paridīpananti dassento ‘‘yaṃ samayaṃ…pe… dīpetī’’ti āha.

Indicating the place and time means indicating the place and time mentioned here as specifying the action of dwelling, as he states: "at what time... etc. ... indicates."

Để chỉ ra việc làm sáng tỏ thời gian và địa điểm—tức là việc làm sáng tỏ thời gian và địa điểm đã được nói ở đây như là những đặc điểm của hành động trú ngụ—ngài nói “vào thời điểm… (vân vân)… chỉ ra”.

Taṃ-saddo hi vuttassa atthassa paṭiniddeso, tasmā idha kālassa, desassa vā paṭiniddeso bhavituṃ arahati, na aññassa.

For the word 'that' refers back to a previously mentioned meaning; therefore, here it should refer back to time or place, and not to anything else.

Thật vậy, từ “taṃ” (đó) là sự chỉ định lại một ý nghĩa đã được nói đến, do đó ở đây nó phải là sự chỉ định lại thời gian hoặc địa điểm, chứ không phải cái khác.

Ayaṃ tāva tatra-saddassa paṭiniddesabhāve atthavibhāvanā.

This is, first of all, the clarification of the meaning when the word 'there' refers back.

Đây là sự làm sáng tỏ ý nghĩa của từ “tatra” khi nó là một sự chỉ định lại.

Yasmā pana īdisesu ṭhānesu tatra-saddo dhammadesanāvisiṭṭhaṃ desaṃ kālañca vibhāveti, tasmā vuttaṃ ‘‘bhāsitabbayutte vā desakāle dīpetī’’ti.

Since, however, in such contexts, the word 'there' clarifies the place and time appropriate for teaching the Dhamma, it is therefore said: "or it indicates the place and time suitable for speaking."

Vì trong những trường hợp như vậy, từ “tatra” làm sáng tỏ địa điểm và thời gian đặc biệt thích hợp cho việc thuyết Pháp, nên đã nói “hoặc chỉ ra địa điểm và thời gian thích hợp để thuyết pháp”.

Tena tatrāti yattha bhagavā dhammadesanatthaṃ bhikkhū ālapi abhāsi, tādise dese, kāle vāti attho.

Hence, 'there' means in such a place or at such a time where the Blessed One addressed and spoke to the bhikkhus for the purpose of teaching the Dhamma.

Do đó, “tatra” có nghĩa là ở địa điểm hoặc vào thời điểm mà Đức Thế Tôn đã nói chuyện với các tỳ-khưu để thuyết Pháp.

Na hītiādinā tamevatthaṃ samattheti.

By 'for not...' and so on, he substantiates that very meaning.

Ngài xác nhận ý nghĩa đó bằng cách nói “Na hi” (Thật vậy, không phải) và những điều tương tự.

Nanu ca yattha ṭhito bhagavā ‘‘akālo kho tāvā’’tiādinā bāhiyassa dhammadesanaṃ paṭikkhipi, tattheva antaravīthiyaṃ ṭhito tassa dhammaṃ desetīti?

But did not the Blessed One, standing in the very same street where he rejected Bāhiya's request for Dhamma teaching with "it is not the right time yet," teach him the Dhamma there?

Chẳng phải Đức Thế Tôn đã từ chối thuyết Pháp cho Bāhiya, nói rằng “Bây giờ chưa phải lúc”, nhưng Ngài lại thuyết Pháp cho ông ấy ngay tại con đường giữa các nhà?

Saccametaṃ, adesetabbakāle adesanāya idaṃ udāharaṇaṃ.

This is true, and this example is given for not teaching at an unsuitable time.

Điều đó là đúng, đây là một ví dụ về việc không thuyết Pháp vào thời điểm không thích hợp.

Tenevāha ‘‘akālo kho tāvā’’ti.

That is why it is said: "it is not the right time yet."

Chính vì thế mà ngài nói “Bây giờ chưa phải lúc”.

Yaṃ pana tattha vuttaṃ ‘‘antaragharaṃ paviṭṭhamhā’’ti (udā. 10), tampi tassa akālabhāvasseva pariyāyena dassanatthaṃ vuttaṃ.

What was said there, "we have entered the village for alms" (Ud. 10), was also said to indicate, in an indirect way, that it was an unsuitable time.

Còn điều đã nói ở đó “Chúng ta đã vào nhà” cũng được nói để gián tiếp chỉ ra rằng đó là thời điểm không thích hợp.

Tassa hi tadā addhānaparissamena rūpakāye akammaññatā ahosi, balavapītivegena nāmakāye, tadubhayassa vūpasamaṃ āgamento papañcaparihāratthaṃ bhagavā ‘‘akālo kho’’ti pariyāyena paṭikkhipi.

For him, at that time, there was an unsuitability in his physical body due to fatigue from the journey, and in his mental body due to intense rapture. Bringing these two to an end, the Bhagavā rejected^* by way of "it is not the right time" in order to avoid mental proliferation.

Quả thật, khi ấy, do sự mệt mỏi của chặng đường dài, thân thể của vị ấy không còn thích hợp (để thuyết pháp), và do sự hăng hái (hỷ) mạnh mẽ trong danh thân. Để làm cho cả hai điều đó lắng dịu và để tránh sự tăng trưởng của phiền não (papañca), Đức Thế Tôn đã từ chối một cách khéo léo (bằng cách nói) "không phải lúc này".

Adesetabbadese adesanāya pana udāharaṇaṃ ‘‘atha kho bhagavā maggā okkamma aññatarasmiṃ rukkhamūle nisīdi (saṃ. ni. 2.154), vihārato nikkhamitvā vihārapacchāyāyaṃ paññatte āsane nisīdī’’ti (dī. ni. 1.363) ca evamādikaṃ idha ādi-saddena saṅgahitaṃ.

An example of not teaching in a place where it should not be taught is found in instances such as, "Then the Bhagavā, having turned aside from the path, sat down at the root of a certain tree," and "Having departed from the monastery, he sat down on a seat prepared in the shade behind the monastery," and similar cases which are encompassed here by the word ādi (etc.).

Còn ví dụ về việc không thuyết pháp ở nơi không nên thuyết pháp là những câu như: “Rồi Đức Thế Tôn rời khỏi con đường, ngồi dưới gốc cây nào đó” (Tương Ưng Bộ 2.154), “Sau khi ra khỏi tịnh xá, Ngài ngồi trên chỗ đã trải sẵn dưới bóng mát phía sau tịnh xá” (Trường Bộ 1.363), và những câu tương tự được bao gồm ở đây bằng từ ādi (vân vân).

168

‘‘Atha kho so, bhikkhave, bālo idha pubbe rasādo idha pāpāni kammāni karitvā’’tiādīsu (ma. ni. 3.251) padapūraṇamatte kho-saddo, ‘‘dukkhaṃ kho agāravo viharati appatisso’’tiādīsu (a. ni. 4.21) avadhāraṇe, ‘‘kittāvatā nu kho, āvuso, satthu pavivittassa viharato sāvakā vivekaṃ nānusikkhantī’’tiādīsu (ma. ni. 1.31) ādikālatthe.

In passages like, "Then, O bhikkhus, that fool, having previously done evil deeds here in this world, craving for tastes," the word kho is merely a filler; in passages like, "Certainly, one lives in suffering, without respect, without reverence," it is for emphasis; and in passages like, "To what extent, friend, when the Teacher lives secluded, do the disciples not practice seclusion?" it signifies initial time.

Trong các câu như “Này các tỳ khưu, kẻ ngu si ấy, đã làm những nghiệp ác ở đời này, đã hưởng vị ở đời này” (Trung Bộ 3.251), từ kho chỉ là để bổ túc câu; trong các câu như “Quả thật, sống thiếu tôn kính, không có sự nể trọng là khổ” (Tăng Chi Bộ 4.21), nó dùng để nhấn mạnh; trong các câu như “Này chư hiền, cho đến khi nào các đệ tử không noi theo sự độc cư của vị Đạo Sư đang sống độc cư?” (Trung Bộ 1.31), nó mang nghĩa thời điểm ban đầu.

Vākyārambheti attho.

The meaning is "at the beginning of a sentence."

Nghĩa là khởi đầu câu.

Tattha padapūraṇena vacanālaṅkāramattaṃ kataṃ hoti, ādikālatthena vākyassa upaññāsamattaṃ, avadhāratthena pana niyamadassanaṃ, tasmā āmantesi evāti āmantane niyamo dassito hotīti.

In these instances, by word-filling, it is merely an embellishment of speech; by initial time, it is merely the introduction of a sentence; but by emphasis, it is the showing of a rule. Therefore, it is said that "he addressed them," showing a rule in addressing.

Ở đó, sự bổ túc câu chỉ là để trang sức cho lời nói; nghĩa thời điểm ban đầu chỉ là để mở đầu câu; còn nghĩa nhấn mạnh là để chỉ sự quy định. Do đó, ở đây, trong lời mời gọi, sự quy định được chỉ ra là “Ngài đã mời gọi như vậy”.

169

‘‘Bhagavāti lokagarudīpana’’nti kasmā vuttaṃ, nanu pubbepi bhagavā-saddassa attho vuttoti?

Why is it stated, "Bhagavā is an illuminator for the world's venerable one," when the meaning of the word Bhagavā has already been given before?

Tại sao lại nói “Bhagavā (Đức Thế Tôn) là để chỉ vị Đạo Sư của thế gian”, chẳng phải nghĩa của từ Bhagavā đã được nói trước đây rồi sao?

Yadipi pubbe vutto, taṃ panassa yathāvutte ṭhāne viharaṇakiriyāya kattuvisesadassanatthaṃ kataṃ, na āmantanakiriyāya, idha pana āmantanakiriyāya, tasmā tadatthaṃ puna ‘‘bhagavā’’ti pāḷiyaṃ vuttanti tassatthaṃ dassetuṃ ‘‘bhagavāti lokagarudīpana’’nti āha.

Although it was stated before, that was done to show the specific agent in the act of dwelling in the aforementioned place, not for the act of addressing. Here, however, it is for the act of addressing. Therefore, to show its meaning, it is again stated in the Pāḷi text as "Bhagavā," and thus it is said, "Bhagavā is an illuminator for the world's venerable one."

Mặc dù đã được nói trước đây, nhưng điều đó là để chỉ ra đặc điểm của chủ thể trong hành động an trú tại chỗ đã được nói đến, chứ không phải trong hành động mời gọi. Ở đây, nó là trong hành động mời gọi. Do đó, để chỉ ra ý nghĩa đó, khi từ “Bhagavā” được nói lại trong Pāḷi, thì nói “Bhagavā là để chỉ vị Đạo Sư của thế gian”.

Kathāsavanayuttapuggalavacananti vakkhamānāya mūlapariyāyadesanāya savanayogyapuggalavacanaṃ.

Kathāsavanayuttapuggalavacana means the speech (address) to individuals suitable for listening to the basic teaching to be spoken.

Lời nói dành cho người xứng đáng nghe pháp là lời nói dành cho người xứng đáng nghe bài pháp Mūlapariyāya sẽ được thuyết.

Catūsupi parisāsu bhikkhū eva edisānaṃ desanānaṃ visesena bhājanabhūtā, iti sātisayasāsanasampaṭiggāhakabhāvadassanatthaṃ idha bhikkhugahaṇanti dassetvā idāni saddatthaṃ dassetuṃ ‘‘apicā’’tiādimāha.

Among all four assemblies, bhikkhus are especially suited to receive such teachings. Therefore, having shown that the mention of bhikkhus here is to indicate their pre-eminent capacity to receive the Dispensation, it now proceeds to explain the meaning of the word by stating "apicā" (furthermore) and so on.

Trong cả bốn hội chúng, chỉ có các tỳ khưu là những người đặc biệt xứng đáng với những bài pháp như vậy. Do đó, sau khi chỉ ra rằng việc đề cập đến các tỳ khưu ở đây là để thể hiện sự tiếp nhận giáo pháp một cách đặc biệt, bây giờ, để chỉ ra ý nghĩa của từ, nói “apicā” (hơn nữa) và tiếp theo.

170

Tattha bhikkhakoti bhikkhūti bhikkhanadhammatāya bhikkhūti attho.

Among these, "bhikkho means bhikkhu"; that is, bhikkhu due to the characteristic of begging.

Ở đó, bhikkhako (người khất thực) là bhikkhu (tỳ khưu) có nghĩa là tỳ khưu do bản chất khất thực.

Bhikkhācariyaṃ ajjhupagatoti buddhādīhipi ajjhupagataṃ bhikkhācariyaṃ uñchācariyaṃ ajjhupagatattā anuṭṭhitattā bhikkhū.

Ajjhupagato bhikkhācariyaṃ (one who has undertaken the ascetic practice of alms-gathering) means bhikkhu because he has undertaken the ascetic practice of alms-gathering, that is, collecting alms, which has also been undertaken by Buddhas and others.

Ajjhupagato bhikkhācariyaṃ (người đã chấp nhận hạnh khất thực): là bhikkhu (tỳ khưu) do đã chấp nhận hạnh khất thực, hạnh nhặt lượm, được cả chư Phật và các bậc Thánh khác chấp nhận, và đã thực hành nó.

Yo hi koci appaṃ vā mahantaṃ vā bhogakkhandhaṃ pahāya agārasmā anagāriyaṃ pabbajito, so kasigorakkhādīhi jīvikākappanaṃ hitvā liṅgasampaṭicchaneneva bhikkhācariyaṃ ajjhupagatattā bhikkhu, parapaṭibaddhajīvikattā vā vihāramajjhe kājabhattaṃ bhuñjamānopi bhikkhācariyaṃ ajjhupagatoti bhikkhu, piṇḍiyālopabhojanaṃ nissāya pabbajjāya ussāhajātattā vā bhikkhācariyaṃ ajjhupagatoti bhikkhūti evampettha attho daṭṭhabbo.

Whoever has abandoned a small or large collection of possessions, gone forth from home to homelessness, and given up livelihood such as farming and cattle-rearing, is a bhikkhu because he has undertaken the ascetic practice of alms-gathering merely by accepting the requisites of a mendicant. Or, because his livelihood depends on others, even if he eats food prepared within the monastery, he is one who has undertaken the ascetic practice of alms-gathering, and thus a bhikkhu. Or, because he has become enthusiastic about the going forth, relying on alms-food, he is one who has undertaken the ascetic practice of alms-gathering, and thus a bhikkhu. The meaning should be understood in this way.

Bất cứ ai đã từ bỏ của cải lớn hay nhỏ, xuất gia từ bỏ gia đình để sống không nhà, người ấy đã từ bỏ cách sống bằng nghề nông, chăn nuôi, v.v., và do đã chấp nhận hạnh khất thực chỉ bằng cách che giấu hình tướng, nên là bhikkhu. Hoặc do cuộc sống phụ thuộc vào người khác, ngay cả khi ăn cơm cúng dường trong tịnh xá, người ấy vẫn là người đã chấp nhận hạnh khất thực, nên là bhikkhu. Hoặc do đã có ý chí xuất gia với nếp sống khất thực, nên là bhikkhu. Ý nghĩa ở đây nên được hiểu như vậy.

Ādinā nayenāti ‘‘bhinnapaṭadharoti bhikkhu, bhindati pāpake akusale dhammeti bhikkhu, bhinnattā pāpakānaṃ akusalānaṃ dhammānaṃ bhikkhū’’tiādinā vibhaṅge (vibha. 510) āgatanayena.

Ādinā nayena (by such a method) refers to the method mentioned in the Vibhaṅga (vibha. 510) such as, "A bhikkhu is one who wears patched robes," "A bhikkhu is one who breaks evil, unwholesome states," "A bhikkhu is one who has broken evil, unwholesome states."

Theo cách thức vân vân là theo cách thức được trình bày trong Phân Tích (Vibhaṅga) (Vibha. 510): “Người mặc y vá là tỳ khưu; người phá hủy các pháp bất thiện là tỳ khưu; do đã phá hủy các pháp bất thiện nên là tỳ khưu”.

Ñāpaneti avabodhane, paṭivedaneti attho.

Ñāpane means in understanding, in realization.

Trong Ñāpane (sự hiểu biết): trong sự thấu hiểu, trong sự giác ngộ.

171

Bhikkhanasīlatātiādīsu bhikkhanasīlatā bhikkhanena ājīvanasīlatā, na kasivaṇijjādīhi ājīvanasīlatā.

Among bhikkhanasīlatā (habit of begging) and so on, bhikkhanasīlatā is the habit of living by begging, not by farming, trade, and so forth.

Trong bhikkhanasīlatā (hạnh khất thực) và các từ tương tự, bhikkhanasīlatā là nếp sống bằng cách khất thực, không phải nếp sống bằng nghề nông, buôn bán, v.v.

Bhikkhanadhammatā ‘‘uddissa ariyā tiṭṭhantī’’ti (paṭi. ma. 153; mi. pa. 4.5.9) evaṃ vuttabhikkhanasabhāvatā, na sambhāvanākohaññasabhāvatā.

Bhikkhanadhammatā is the nature of begging as stated in "The Noble Ones stand dedicated to it" (paṭi. ma. 153; mi. pa. 4.5.9), not the nature of mere possibility or deception.

Bhikkhanadhammatā (bản chất khất thực) là bản chất khất thực được nói đến như “các bậc Thánh đứng đợi” (Paṭi. Ma. 153; Mi. Pa. 4.5.9), không phải bản chất của sự lừa dối hay giả vờ.

Bhikkhane sādhukāritā ‘‘uttiṭṭhe nappamajjeyyā’’ti (dha. pa. 168) vacanaṃ anussaritvā tattha appamajjanā.

Bhikkhane sādhukāritā is not being heedless in it, remembering the saying, "Arise, be not heedless" (dha. pa. 168).

Bhikkhane sādhukāritā (sự thực hành tốt trong khất thực) là sự không phóng dật trong việc ghi nhớ lời dạy “hãy đứng dậy, đừng phóng dật” (Dhammapada 168).

Atha vā sīlaṃ nāma pakatisabhāvo, idha pana tadadhiṭṭhānaṃ.

Alternatively, sīlaṃ (virtue) means natural disposition, but here it is its foundation.

Hoặc sīla (giới) là bản chất tự nhiên, nhưng ở đây là sự nương tựa vào đó.

Dhammoti vataṃ.

Dhammo means practice.

Dhammo (pháp) là giới nguyện.

Apare pana ‘‘sīlaṃ nāma vatasamādānaṃ, dhammo nāma paveṇīāgataṃ cārittaṃ, sādhukāritāti sakkaccakāritā ādarakiriyā’’ti vaṇṇenti.

Others, however, explain: "sīlaṃ means the undertaking of vows, dhammo means the traditional conduct, sādhukāritā means doing with care, earnest action."

Những người khác lại giải thích: “sīla (giới) là sự thọ trì giới nguyện, dhammo (pháp) là phong tục truyền thống, sādhukāritā (sự thực hành tốt) là sự thực hành cẩn trọng, hành động tôn kính”.

Hīnādhikajanasevitanti ye bhikkhubhāve ṭhitāpi jātimadādivasena uddhatā unnaḷā.

Hīnādhikajanasevitaṃ (served by inferior and superior people) refers to those who, even though established in the state of being bhikkhus, are arrogant and conceited due to pride of birth and so on.

Hīnādhikajanasevitaṃ (được người thấp kém và người cao quý thực hành): Những người dù đang ở trong trạng thái tỳ khưu nhưng lại kiêu ngạo, ngông cuồng do tự mãn về dòng dõi, v.v.

Ye ca gihibhāve paresu atthikabhāvampi anupagatatāya bhikkhācariyaṃ paramakāpaññataṃ maññanti, tesaṃ ubhayesampi yathākkamaṃ ‘‘bhikkhavo’’ti vacanena hīnajanehi daliddehi paramakāpaññataṃ pattehi parakulesu bhikkhācariyāya jīvikaṃ kappentehi sevitaṃ vuttiṃ pakāsento uddhatabhāvaniggahaṃ karoti, adhikajanehi uḷārabhogakhattiyakulādito pabbajitehi buddhādīhi ājīvavisodhanatthaṃ sevitaṃ vuttiṃ pakāsento dīnabhāvaniggahaṃ karotīti yojetabbaṃ.

And those who, as laypeople, not even being in need of others, consider the ascetic practice of alms-gathering to be the utmost degradation—for both of these, the word "bhikkhavo" is to be understood as follows: by announcing a livelihood served by inferior people, by the poor who have reached the utmost degradation and sustain their lives by alms-gathering in others' families, he suppresses arrogance; by announcing a livelihood served by superior people, by those who have gone forth from noble and wealthy khattiya families and by Buddhas, for the purification of livelihood, he suppresses lowliness.

Và những người đang ở trạng thái cư sĩ, do không đạt được sự cần thiết đối với người khác, xem hạnh khất thực là sự thấp kém tột cùng. Đối với cả hai loại người này, việc dùng từ “bhikkhavo” (này các tỳ khưu) lần lượt để chỉ ra nếp sống được thực hành bởi những người thấp kém, nghèo khổ, đã đạt đến sự thấp kém tột cùng, sống bằng cách khất thực từ nhà người khác, là để chế ngự sự kiêu ngạo. Việc chỉ ra nếp sống được thực hành bởi những người cao quý, những người đã xuất gia từ dòng dõi Sát đế lợi giàu có, v.v., và bởi chư Phật để thanh lọc cuộc sống, là để chế ngự sự ti tiện. Nên được kết hợp như vậy.

Yasmā ‘‘bhikkhavo’’ti vacanaṃ āmantanabhāvato abhimukhīkaraṇaṃ, pakaraṇato sāmatthiyato ca sussūsājananaṃ sakkaccasavanamanasikāraniyojanañca hoti.

Because the word "bhikkhavo," being an address, is a direct appeal, and from the context and capability, it generates eagerness to listen and enjoins careful attention to listening.

Bởi vì từ “bhikkhavo” (này các tỳ khưu), do là lời mời gọi, nên là sự hướng đến đối tượng; và do bối cảnh và năng lực, nó là sự khơi dậy lòng khao khát lắng nghe và sự thúc giục chú tâm lắng nghe một cách cẩn trọng.

Tasmā tamatthaṃ dassento ‘‘bhikkhavoti iminā’’tiādimāha.

Therefore, to show that meaning, he states "iminā bhikkhavo" (by this, O bhikkhus) and so on.

Do đó, để chỉ ra ý nghĩa đó, nói “iminā bhikkhavoti” (bằng từ này, này các tỳ khưu) và tiếp theo.

172

Tattha sādhukasavanamanasikāreti sādhukasavane sādhukamanasikāre ca.

Among these, sādhukasavanamanasikāre means in proper listening and proper attention.

Ở đó, sādhukasavanamanasikāre có nghĩa là trong sự lắng nghe tốt và sự chú tâm tốt.

Kathaṃ pana pavattitā savanādayo sādhukaṃ pavattitā hontīti?

How, then, do listening and so forth occur properly?

Vậy thì, sự lắng nghe và các hành động khác được thực hiện như thế nào thì được gọi là được thực hiện tốt?

‘‘Addhā imāya sammāpaṭipattiyā sakalasāsanasampatti hatthagatā bhavissatī’’ti ādaragāravayogena, kathādīsu aparibhavanādinā ca.

By reverence and respect, thinking, "Surely, by this right practice, the complete accomplishment of the Dispensation will be attained," and by not disparaging the teaching and so forth.

Đó là bằng sự tôn kính và quý trọng rằng “Chắc chắn, với sự thực hành đúng đắn này, toàn bộ thành tựu giáo pháp sẽ nằm trong tầm tay”, và bằng sự không khinh thường bài pháp, v.v.

Vuttaṃ hi ‘‘pañcahi, bhikkhave, dhammehi samannāgato suṇanto saddhammaṃ bhabbo niyāmaṃ okkamituṃ kusalesu dhammesu sammattaṃ.

For it has been said: "Endowed with five qualities, O bhikkhus, a listener to the True Dhamma is capable of entering the fixed path, the rightness in wholesome states.

Quả thật, đã được nói: “Này các tỳ khưu, người lắng nghe Chánh Pháp, được trang bị năm pháp, có khả năng đi vào con đường đúng đắn, đạt được sự đúng đắn trong các pháp thiện lành.

Katamehi pañcahi?

Which five?

Năm pháp nào?

Na kathaṃ paribhoti, na kathikaṃ paribhoti, na attānaṃ paribhoti, avikkhittacitto dhammaṃ suṇāti ekaggacitto, yoniso ca manasi karoti.

He does not disparage the teaching, does not disparage the teacher, does not disparage himself, listens to the Dhamma with an undistracted mind, with a focused mind, and he attends carefully.

Không khinh thường bài pháp, không khinh thường người thuyết pháp, không khinh thường bản thân, lắng nghe pháp với tâm không tán loạn, với tâm chuyên nhất, và chú ý đúng đắn.

Imehi kho, bhikkhave, pañcahi dhammehi samannāgato suṇanto saddhammaṃ bhabbo niyāmaṃ okkamituṃ kusalesu dhammesu sammatta’’nti (a. ni. 5.151).

Endowed with these five qualities, O bhikkhus, a listener to the True Dhamma is capable of entering the fixed path, the rightness in wholesome states" (a. ni. 5.151).

Này các tỳ khưu, người lắng nghe Chánh Pháp, được trang bị năm pháp này, có khả năng đi vào con đường đúng đắn, đạt được sự đúng đắn trong các pháp thiện lành” (Tăng Chi Bộ 5.151).

Tenevāha ‘‘sādhukasavanamanasikārāyattā hi sāsanasampattī’’ti.

Therefore, it is said, "Indeed, the accomplishment of the Dispensation depends on proper listening and attention."

Chính vì thế mà nói “sự thành tựu giáo pháp phụ thuộc vào sự lắng nghe và chú tâm đúng đắn”.

Sāsanasampatti nāma sīlādinipphatti.

Sāsanasampatti means the perfection of sīla and other virtues.

Sāsanasampatti (thành tựu giáo pháp) có nghĩa là sự hoàn thành các giới, v.v.

173

Paṭhamaṃ uppannattā adhigamavasena.

Paṭhamaṃ uppannattā means by way of realization, due to being generated first.

Paṭhamaṃ uppannattā (do đã phát sinh trước tiên): theo nghĩa chứng đắc.

Satthucariyānuvidhāyakattā sīlādiguṇānuṭṭhānena.

Satthucariyānuvidhāyakattā means by the practice of virtues such as sīla, following the Teacher's conduct.

Satthucariyānuvidhāyakattā (do noi theo hạnh của Đạo Sư): bằng sự thực hành các đức tính như giới, v.v.

Tiṇṇaṃ yānānaṃ vasena anudhammapaṭipattisabbhāvato sakalasāsanapaṭiggāhakattā.

Sakalasāsanapaṭiggāhakattā means by being the receiver of the entire Dispensation, due to the existence of practice conforming to the Dhamma in terms of the three vehicles.

Sakalasāsanapaṭiggāhakattā (do tiếp nhận toàn bộ giáo pháp): do có sự thực hành đúng pháp theo ba thừa.

Santikattāti samīpabhāvato.

Santikattā means by closeness.

Santikattā (do gần gũi): do ở gần.

Santikāvacarattāti sabbakālaṃ sampayuttabhāvato.

Santikāvacarattā means by constant association.

Santikāvacarattā (do thường xuyên ở gần): do luôn luôn gắn bó.

Yathānusiṭṭhanti anusāsanianurūpaṃ, anusāsaniṃ anavasesato paṭiggahetvāti attho.

Yathānusiṭṭhaṃ means according to the instruction, that is, having accepted the instruction without remainder.

Yathānusiṭṭhaṃ (như đã được chỉ dạy): phù hợp với lời giáo huấn, có nghĩa là đã tiếp nhận lời giáo huấn một cách trọn vẹn.

Ekacce bhikkhūyeva sandhāyāti ye suttapariyosāne ‘‘te bhikkhū bhagavato bhāsitaṃ abhinandu’’nti vuttā pañcasatā brāhmaṇapabbajitā, te sandhāya.

“Referring only to some bhikkhus” means referring to those five hundred Brahmin ascetics, of whom it is said at the conclusion of the discourse, “those bhikkhus rejoiced in what the Blessed One had spoken.”

Chỉ nhắm đến một số tỳ khưu có nghĩa là nhắm đến năm trăm vị Bà la môn xuất gia đã được nói đến ở cuối bài kinh: “Những tỳ khưu ấy hoan hỷ lời đức Thế Tôn đã thuyết.”

174

Pubbe sabbaparisasādhāraṇattepi bhagavato dhammadesanāya ‘‘jeṭṭhaseṭṭhā’’tiādinā bhikkhūnaṃ eva āmantane kāraṇaṃ dassetvā idāni bhikkhū āmantetvāva dhammadesanāya payojanaṃ dassetuṃ ‘‘kimatthaṃ pana bhagavā’’ti codanaṃ samuṭṭhāpesi.

Although previously the Blessed One’s discourse was common to the entire assembly, having shown the reason for addressing only the bhikkhus with phrases like “foremost and excellent ones,” now, in order to show the purpose of discoursing on the Dhamma by addressing only the bhikkhus, the question “For what purpose then, did the Blessed One…?” was raised.

Trước đây, dù lời thuyết pháp của đức Thế Tôn là chung cho tất cả hội chúng, nhưng đã chỉ ra lý do để chỉ gọi các tỳ khưu bằng cách nói “hỡi các bậc trưởng thượng” và các từ tương tự. Bây giờ, để chỉ ra mục đích của việc thuyết pháp chỉ bằng cách gọi các tỳ khưu, Ngài đã nêu lên câu hỏi: “Vậy vì mục đích gì mà đức Thế Tôn…?”

Tattha aññaṃ cintentāti aññavihitā.

There, “thinking of other things” means being otherwise engaged.

Trong đó, đang nghĩ về điều khác có nghĩa là tâm đang bận rộn với điều khác.

Vikkhittacittāti asamāhitacittā.

“Dispersed minds” means unconcentrated minds.

Tâm tán loạn có nghĩa là tâm không định tĩnh.

Dhammaṃ paccavekkhantāti tadā hiyyo tato paradivasesu vā sutadhammaṃ pati pati manasā avekkhantā.

“Reflecting on the Dhamma” means mentally reflecting on the Dhamma heard on that day, or yesterday, or the day before yesterday.

Đang quán xét Pháp có nghĩa là đang quán xét trong tâm từng phần Pháp đã nghe vào lúc đó, hôm qua, hoặc những ngày trước đó.

Bhikkhū āmantetvā dhamme desiyamāne ādito paṭṭhāya desanaṃ sallakkhetuṃ sakkontīti imamevatthaṃ byatirekamukhena dassetuṃ ‘‘te anāmantetvā’’tiādi vuttaṃ.

The phrase “not addressing them,” etc., was stated to show, by way of contrast, this very point: that when the Dhamma is taught by addressing the bhikkhus, they are able to comprehend the discourse from the very beginning.

Để chỉ ra rằng khi đức Thế Tôn thuyết Pháp bằng cách gọi các tỳ khưu, họ có thể chú tâm vào bài thuyết giảng từ đầu, ý nghĩa này đã được nói đến bằng cách phủ định: “Nếu không gọi họ…” và các từ tương tự.

175

Bhikkhavotīti ca sandhivasena i-kāralopo daṭṭhabbo ‘‘bhikkhavo itī’’ti.

And the elision of the vowel ‘i’ in “Bhikkhavo’ti” should be understood as due to sandhi, from “bhikkhavo iti.”

Bhikkhavoti (hỡi các tỳ khưu) – sự lược bỏ nguyên âm i-kāra nên được hiểu là do sự kết hợp (sandhi) của “bhikkhavo iti”.

Ayaṃ hi iti-saddo hetu-parisamāpanādipadatthavipariyāya-pakārāvadhāraṇanidassanādianekatthappabhedo.

Indeed, this word ‘iti’ has various meanings such as cause, conclusion, inversion of the meaning of a word, manner, emphasis, and illustration.

Quả thật, từ ‘iti’ này có nhiều nghĩa khác nhau như nguyên nhân, kết thúc, v.v., đảo ngược ý nghĩa của từ, cách thức, ví dụ, v.v.

Tathā hesa ‘‘ruppatīti kho, bhikkhave, tasmā ‘rūpa’nti vuccatī’’tiādīsu (saṃ. ni. 3.79) hetuatthe dissati; ‘‘tasmā tiha me, bhikkhave, dhammadāyādā bhavatha, mā āmisadāyādā, atthi me tumhesu anukampā ‘kinti me sāvakā dhammadāyādā bhaveyyuṃ, no āmisadāyādā’ti’’ādīsu parisamāpane; ‘‘iti vā, iti evarūpā naccagītavāditavisūkadassanā paṭivirato’’tiādīsu (dī. ni. 1.13) ādiatthe; ‘‘māgaṇṭhiyoti tassa brāhmaṇassa saṅkhā samaññā paññatti vohāro nāmaṃ nāmakammaṃ nāmadheyyaṃ nirutti byañjanamabhilāpo’’tiādīsu (mahāni. 73) padatthavipariyāye; ‘‘iti kho, bhikkhave, sappaṭibhayo bālo, appaṭibhayo paṇḍito, saupaddavo bālo, anupaddavo paṇḍito, saupasaggo bālo, anupasaggo paṇḍito’’tiādīsu (ma. ni. 3.124) pakāre; ‘‘atthi idappaccayā jarāmaraṇanti iti puṭṭhena satā, ānanda, atthītissa vacanīyaṃ, kiṃ paccayā jarāmaraṇanti iti ce vadeyya, jātipaccayā jarāmaraṇanti iccassa vacanīya’’ntiādīsu (dī. ni. 2.96) avadhāraṇe; ‘‘sabbamatthīti kho, kaccāna, ayameko anto, sabbaṃ natthīti kho, kaccāna, ayaṃ dutiyo anto’’tiādīsu (saṃ. ni. 2.15) nidassane.

Thus, it is seen in the sense of cause in phrases like “It is disfigured, bhikkhus, therefore it is called ‘form’” (Saṃ. Ni. 3.79); in the sense of conclusion in phrases like “Therefore, bhikkhus, be heirs of Dhamma to me, not heirs of material things; I have compassion for you: ‘How might my disciples be heirs of Dhamma, not heirs of material things?’” (Ma. Ni. 1.13); in the sense of ‘and so on’ in phrases like “Abstained from such a display of dancing, singing, music, and shows” (Dī. Ni. 1.13); in the sense of inversion of the meaning of a word in phrases like “‘Māgaṇḍiya’ is the appellation, designation, term, usage, name, naming, nomenclature, etymology, expression, or utterance of that Brahmin” (Mahāni. 73); in the sense of manner in phrases like “Thus, bhikkhus, the fool is fearful, the wise one is fearless; the fool is troubled, the wise one is untroubled; the fool is obstructed, the wise one is unobstructed” (Ma. Ni. 3.124); in the sense of emphasis in phrases like “When asked ‘Is there old age and death dependent on this?’ one should say, Ānanda, ‘There is.’ And if one were to say ‘Dependent on what is old age and death?’ one should say, ‘Old age and death are dependent on birth’” (Dī. Ni. 2.96); and in the sense of illustration in phrases like “‘Everything exists,’ Kaccāna, this is one extreme. ‘Everything does not exist,’ Kaccāna, this is the second extreme” (Saṃ. Ni. 2.15).

Chẳng hạn, nó được thấy với nghĩa nguyên nhân trong các câu như: “Này các tỳ khưu, vì nó bị biến hoại, nên nó được gọi là ‘sắc’ (rūpa)” và các từ tương tự; với nghĩa kết thúc trong các câu như: “Do đó, này các tỳ khưu, hãy là người thừa kế Pháp của Ta, đừng là người thừa kế vật chất. Ta có lòng thương xót đối với các con: ‘Làm sao các đệ tử của Ta có thể là người thừa kế Pháp, chứ không phải người thừa kế vật chất?’” và các từ tương tự; với nghĩa khởi đầu trong các câu như: “Hoặc như vậy, hoặc như vậy là từ bỏ việc xem các buổi ca múa, nhạc kịch, biểu diễn giải trí” và các từ tương tự; với nghĩa đảo ngược ý nghĩa của từ trong các câu như: “Māgaṇṭhiya – đó là sự tính toán, sự đồng thuận, sự quy định, sự sử dụng, tên gọi, sự đặt tên, danh xưng, cách diễn đạt, từ ngữ, sự biểu thị của vị Bà la môn đó” và các từ tương tự; với nghĩa cách thức trong các câu như: “Này các tỳ khưu, như vậy, kẻ ngu si thì đáng sợ, người trí thì không đáng sợ; kẻ ngu si thì đầy chướng ngại, người trí thì không chướng ngại; kẻ ngu si thì đầy hiểm nguy, người trí thì không hiểm nguy” và các từ tương tự; với nghĩa xác định trong các câu như: “Này Ānanda, khi được hỏi rằng ‘có sự già chết do duyên này không?’, người ấy phải nói là ‘có’. Nếu người ấy hỏi ‘già chết do duyên gì?’, người ấy phải nói là ‘già chết do duyên sinh’” và các từ tương tự; với nghĩa ví dụ trong các câu như: “Này Kaccāna, ‘tất cả đều có’ – đây là một cực đoan. Này Kaccāna, ‘tất cả đều không có’ – đây là cực đoan thứ hai” và các từ tương tự.

Idhāpi nidassaneva daṭṭhabbo.

Here too, it should be understood as illustration.

Ở đây cũng nên hiểu nó với nghĩa ví dụ.

Bhikkhavoti hi āmantitākāro, tamesa iti-saddo nidasseti ‘‘bhikkhavoti āmantesī’’ti.

For “Bhikkhavo” is a vocative form, and this word ‘iti’ illustrates it, meaning “he addressed, ‘Bhikkhus!’”

Vì “Bhikkhavo” là cách gọi, và từ ‘iti’ này chỉ ra điều đó: “Ngài đã gọi ‘Bhikkhavo’ (hỡi các tỳ khưu).”

Iminā nayena ‘‘bhaddante’’tiādīsupi yathārahaṃ iti-saddassa attho veditabbo.

In this manner, the meaning of the word ‘iti’ should be understood appropriately in phrases like “Bhaddante,” etc.

Theo cách này, ý nghĩa của từ ‘iti’ cũng nên được hiểu một cách thích hợp trong các trường hợp như “Bhaddante” (Bạch Đại đức) và các từ tương tự.

Pubbe ‘‘bhagavā āmantesī’’ti vuttattā ‘‘bhagavato paccassosu’’nti idha ‘‘bhagavato’’ti sāmivacanaṃ āmantanameva sambandhīantaraṃ apekkhatīti iminā adhippāyena ‘‘bhagavato āmantanaṃ paṭiassosu’’nti vuttaṃ.

Since it was previously stated “the Blessed One addressed,” the phrase “they responded to the Blessed One” here, with the genitive case “bhagavato,” implies that the Blessed One’s addressing expects a corresponding response, and with this intention, it is said, “they responded to the Blessed One’s address.”

Vì trước đó đã nói “đức Thế Tôn gọi”, nên ở đây, câu “bhagavato paccassosu” (họ vâng lời đức Thế Tôn) được nói với ý nghĩa rằng sở hữu cách “bhagavato” (của đức Thế Tôn) chỉ liên quan đến sự gọi và không cần một mối quan hệ trung gian nào khác: “Họ đã vâng lời gọi của đức Thế Tôn.”

‘‘Bhagavato’’ti pana idaṃ paṭissavasambandhanena sampadānavacanaṃ yathā ‘‘devadattassa paṭissuṇotī’’ti.

However, this “bhagavato” in connection with responding is in the dative case, like “he responds to Devadatta.”

Tuy nhiên, từ “bhagavato” này là một cách nói ở sở hữu cách (sampadāna) theo mối quan hệ vâng lời, giống như trong câu “devadattassa paṭissuṇoti” (vâng lời Devadatta).

176

Yaṃ nidānaṃ bhāsitanti sambandho.

The connection is: “What was the nidāna spoken?”

Có mối quan hệ là “cái duyên khởi đã được thuyết giảng”.

Etthāha – kimatthaṃ pana dhammavinayasaṅgahe kariyamāne nidānavacanaṃ, nanu bhagavatā bhāsitavacanasseva saṅgaho kātabboti?

Regarding this, it is asked: “For what purpose is the nidāna mentioned when compiling the Dhamma and Vinaya? Should not only the words spoken by the Blessed One be compiled?”

Ở đây người ta hỏi: “Vậy để làm gì mà có lời nói về duyên khởi khi đang tập hợp Pháp và Luật? Chẳng phải chỉ cần tập hợp những lời đã được đức Thế Tôn thuyết giảng sao?”

Vuccate – desanāya ṭhitiasammosasaddheyyabhāvasampādanatthaṃ.

It is said: For the purpose of ensuring the permanence, indelibility, and credibility of the discourse.

Được trả lời: “Để làm cho bài thuyết giảng được tồn tại lâu dài, không bị nhầm lẫn và đáng tin cậy.”

Kāladesadesakanimittaparisāpadesehi upanibandhitvā ṭhapitā hi desanā ciraṭṭhitikā hoti asammosadhammā saddheyyā ca, desakālakattusotunimittehi upanibaddho viya vohāravinicchayo.

For a discourse established by being bound to time, place, speaker, occasion, and assembly becomes long-lasting, indelible, and credible, just like a legal judgment bound by speaker, time, agent, listener, and occasion.

Quả thật, một bài thuyết giảng được thiết lập bằng cách liên kết với thời gian, địa điểm, người thuyết giảng, dấu hiệu và hội chúng sẽ tồn tại lâu dài, không bị nhầm lẫn và đáng tin cậy, giống như một phán quyết pháp lý được liên kết với người thuyết giảng, thời gian, người thực hiện, người nghe và dấu hiệu.

Teneva ca āyasmatā mahākassapena ‘‘mūlapariyāyasuttaṃ āvuso, ānanda, kattha bhāsita’’ntiādinā desādipucchāsu katāsu tāsaṃ vissajjanaṃ karontena dhammabhaṇḍāgārikena ‘‘evaṃ me suta’’ntiādinā imassa suttassa nidānaṃ bhāsitaṃ.

For this very reason, when Venerable Mahākassapa questioned about the place, etc., with phrases like “Friends, Ānanda, where was the Mūlapariyāyasutta spoken?”, the Dhamma custodian, while answering them, spoke the nidāna of this sutta with phrases like “Thus have I heard.”

Và chính vì thế, khi Tôn giả Mahākassapa hỏi về địa điểm, v.v., như “Này hiền giả Ānanda, kinh Mūlapariyāya được thuyết ở đâu?”, vị Pháp tạng Ānanda đã thuyết về duyên khởi của kinh này bằng cách trả lời những câu hỏi đó với câu “Như vầy tôi nghe…” và các từ tương tự.

Apica satthusampattipakāsanatthaṃ nidānavacanaṃ.

Moreover, the nidāna statement serves to proclaim the Teacher’s excellent qualities.

Hơn nữa, lời nói về duyên khởi là để công bố sự viên mãn của Bậc Đạo Sư.

Tathāgatassa hi bhagavato pubbaracanānumānāgamatakkābhāvato sammāsambuddhabhāvasiddhi.

For the Tathāgata, the Blessed One, attains perfect self-awakening due to the absence of prior contrivance, inference, tradition, or reasoning.

Quả thật, sự thành tựu của đức Thế Tôn như một bậc Chánh Đẳng Giác là do không có sự sắp đặt trước, suy đoán, truyền thống hay lý luận.

Na hi sammāsambuddhassa pubbaracanādīhi attho atthi sabbattha appaṭihatañāṇacāratāya ekappamāṇattā ca ñeyyadhammesu.

For a Perfectly Awakened One has no need for prior contrivances, etc., being unhindered in knowledge everywhere and possessing singular authority in matters knowable.

Vì một bậc Chánh Đẳng Giác không cần đến sự sắp đặt trước, v.v., do sự hoạt động của trí tuệ không bị ngăn ngại ở mọi nơi và do sự đồng nhất về mức độ của các pháp cần biết.

Tathā ācariyamuṭṭhidhammamacchariyasāsanasāvakānurodhābhāvato khīṇāsavabhāvasiddhi.

Similarly, the attainment of being an Arahant is due to the absence of a teacher’s closed-fistedness, stinginess regarding the Dhamma, regard for the Saṅgha, or consideration for disciples.

Tương tự, sự thành tựu của Ngài như một bậc A-la-hán là do không có sự nắm giữ giáo pháp bí mật của bậc đạo sư, không có sự keo kiệt giáo pháp, và không có sự ràng buộc với các đệ tử trong giáo pháp.

Na hi sabbaso khīṇāsavassa te sambhavantīti suvisuddhassa parānuggahappavatti.

For these do not occur in one who is entirely an Arahant; thus, there is a predisposition for benefiting others by one who is perfectly pure.

Vì những điều đó không thể có ở một bậc hoàn toàn đã đoạn tận các lậu hoặc, nên sự ban bố lợi ích cho người khác là hoàn toàn thanh tịnh.

Evaṃ desakasaṃkilesabhūtānaṃ diṭṭhisīlasampadādūsakānaṃ avijjātaṇhānaṃ accantābhāvasaṃsūcakehi ñāṇasampadāpahānasampadābhibyañjakehi ca sambuddhavisuddhabhāvehi purimavesārajjadvayasiddhi, tato eva ca antarāyikaniyyānikadhammesu sammohābhāvasiddhito pacchimavesārajjadvayasiddhīti bhagavato catuvesārajjasamannāgamo attahitaparahitapaṭipatti ca nidānavacanena pakāsitā hoti tattha tattha sampattapariyāya ajjhāsayānurūpaṃ ṭhānuppattikapaṭibhānena dhammadesanādīpanato, idha pana pathavīādīsu vatthūsu puthujjanānaṃ paṭipattivibhāgavavatthāpakadesanādīpanatoti yojetabbaṃ.

In this way, the attainment of the first two fearlessnesses of the Blessed One is proclaimed by the qualities of enlightenment and purity, which reveal the complete absence of ignorance and craving—which are defilements of the speaker and corruptors of accomplishment in view and conduct—and from this very fact, the attainment of the latter two fearlessnesses results from the absence of delusion regarding detrimental and liberative Dhammas, and thus the Blessed One’s possession of the four fearlessnesses and his practice for his own and others’ welfare are proclaimed by the nidāna statement, due to his expounding the Dhamma with spontaneous insight appropriate to the respective opportunities and dispositions, while here, it should be connected to the exposition of the different ways ordinary people practice with regard to objects like earth and so on.

Như vậy, sự thành tựu hai sự vô úy đầu tiên của đức Thế Tôn được công bố bởi những trạng thái Chánh Đẳng Giác và thanh tịnh, biểu lộ sự viên mãn về trí tuệ và sự viên mãn về sự đoạn trừ, những trạng thái hoàn toàn không có vô minh và ái, vốn là những phiền não của người thuyết giảng và những kẻ làm ô uế sự thành tựu về kiến giải và giới hạnh; và chính từ đó, sự thành tựu hai sự vô úy sau cùng được công bố do sự không có mê lầm đối với những pháp gây chướng ngại và những pháp đưa đến giải thoát. Và sự thành tựu bốn sự vô úy của đức Thế Tôn cùng với sự thực hành lợi ích cho mình và lợi ích cho người khác được công bố qua lời nói về duyên khởi, vì nó làm sáng tỏ bài thuyết giảng Pháp, v.v., bằng sự ứng đối tức thời phù hợp với sự viên mãn, khuynh hướng và hoàn cảnh ở từng nơi; còn ở đây, nó làm sáng tỏ bài thuyết giảng phân biệt và thiết lập các hành vi của phàm phu đối với các đối tượng như đất, v.v. – nên phải kết nối như vậy.

Tena vuttaṃ ‘‘satthusampattipakāsanatthaṃ nidānavacana’’nti.

Therefore it is said, “the nidāna statement serves to proclaim the Teacher’s excellent qualities.”

Do đó, đã nói: “Lời nói về duyên khởi là để công bố sự viên mãn của Bậc Đạo Sư.”

177

Tathā sāsanasampattipakāsanatthaṃ nidānavacanaṃ.

Likewise, the nidāna statement serves to proclaim the excellent qualities of the Dispensation.

Tương tự, lời nói về duyên khởi là để công bố sự viên mãn của Giáo Pháp.

Ñāṇakaruṇāpariggahitasabbakiriyassa hi bhagavato natthi niratthikā paṭipatti, attahitatthā vā.

For the Blessed One, whose every action is guided by wisdom and compassion, has no meaningless practice, nor any practice for his own benefit.

Quả thật, không có hành động nào của đức Thế Tôn, người mà mọi hành động đều được bao bọc bởi trí tuệ và lòng bi mẫn, là vô ích hoặc chỉ vì lợi ích của riêng mình.

Tasmā paresaṃ eva atthāya pavattasabbakiriyassa sammāsambuddhassa sakalampi kāyavacīmanokammaṃ yathāpavattaṃ vuccamānaṃ diṭṭhadhammikasamparāyikaparamatthehi yathārahaṃ sattānaṃ anusāsanaṭṭhena sāsanaṃ, na kabyaracanā, tayidaṃ satthucaritaṃ kāladesadesakaparisāpadesehi saddhiṃ tattha tattha nidānavacanehi yathārahaṃ pakāsīyati, idha pana ‘‘pathaviyādīsu vatthūsū’’ti sabbaṃ purimasadisameva.

Therefore, for the Perfectly Awakened One, whose every action proceeds for the benefit of others, all his bodily, verbal, and mental actions, when described as they occurred, constitute the Dispensation (sāsana) in the sense of instructing beings appropriately regarding their immediate welfare, future welfare, and ultimate truth, not as poetic composition; and this conduct of the Teacher, along with the time, place, speaker, assembly, and occasion, is appropriately proclaimed by the nidāna statements in various places; here, however, “in relation to objects like earth, etc.,” everything is the same as before.

Do đó, tất cả các hành động thân, khẩu, ý của đức Chánh Đẳng Giác, người mà mọi hành động đều vì lợi ích của người khác, khi được nói ra đúng như đã xảy ra, là Giáo Pháp theo nghĩa là sự giáo huấn chúng sinh một cách thích hợp về các lợi ích trong hiện tại, vị lai và tối thượng, chứ không phải là sự sáng tác thơ ca. Và cuộc đời của Bậc Đạo Sư này, cùng với thời gian, địa điểm, người thuyết giảng và hội chúng, được công bố một cách thích hợp qua các lời nói về duyên khởi ở từng nơi; còn ở đây, tất cả đều giống như trước, tức là “đối với các đối tượng như đất, v.v.”.

Tena vuttaṃ ‘‘sāsanasampattipakāsanatthaṃ nidānavacana’’nti.

Therefore it is said, “the nidāna statement serves to proclaim the excellent qualities of the Dispensation.”

Do đó, đã nói: “Lời nói về duyên khởi là để công bố sự viên mãn của Giáo Pháp.”

Apica satthuno pamāṇabhāvappakāsanena sāsanassa pamāṇabhāvadassanatthaṃ nidānavacanaṃ, tañca desakappamāṇabhāvadassanaṃ heṭṭhā vuttanayānusārena ‘‘bhagavā’’ti ca iminā padena vibhāvitanti veditabbaṃ.

Furthermore, the nidāna statement serves to demonstrate the authoritativeness of the Dispensation by proclaiming the Teacher’s authoritativeness, and this demonstration of the speaker’s authoritativeness should be understood as revealed by the word “Bhagavā” in accordance with the method explained above.

Hơn nữa, lời nói về duyên khởi là để chỉ ra tính xác thực của Giáo Pháp bằng cách công bố tính xác thực của Bậc Đạo Sư, và sự chỉ ra tính xác thực của người thuyết giảng này nên được hiểu là đã được làm rõ bằng từ “Bhagavā” (đức Thế Tôn) theo cách đã nói ở trên.

‘‘Bhagavā’’ti iminā tathāgatassa rāgadosamohādisabbakilesamaladuccaritādidosappahānadīpanena vacanena anaññasādhāraṇasuparisuddhañāṇakaruṇādiguṇavisesayogaparidīpanena tato eva sabbasattuttamabhāvadīpanena ayamattho sabbathā pakāsito hotīti idamettha nidānavacanappayojanassa mukhamattadassanaṃ.

By this word, "Bhagavā" (Blessed One), this meaning is fully revealed: by indicating the Tathāgata's abandonment of all defilements like lust, hatred, and delusion, and impurities and faults like bad conduct; by indicating his possession of especially pure qualities like knowledge and compassion, unique to him; and thereby indicating his supreme position among all beings—this is merely an indication of the purpose of the introductory word here.

Bằng lời này, “Bhagavā” (Đức Thế Tôn), ý nghĩa này được làm sáng tỏ một cách toàn diện qua việc chỉ rõ sự đoạn trừ tất cả các cấu uế, ác hạnh và các lỗi lầm như tham, sân, si của Như Lai; qua việc chỉ rõ sự hội tụ các phẩm chất đặc biệt như trí tuệ và lòng bi mẫn siêu việt, vô cùng thanh tịnh, không ai sánh bằng; và từ đó, qua việc chỉ rõ trạng thái tối thượng trong tất cả chúng sinh. Đây chỉ là sự trình bày sơ lược về mục đích của lời mở đầu trong trường hợp này.

178

Abbhantaranidānavaṇṇanā niṭṭhitā.

Here concludes the explanation of the internal introduction.

Phần giải thích Nidāna nội bộ đã hoàn tất.

179

Suttanikkhepavaṇṇanā

Explanation of the Discourse Presentation

Giải thích Suttanikkhepa

180

Nikkhittassāti desitassa.

Nikkhittassa means: of that which is taught.

Nikkhittassāti: đã được thuyết.

Desanāpi hi desetabbassa sīlādiatthassa vineyyasantānesu nikkhipanato ‘‘nikkhepo’’ti vuccati.

Indeed, teaching is also called "presentation" (nikkhepo) because it places the meaning, such as virtue, that is to be taught, into the minds of those to be disciplined.

Quả thật, sự thuyết pháp cũng được gọi là “nikkhepa” (sự thuyết) vì nó đặt (nikkhipanato) các ý nghĩa như giới vào tâm của người cần được giáo hóa.

Suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hotīti sāmaññato bhagavato desanāsamuṭṭhānassa vibhāgaṃ dassetvā ‘‘etthāyaṃ desanā evaṃsamuṭṭhānā’’ti desanāya samuṭṭhāne dassite suttassa sammadeva nidānaparijānanena vaṇṇanāya suviññeyyattā vuttaṃ.

It becomes clear when the discourse presentation is examined, means that after showing the general classification of the Buddha's discourses' origin, when it is shown how "this discourse originates in such and such a way," the discourse becomes well understood through a proper understanding of its origin, and thus the explanation is easily comprehensible.

Suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hotīti: sau khi trình bày sự phân loại nguồn gốc của giáo pháp của Đức Thế Tôn một cách tổng quát, khi nguồn gốc của giáo pháp được chỉ rõ là “giáo pháp này có nguồn gốc như thế này”, thì sự giải thích trở nên dễ hiểu nhờ sự nhận biết đúng đắn về nidāna của kinh, do đó đã nói như vậy.

Evañhi ‘‘assutavā bhikkhave puthujjano’’tiādinā, ‘‘yopi so, bhikkhave, bhikkhu arahaṃ khīṇāsavo’’tiādinā (ma. ni. 1.8), ‘‘tathāgatopi kho, bhikkhave, arahaṃ sammāsambuddho’’tiādinā (ma. ni. 1.12) ca pavattadesanā anusandhidassanasukhatāya suviññeyyā hoti.

For instance, discourses like "Uninstructed ordinary person, bhikkhus" and so on, "And that bhikkhu, bhikkhus, who is an Arahant, with defilements destroyed" (M.I, 1.8), "The Tathāgata, bhikkhus, is an Arahant, a Fully Self-Enlightened One" (M.I, 1.12), and so on, are easily comprehensible for the ease of showing their sequence.

Chẳng hạn, giáo pháp được thuyết giảng với lời mở đầu “Này các tỳ khưu, phàm phu không được nghe pháp…” và “Này các tỳ khưu, vị tỳ khưu A-la-hán, các lậu hoặc đã đoạn tận…” (Ma. Ni. 1.8), và “Này các tỳ khưu, Như Lai là bậc A-la-hán, Chánh Đẳng Giác…” (Ma. Ni. 1.12) trở nên dễ hiểu nhờ sự dễ dàng trong việc chỉ ra sự liên kết.

Tattha yathā anekasataanekasahassabhedānipi suttantāni saṃkilesabhāgiyādipadhānanayavasena soḷasavidhataṃ nātivattanti, evaṃ attajjhāsayādisuttanikkhepavasena catubbidhabhāvanti āha ‘‘cattāro hi suttanikkhepā’’ti.

Just as suttantas, though they have hundreds and thousands of divisions, do not exceed sixteen types based on principal methods like the defilement-inclusive category, so too do they have four types based on the presentation of the discourse according to one's own inclination, and so it is said: "For there are four types of discourse presentation."

Trong đó, cũng như các kinh điển, dù có hàng trăm hàng ngàn loại khác nhau, không vượt quá mười sáu loại theo phương pháp chính của các pháp thuộc phần cấu uế, v.v., thì cũng vậy, chúng không vượt quá bốn loại theo Suttanikkhepa như Attajjhāsaya, v.v. Do đó, đã nói “có bốn Suttanikkhepa”.

181

Ettha ca yathā attajjhāsayassa aṭṭhuppattiyā ca parajjhāsayapucchāhi saddhiṃ saṃsaggabhedo sambhavati ‘‘attajjhāsayo ca parajjhāsayo ca, attajjhāsayo ca pucchāvasiko ca, aṭṭhuppattiko ca parajjhāsayo ca, aṭṭhuppattiko ca pucchāvasiko cā’’ti ajjhāsayapucchānusandhisabbhāvato, evaṃ yadipi aṭṭhuppattiyā attajjhāsayenapi saṃsaggabhedo sambhavati, attajjhāsayādīhi pana purato ṭhitehi aṭṭhuppattiyā saṃsaggo natthīti nayidha niravaseso vitthāranayo sambhavatīti ‘‘cattāro suttanikkhepā’’ti vuttaṃ, tadantogadhattā vā sambhavantānaṃ sesanikkhepānaṃ mūlanikkhepavasena cattārova dassitā.

Here, just as a compound division can occur where one's own inclination and the occasion of arising are combined with the questions of others' inclinations—"one's own inclination and others' inclination," "one's own inclination and dependent on a question," "occasion of arising and others' inclination," "occasion of arising and dependent on a question"—due to the presence of an inclination-question sequence; similarly, even if a compound division can occur where the occasion of arising is combined with one's own inclination, there is no combination of the occasion of arising with the aforementioned own inclination and so forth. Therefore, a complete detailed method is not possible here, and thus it is said "four discourse presentations," or alternatively, the remaining possible presentations are included within these four, and so only four primary presentations are shown.

Trong trường hợp này, cũng như sự phân loại kết hợp có thể xảy ra giữa Attajjhāsaya và Aṭṭhuppatti với Parajjhāsaya và Pucchā, chẳng hạn như “Attajjhāsaya và Parajjhāsaya”, “Attajjhāsaya và Pucchāvasika”, “Aṭṭhuppattika và Parajjhāsaya”, “Aṭṭhuppattika và Pucchāvasika” do sự hiện diện của Ajjhāsaya, Pucchā và Anusandhi; thì cũng vậy, mặc dù sự phân loại kết hợp có thể xảy ra giữa Aṭṭhuppatti với Attajjhāsaya, nhưng không có sự kết hợp của Aṭṭhuppatti với các Ajjhāsaya khác đã được đặt ra trước đó. Do đó, phương pháp trình bày chi tiết không thể hoàn chỉnh ở đây, nên đã nói “có bốn Suttanikkhepa”, hoặc chỉ có bốn loại được trình bày như là các nikkhepa gốc, vì các nikkhepa khác có thể xảy ra đều nằm trong đó.

Tathādassanañcettha ayaṃ saṃsaggabhedo gahetabboti.

And in such a demonstration, this compound division should be understood here.

Và trong cách trình bày đó, sự phân loại kết hợp này nên được hiểu.

182

Tatrāyaṃ vacanattho – nikkhipīyatīti nikkhepo, suttaṃ eva nikkhepo suttanikkhepo.

The meaning of the word here is: "Nikkhīpiyati" means it is placed, hence "nikkhepo." A discourse itself is a presentation, thus suttanikkhepo.

Trong đó, ý nghĩa của từ là: cái được đặt ra là nikkhepa, chính kinh điển là nikkhepa, Suttanikkhepa.

Atha vā nikkhipanaṃ nikkhepo, suttassa nikkhepo suttanikkhepo, suttadesanāti attho.

Alternatively, placing is nikkhepo; the placing of a discourse is suttanikkhepo, meaning the teaching of a discourse.

Hoặc là, sự đặt ra là nikkhepa, sự đặt ra của kinh điển là Suttanikkhepa, nghĩa là sự thuyết giảng kinh điển.

Attano ajjhāsayo attajjhāsayo, so assa atthi kāraṇabhūtoti attajjhāsayo.

One's own inclination is attajjhāsayo; because this is a cause for him, he is attajjhāsayo (motivated by one's own inclination).

Ý định của tự thân là Attajjhāsaya, cái đó có ở người đó như là nguyên nhân, nên gọi là Attajjhāsaya.

Attano ajjhāsayo etassāti vā attajjhāsayo.

Or, one whose inclination is his own, is attajjhāsayo.

Hoặc là, ý định của tự thân là của người đó, nên gọi là Attajjhāsaya.

Parajjhāsayepi eseva nayo.

The same method applies to parajjhāsaye (others' inclination).

Đối với Parajjhāsaya cũng cùng một phương pháp.

Pucchāya vaso pucchāvaso, so etassa atthīti pucchāvasiko.

The power of a question is pucchāvaso; he who has this is pucchāvasiko (dependent on a question).

Sự chi phối của câu hỏi là Pucchāvasa, cái đó có ở người đó, nên gọi là Pucchāvasika.

Suttadesanāvatthubhūtassa atthassa uppatti atthuppatti, atthuppattiyeva aṭṭhuppatti ttha-kārassa ṭṭha-kāraṃ katvā.

The arising of the subject matter that forms the basis of the discourse teaching is atthuppatti; atthuppatti itself becomes aṭṭhuppatti by changing 'ttha' to 'ṭṭha'.

Sự phát sinh của một sự việc là đối tượng của sự thuyết giảng kinh điển là Atthuppatti, chính Atthuppatti là Aṭṭhuppatti, bằng cách biến âm chữ ‘ttha’ thành ‘ṭṭha’.

Sā etassa atthīti aṭṭhuppattiko.

He who has this is aṭṭhuppattiko (occasion of arising).

Cái đó có ở người đó, nên gọi là Aṭṭhuppattika.

Atha vā nikkhipīyati suttaṃ etenāti suttanikkhepo, attajjhāsayādi eva.

Alternatively, suttanikkhepo is that by which a discourse is presented, meaning one's own inclination, etc.

Hoặc là, kinh điển được đặt ra bởi cái này, nên gọi là Suttanikkhepa, chính là Attajjhāsaya, v.v.

Etasmiṃ pana attavikappe attano ajjhāsayo attajjhāsayo.

However, in this latter interpretation, one's own inclination is attajjhāsayo.

Trong trường hợp giải thích này, ý định của tự thân là Attajjhāsaya.

Paresaṃ ajjhāsayo parajjhāsayo.

Others' inclination is parajjhāsayo.

Ý định của người khác là Parajjhāsaya.

Pucchīyatīti pucchā, pucchitabbo attho.

That which is questioned is pucchā, meaning the matter to be questioned.

Cái được hỏi là Pucchā, tức là ý nghĩa cần được hỏi.

Pucchanavasena pavattaṃ dhammapaṭiggāhakānaṃ vacanaṃ pucchāvasikaṃ, tadeva nikkhepa-saddāpekkhāya pulliṅgavasena ‘‘pucchāvasiko’’ti vuttaṃ.

The speech of those who receive the Dhamma, which occurs by way of questioning, is pucchāvasikaṃ; that itself is referred to as "pucchāvasiko" in the masculine gender, in relation to the word "nikkhepa."

Lời nói của những người tiếp nhận pháp diễn ra theo cách hỏi là Pucchāvasika, chính cái đó được gọi là “Pucchāvasiko” theo giống đực khi liên quan đến từ nikkhepa.

Tathā aṭṭhuppatti eva aṭṭhuppattikoti evampettha attho veditabbo.

Similarly, aṭṭhuppatti itself is aṭṭhuppattiko; in this way, the meaning should be understood here.

Cũng vậy, chính Aṭṭhuppatti là Aṭṭhuppattiko. Ý nghĩa ở đây nên được hiểu như vậy.

183

Apicettha paresaṃ indriyaparipākādikāraṇanirapekkhattā attajjhāsayassa visuṃ suttanikkhepabhāvo yutto kevalaṃ attano ajjhāsayeneva dhammatantiṭhapanatthaṃ pavattitadesanattā.

Furthermore, it is appropriate for "one's own inclination" to be a distinct type of discourse presentation because it is independent of factors like the ripening of others' faculties, as the teaching arises solely from one's own inclination to establish the tradition of the Dhamma.

Hơn nữa, ở đây, sự kiện Attajjhāsaya là một Suttanikkhepa riêng biệt là hợp lý, vì nó không phụ thuộc vào các nguyên nhân như sự chín muồi của căn của người khác, và là giáo pháp được thuyết giảng chỉ dựa trên ý định của tự thân để thiết lập giáo lý.

Parajjhāsayapucchāvasikānaṃ pana paresaṃ ajjhāsayapucchānaṃ desanāpavattihetubhūtānaṃ uppattiyaṃ pavattitānaṃ kathamaṭṭhuppattiyaṃ anavarodho, pucchāvasikaaṭṭhuppattikānaṃ vā parajjhāsayānurodhena pavattikānaṃ kathaṃ parajjhāsaye anavarodhoti?

But for "others' inclination" and "dependent on a question," which arise from the arising of others' inclinations and questions that are the cause for the teaching's occurrence, how can there be no inclusion in "occasion of arising"? And for "dependent on a question" and "occasion of arising," which arise in accordance with others' inclinations, how can there be no inclusion in "others' inclination"?

Nhưng đối với Parajjhāsaya và Pucchāvasika, là những nguyên nhân cho sự thuyết giảng phát sinh từ ý định và câu hỏi của người khác, tại sao chúng không bị bao gồm trong Aṭṭhuppatti? Hoặc đối với Pucchāvasika và Aṭṭhuppattika, là những giáo pháp phát sinh theo ý định của người khác, tại sao chúng không bị bao gồm trong Parajjhāsaya?

Na codetabbametaṃ.

This should not be questioned.

Không nên chất vấn điều này.

Paresañhi abhinīhāraparipucchādivinimuttasseva suttadesanākāraṇuppādassa aṭṭhuppattibhāvena gahitattā parajjhāsayapucchāvasikānaṃ visuṃ gahaṇaṃ.

For the distinct understanding of "others' inclination" and "dependent on a question" is due to an occasion of arising being taken as the cause for a discourse teaching that is solely free from others' aspirations, questions, and so forth.

Vì sự phát sinh của nguyên nhân thuyết giảng kinh điển mà không có sự thỉnh cầu hay câu hỏi của người khác được coi là Aṭṭhuppatti, nên Parajjhāsaya và Pucchāvasika được xem xét riêng.

Tathā hi brahmajāla (dī. ni. 1.1) dhammadāyādasuttādīnaṃ (ma. ni. 1.29) vaṇṇāvaṇṇaāmisuppādādidesanānimittaṃ ‘‘aṭṭhuppattī’’ti vuccati.

Thus, the cause for teaching, such as praise, blame, or the arising of requisites, for the Brahmajāla Sutta (D.I, 1.1) and Dhammadāyāda Sutta (M.I, 1.29) and so on, is called "occasion of arising."

Chẳng hạn, nguyên nhân của giáo pháp như khen ngợi, chê bai, sự phát sinh của các vật phẩm, v.v., trong các kinh như Brahmajāla (Dī. Ni. 1.1) và Dhammadāyāda Sutta (Ma. Ni. 1.29) được gọi là “Aṭṭhuppatti”.

Paresaṃ pucchaṃ vinā ajjhāsayaṃ eva nimittaṃ katvā desito parajjhāsayo, pucchāvasena desito pucchāvasikoti pākaṭoyamatthoti.

"Others' inclination" is taught making solely the inclination of others the cause, without their question; "dependent on a question" is taught by way of a question—this meaning is clear.

Parajjhāsaya là giáo pháp được thuyết giảng dựa trên ý định của người khác mà không có câu hỏi; Pucchāvasika là giáo pháp được thuyết giảng dựa trên câu hỏi. Ý nghĩa này đã rõ ràng.

184

Attano ajjhāsayeneva kathesi dhammatantiṭhapanatthanti daṭṭhabbaṃ.

He taught solely by his own inclination for the purpose of establishing the Dhamma tradition—this should be understood.

Attano ajjhāsayeneva kathesi dhammatantiṭhapanatthanti: nên hiểu là đã thuyết giảng chỉ bằng ý định của tự thân để thiết lập giáo lý.

Sammappadhānasuttantahārakoti anupubbena nikkhittānaṃ saṃyuttake sammappadhānapaṭisaṃyuttānaṃ suttānaṃ āvaḷi.

Sammappadhānasuttantahārako means the sequence of suttas relating to the Right Exertions (sammappadhāna) arranged in the Saṃyutta Nikāya.

Sammappadhānasuttantahārakoti: là chuỗi các kinh liên quan đến Chánh cần được đặt ra theo thứ tự trong Tương Ưng Bộ.

Tathā iddhipādahārakādayo.

Similarly for iddhipādahārakā (sequence of suttas on the Bases of Spiritual Power) and so on.

Cũng vậy, iddhipādahārakādayo (chuỗi các kinh liên quan đến Tứ thần túc), v.v.

185

Vimuttiparipācanīyā dhammā saddhindriyādayo.

Vimuttiparipācanīyā dhammā are qualities that ripen for liberation, such as the faculty of faith.

Vimuttiparipācanīyā dhammā: các pháp làm chín muồi sự giải thoát, như Tín căn, v.v.

Ajjhāsayanti adhimuttiṃ.

Ajjhāsaya means strong inclination.

Ajjhāsayanti: sự quyết định, ý định.

Khantinti diṭṭhinijjhānakkhantiṃ.

Khanti means the patience of seeing and contemplating.

Khantinti: sự chấp nhận quan điểm, sự nhẫn nại.

Mananti cittaṃ.

Mana means mind (citta).

Mananti: tâm.

Abhinihāranti paṇidhānaṃ.

Abhinihāra means aspiration or resolve.

Abhinihāranti: sự phát nguyện, sự ước muốn.

Bujjhanabhāvanti bujjhanasabhāvaṃ, paṭivijjhanākāraṃ vā.

Bujjhanabhāva means the state of understanding, or the mode of penetration.

Bujjhanabhāvanti: trạng thái giác ngộ, hoặc cách thức thấu hiểu.

186

Uppanne māne nikkhittanti sambandho.

"Nikkhittaṃ" (presented) is connected with "uppanne māne" (when conceit arises).

Uppanne māne nikkhittanti: có liên hệ đến việc được đặt ra khi kiêu mạn phát sinh.

Itthiliṅgādīni tīṇi liṅgāni.

The three genders are masculine, feminine, and neuter.

Tīṇi liṅgāni: ba giống, như giống cái, v.v.

Nāmādīni cattāri padāni.

The four kinds of words are noun, verb, particle, and indeclinable.

Cattāri padāni: bốn loại từ, như danh từ, v.v.

Paṭhamādayo satta vibhattiyo.

The seven cases are nominative, accusative, and so forth.

Satta vibhattiyo: bảy biến cách, như biến cách thứ nhất, v.v.

Muñcitvā na kiñci katheti sabhāvaniruttiyā tatheva pavattanato.

He says nothing abandoning because it occurs in its natural idiom just as it is.

Muñcitvā na kiñci katheti: không nói gì khác ngoài, vì nó diễn ra đúng như vậy trong ngôn ngữ tự nhiên.

Gaṇṭhibhūtaṃ padaṃ.

A word that is a "knot."

Gaṇṭhibhūtaṃ padaṃ: từ khó hiểu (nút thắt).

Yathā hi rukkhassa gaṇṭhiṭṭhānaṃ dubbinibbedhaṃ duttacchitañca hoti, evamevaṃ yaṃ padaṃ atthato vivarituṃ na sakkā, taṃ ‘‘gaṇṭhipada’’nti vuccati.

Just as the knotty part of a tree is difficult to penetrate and difficult to cut, similarly, a word whose meaning cannot be uncovered is called a "knotty word."

Cũng như vị trí nút thắt của cây khó xuyên thủng và khó chặt, thì cũng vậy, từ nào khó giải thích về ý nghĩa được gọi là “gaṇṭhipada” (từ nút thắt).

Anupahaccāti anuddharitvā.

Anupahaccā means without removing.

Anupahaccāti: không làm hại, không phá hoại.

187

Yena yena sambandhaṃ gacchati, tassa tassa anavasesataṃ dīpetīti iminā imassa sabba-saddassa sappadesataṃ dasseti.

It indicates the unexclusiveness of whatever it is connected with; by this, it shows the partial nature of this word "sabba" (all).

Yena yena sambandhaṃ gacchati, tassa tassa anavasesataṃ dīpetīti: bằng cách này, nó chỉ ra tính toàn bộ của từ “sabba” (tất cả) khi nó liên hệ đến từng cái.

Sabba-saddo hi sabbasabbaṃ padesasabbaṃ āyatanasabbaṃ sakkāyasabbanti catūsu visayesu diṭṭhappayogo.

Indeed, the word "sabba" has seen usage in four contexts: the all-encompassing all, the partial all, the sense-sphere all, and the personal-existence all.

Từ “sabba” được sử dụng trong bốn lĩnh vực: sabbasabbaṃ (tất cả của tất cả), padesasabbaṃ (tất cả của một phần), āyatanasabbaṃ (tất cả của xứ), sakkāyasabbaṃ (tất cả của thân kiến).

Tathā hesa ‘‘sabbe dhammā sabbākārena buddhassa bhagavato ñāṇamukhe āpāthamāgacchantī’’tiādīsu (mahāni. 156; cūḷani. 85; paṭi. ma. 3.6) sabbasabbasmiṃ āgato.

Thus, it appears in "all dhammas enter the Buddha, the Blessed One's, field of knowledge in every aspect" (Mhāniddesa 156; Cūḷaniddesa 85; Paṭisambhidāmagga 3.6) for the all-encompassing all.

Chẳng hạn, nó xuất hiện trong “sabbe dhammā sabbākārena buddhassa bhagavato ñāṇamukhe āpāthamāgacchantī” (tất cả các pháp, bằng mọi cách, đều đi vào cửa trí tuệ của Đức Phật, Đức Thế Tôn) (Mahāni. 156; Cūḷani. 85; Paṭi. Ma. 3.6) trong ý nghĩa sabbasabbaṃ.

‘‘Sabbesaṃ vo, sāriputta, subhāsitaṃ pariyāyenā’’tiādīsu (ma. ni. 1.345) padesasabbasmiṃ.

In "All of your good words, Sāriputta, are by way of explanation" (M.I, 1.345) for the partial all.

Trong “Sabbesaṃ vo, Sāriputta, subhāsitaṃ pariyāyenā” (Này Xá-lợi-phất, lời nói tốt đẹp của tất cả các ông, theo cách thức đã được nói) (Ma. Ni. 1.345) trong ý nghĩa padesasabbaṃ.

‘‘Sabbaṃ vo, bhikkhave, desessāmi…pe… cakkhuñceva rūpā ca…pe… mano ceva dhammā cā’’ti (saṃ. ni. 4.23) ettha āyatanasabbasmiṃ.

In "I shall teach you, O bhikkhus, all...pe...the eye and forms...pe...the mind and mental phenomena" (Saṃ. Ni. 4.23), it refers to the all of the sense bases (āyatana).

"Này các Tỳ-khưu, Ta sẽ thuyết giảng về tất cả... (v.v.) ...nhãn và sắc... (v.v.) ...ý và pháp" (Tương Ưng Bộ 4.23) là nói về tất cả các xứ (āyatana).

‘‘Sabbaṃ sabbato sañjānātī’’tiādīsu (ma. ni. 1.5) sakkāyasabbasmiṃ.

In "He perceives all from all" and so on (Ma. Ni. 1.5), it refers to the all of the existing body (sakkāya).

Trong các câu như "Nhận biết tất cả từ mọi phương diện" (Trung Bộ 1.5) là nói về tất cả trong thân kiến (sakkāya).

Tattha sabbasabbasmiṃ āgato nippadeso, itaresu tīsupi āgato sappadeso, idha pana sakkāyasabbasmiṃ veditabbo.

There, the term "sabba" (all) in "sabbasabbasmiṃ" (in all of all) is without specific reference, while in the other three, it has specific reference. Here, however, it should be understood as referring to the all of the existing body (sakkāya).

Trong đó, phần được đề cập đến trong tất cả mọi phương diện (sabbasabba) là không có giải thích chi tiết (nippadesa), còn trong ba trường hợp khác thì có giải thích chi tiết (sappadesa). Ở đây, cần hiểu là nói về tất cả trong thân kiến (sakkāya).

Tathā hi vakkhati ‘‘sakkāyapariyāpannā pana tebhūmakadhammāva anavasesato veditabbā’’ti (ma. ni. aṭṭha. 1.1 suttanikkhepavaṇṇanā).

Thus, it will be said, "However, the three-realm phenomena included within the existing body should be understood without remainder" (Ma. Ni. Aṭṭha. 1.1, Suttanikkhepavaṇṇanā).

Quả vậy, Ngài sẽ nói rằng: "Tuy nhiên, cần phải hiểu rằng tất cả các pháp thuộc ba cõi (tebhūmaka) đều nằm trong phạm vi của thân kiến (sakkāya) mà không bỏ sót điều gì" (Chú giải Trung Bộ 1.1, phần giải thích tóm tắt kinh).

188

Saccesūti ariyasaccesu.

In the truths (saccesu) means in the Noble Truths.

Saccesu (trong các sự thật) là trong các Thánh đế (ariyasacca).

Ete caturo dhammāti idāni vuccamāne saccādike cattāro dhamme sandhāya vadati.

These four qualities (ete caturo dhammā) refers to the four qualities, such as truth, which are now being mentioned.

Ete caturo dhammā (bốn pháp này) là chỉ bốn pháp được nói đến bây giờ, như sự thật (sacca) v.v.

Tattha saccanti vacīsaccaṃ.

There, truth (saccaṃ) means truthful speech.

Trong đó, sacca (sự thật) là lời nói chân thật (vacīsacca).

Ṭhitīti vīriyaṃ, ‘‘dhitī’’ti vā pāṭho, so evattho.

Steadfastness (ṭhitī) means energy (vīriya), or the reading is "dhitī," which has the same meaning.

Ṭhitī (sự kiên định) là tinh tấn (vīriya), hoặc cũng có thể là dhitī, ý nghĩa vẫn vậy.

Cāgoti alobho.

Renunciation (cāgo) means non-greed (alobha).

Cāgo (sự xả bỏ) là vô tham (alobha).

Diṭṭhaṃ so ativattatīti yasmiṃ ete saccādayo dhammā upalabbhanti, so diṭṭhaṃ attano amittaṃ atikkamati, na tassa hatthataṃ gacchati, atha kho naṃ abhibhavati evāti attho.

He overcomes what is seen (diṭṭhaṃ so ativattatī) means that in whom these qualities such as truth are found, he overcomes what is seen, his enemy; he does not fall into its power, but rather, he conquers it, is the meaning.

Diṭṭhaṃ so ativattatī (người ấy vượt qua điều đã thấy) có nghĩa là người nào có các pháp như sự thật (sacca) v.v. ấy hiện hữu, người ấy vượt qua kẻ thù của mình đã thấy, không rơi vào tay kẻ ấy, mà còn chế ngự kẻ ấy.

Sabhāve vattati asabhāvadhammassa kāraṇāsambhavato.

He abides in his own nature (sabhāve vattati) because there is no possibility of a cause for a phenomenon contrary to its nature.

Sabhāve vattati (tồn tại trong tự tính) vì không thể có nguyên nhân cho pháp không có tự tính (asabhāvadhammassa kāraṇāsambhavato).

Na hi nissabhāvā dhammā kenaci nibbattīyanti.

Indeed, phenomena without inherent nature are not produced by anyone.

Quả thật, các pháp không có tự tính không thể được tạo ra bởi bất cứ ai.

Attano lakkhaṇaṃ dhārentīti yadipi lakkhaṇavinimuttā dhammā nāma natthi, tathāpi yathā diṭṭhitaṇhāparikappitākāramattā attasubhasukhasassatādayo, pakatiyādayo, dabbādayo, jīvādayo, kāyādayo lokavohāramattasiddhā gagaṇakusumādayova saccikaṭṭhaparamatthato na upalabbhanti, na evamete, ete pana saccikaṭṭhaparamatthabhūtā upalabbhanti, tato eva sattādivisesavirahato dhammamattā sabhāvavantoti dassanatthaṃ ‘‘attano lakkhaṇaṃ dhārentī’’ti vuttaṃ.

Bearing their own characteristics: Although there are no phenomena devoid of characteristics, just as notions such as self, beauty, happiness, permanence, nature, substance, living beings, and bodies—which are merely established by worldly convention, like flowers in the sky—are not found in the ultimate sense of reality, these phenomena are not like that. These, however, are found as ultimate realities. Therefore, to show that they are merely phenomena possessing inherent nature, free from distinctions like 'being', it is said, "bearing their own characteristics."

Attano lakkhaṇaṃ dhārentī (mang giữ tự tướng của chính mình): Mặc dù không có pháp nào không có tướng (lakkhaṇa), nhưng giống như những gì chỉ là hình thức được tưởng tượng bởi tà kiến và ái dục, như ngã, tịnh, lạc, thường hằng v.v., các yếu tố như bản chất (pakati), vật chất (dabba), sinh linh (jīva), thân thể (kāya) v.v., chỉ tồn tại theo quy ước thế gian, hoặc như hoa trên trời, không thực sự được tìm thấy theo nghĩa tối thượng (paramattha). Các pháp này thì không như vậy, chúng được tìm thấy như là những thực tại tối thượng (saccikaṭṭhaparamattha). Chính vì thế, để chỉ ra rằng chúng chỉ là các pháp (dhamma) có tự tính (sabhāva) do không có sự khác biệt như chúng sinh (satta) v.v., nên đã nói "mang giữ tự tướng của chính mình".

Bhavati hi bhedābhāvepi sukhāvabodhanatthaṃ upacāramattasiddhena bhedena niddeso yathā ‘‘silāputtakassa sarīra’’nti.

Indeed, even in the absence of distinction, for the sake of easy understanding, a designation is made with a distinction established by mere convention, just as in 'the body of a stone statue'.

Quả thật, ngay cả khi không có sự phân biệt, để dễ hiểu, người ta vẫn dùng cách gọi mang tính quy ước để chỉ sự phân biệt, như "thân thể của con trai tảng đá" (silāputtakassa sarīra).

Dhārīyanti vā yathāsabhāvato avadhārīyanti ñāyantīti dhammā, kakkhaḷaphusanādayo.

Or, they are borne, or understood according to their inherent nature, or known; thus, phenomena (dhammā) are such things as hardness and contact.

Hoặc dhammā (các pháp) là những gì được mang giữ (dhārīyanti), tức là được xác định, được biết theo đúng tự tính của chúng, như sự xúc chạm thô cứng v.v.

189

Asādhāraṇahetumhīti asādhāraṇakāraṇe, sakkāyadhammesu tassa tassa āveṇikapaccayeti attho.

From an uncommon cause (asādhāraṇahetumhi): meaning from an uncommon condition, specifically the unique factors for each of the phenomena of the existing body (sakkāya).

Asādhāraṇahetumhi (trong nguyên nhân không chung): Trong nguyên nhân đặc biệt (asādhāraṇakāraṇa), tức là các điều kiện đặc thù (āveṇikapaccaya) của từng pháp trong các pháp thuộc thân kiến (sakkāyadhamma).

Kiṃ pana tanti?

What, then, is that?

Vậy đó là gì?

Taṇhāmānadiṭṭhiyo, avijjādayopi vā.

Craving, conceit, and views, or even ignorance and so forth.

Là ái (taṇhā), mạn (māna), kiến (diṭṭhi), hoặc cũng có thể là vô minh (avijjā) v.v.

Yatheva hi pathavīādīsu maññanāvatthūsu uppajjamānā taṇhādayo maññanā tesaṃ pavattiyā mūlakāraṇaṃ, evaṃ avijjādayopi.

Just as craving and so forth, arising in the objects of conceiving like earth and so on, are the root cause for the occurrence of those conceivings, so too are ignorance and so forth.

Cũng như ái dục v.v. phát sinh trong các đối tượng tưởng tượng như đất v.v. là nguyên nhân gốc rễ cho sự tồn tại của chúng, vô minh v.v. cũng vậy.

Tathā hi ‘‘assutavā puthujjano’’tiādinā ‘‘apariññātaṃ tassāti vadāmī’’ti (ma. ni. 1.2) ‘‘nandī dukkhassa mūla’’nti (ma. ni. 1.13) ca anvayato, ‘‘khayā rāgassa…pe… vītamohattā’’ti byatirekato ca tesaṃ mūlakāraṇabhāvo vibhāvito.

Thus, by way of affirmation, through phrases like "the untaught ordinary person" (assutavā puthujjano) and "I say that it is not fully understood by him" and "delight is the root of suffering," and by way of negation, through "with the destruction of lust... with the removal of delusion," their nature as root causes is made clear.

Quả vậy, nguyên nhân gốc rễ của chúng đã được làm rõ bằng cách giải thích theo chiều thuận (anvaya) qua các câu như "Phàm phu không được nghe" (Trung Bộ 1.2) cho đến "Ta nói rằng điều đó đối với người ấy là chưa được hiểu biết" và "Hỷ là gốc rễ của khổ" (Trung Bộ 1.13), và theo chiều nghịch (byatireka) qua các câu như "Do ái diệt... (v.v.) ...do vô minh diệt".

190

Pariyāyeti desetabbamatthaṃ avagameti bodhayatīti pariyāyo, desanā.

It makes one understand or comprehend the meaning to be taught; thus, pariyāya means teaching.

Pariyāya (phương pháp) là cái làm cho hiểu được, làm cho giác ngộ được ý nghĩa cần thuyết giảng, tức là lời thuyết giảng (desanā).

Pariyāyati attano phalaṃ pariggahetvā vattati tassa vā kāraṇabhāvaṃ gacchatīti pariyāyo, kāraṇaṃ.

It encompasses its own fruit and proceeds, or it becomes the cause of that; thus, pariyāya means cause.

Pariyāya (nguyên nhân) là cái nắm giữ kết quả của chính nó và tồn tại, hoặc trở thành nguyên nhân của kết quả đó, tức là nguyên nhân (kāraṇa).

Pariyāyati aparāparaṃ parivattatīti pariyāyo, vāro.

It revolves repeatedly; thus, pariyāya means turn or occasion.

Pariyāya (lượt) là cái lặp đi lặp lại, tức là lượt (vāra).

Evaṃ pariyāyasaddassa desanākāraṇavāresu pavatti veditabbā.

Thus, the application of the word pariyāya in the sense of teaching, cause, and turn should be understood.

Như vậy, cần hiểu sự vận dụng của từ pariyāya trong các nghĩa thuyết giảng, nguyên nhân và lượt.

Yathārutavasena aggahetvā niddhāretvā gahetabbatthaṃ neyyatthaṃ.

The meaning to be taken by determining it, not by taking it according to its literal sound, is neyyattha (interpretable meaning).

Neyyatthaṃ (nghĩa cần dẫn giải) là ý nghĩa cần được nắm bắt sau khi đã xác định, không phải nắm bắt theo nghĩa đen.

Tebhūmakā dhammāva anavasesato veditabbā maññanāvatthubhūtānaṃ sabbesaṃ pathavīādidhammānaṃ adhippetattā.

All phenomena of the three realms are to be fully understood, since all phenomena such as earth and so forth, which are objects of conceiving, are intended.

Tất cả các pháp thuộc ba cõi đều phải được hiểu không sót một điều gì vì tất cả các pháp như đất v.v. là đối tượng của sự tưởng tượng đều được bao hàm.

191

Kāraṇadesananti kāraṇañāpanaṃ desanaṃ.

Kāraṇadesana means the teaching that makes known the cause.

Kāraṇadesanaṃ (sự thuyết giảng về nguyên nhân) là sự thuyết giảng làm sáng tỏ nguyên nhân.

Taṃ atthanti taṃ sabbadhammānaṃ mūlakāraṇasaṅkhātaṃ, kāraṇadesanāsaṅkhātaṃ vā atthaṃ.

That meaning (taṃ atthaṃ): that meaning which is called the root cause of all phenomena, or which is called the teaching of the cause.

Taṃ atthaṃ (ý nghĩa đó) là ý nghĩa được gọi là nguyên nhân gốc rễ của tất cả các pháp, hoặc ý nghĩa được gọi là sự thuyết giảng về nguyên nhân.

Tenevāha ‘‘taṃ kāraṇaṃ taṃ desana’’nti.

Therefore, he said, "that cause, that teaching."

Chính vì thế mà nói "Đó là nguyên nhân, đó là sự thuyết giảng".

Ekatthametanti etaṃ padadvayaṃ ekatthaṃ.

This is one meaning: these two words have one meaning.

Ekatthametaṃ (hai từ này cùng một nghĩa) là hai từ này cùng một ý nghĩa.

Sādhu-saddo eva hi ka-kārena vaḍḍhetvā ‘‘sādhuka’’nti vutto.

Indeed, the word sādhu is simply said as "sādhuka" by adding the letter 'ka'.

Quả thật, từ sādhuka được nói ra bằng cách thêm âm ka vào từ sādhu.

Teneva hi sādhusaddassa atthaṃ vadantena atthuddhāravasena sādhukasaddo udāhaṭo.

Therefore, in explaining the meaning of the word sādhu, the word sādhuka is cited by way of extracting the meaning.

Chính vì thế, khi nói về ý nghĩa của từ sādhu, từ sādhuka đã được dẫn chứng theo cách làm rõ ý nghĩa.

Dhammarucīti puññakāmo.

Dhammarucī means one who desires merit.

Dhammarucī (người yêu thích Pháp) là người mong muốn công đức.

Paññāṇavāti paññavā.

Paññāṇavā means endowed with wisdom.

Paññāṇavā (người có trí tuệ) là người có trí tuệ (paññavā).

Addubbhoti adūsako, anupaghātakoti attho.

Addubbho means not harming, not destroying.

Addubbho (không làm hại) là không làm tổn thương, không phá hoại.

Idhāpīti imasmiṃ mūlapariyāyasuttepi.

Here too: in this Mūlapariyāya Sutta.

Idhāpi (cũng ở đây) là trong kinh Mūlapariyāya này.

Ayanti sādhukasaddo.

This (ayaṃ) refers to the word sādhuka.

Ayaṃ (cái này) là từ sādhuka.

Ettheva daḷhīkammeti sakkaccakiriyāyaṃ.

Herein, in strengthening the action: in doing it carefully.

Ettheva daḷhīkamme (chính trong sự kiên cố này) là trong sự thực hành cẩn trọng (sakkaccakiriyā).

Āṇattiyanti āṇāpane.

In commanding (āṇattiyaṃ): in giving orders.

Āṇattiyaṃ (trong sự ra lệnh) là trong sự sai bảo.

‘‘Suṇātha sādhukaṃ manasi karothā’’ti hi vutte sādhukasaddena savanamanasikārānaṃ sakkaccakiriyā viya tadāṇāpanampi vuttaṃ hoti.

Indeed, when it is said, "Listen carefully, pay attention," by the word sādhuka, just as the careful performance of listening and attention is expressed, so too is the command for them.

Quả thật, khi nói "Hãy lắng nghe và chú ý kỹ lưỡng (sādhukaṃ manasi karotha)", thì từ sādhuka cũng hàm ý sự ra lệnh đó, giống như sự thực hành cẩn trọng trong việc lắng nghe và chú ý.

Āyācanatthatā viya cassa āṇāpanatthatā veditabbā.

Its meaning of commanding should be understood like its meaning of entreating.

Cần hiểu rằng ý nghĩa ra lệnh của nó cũng giống như ý nghĩa cầu xin.

192

Idānettha evaṃ yojanā veditabbāti sambandho.

Now, the connection is: "Herein, such an interpretation should be understood."

Bây giờ, cần hiểu sự kết nối như sau.

Sotindriyavikkhepavāraṇaṃ savane niyojanavasena kiriyantarapaṭisedhanabhāvato, sotaṃ odahathāti attho.

Prevention of distraction of the ear faculty (sotindriyavikkhepavāraṇaṃ) means "apply your ear," as it prevents other actions by enjoining listening.

Sự ngăn chặn sự phân tán của thính giác (sotindriyavikkhepavāraṇaṃ) là việc đặt tai vào nghe, do có tính chất ngăn cản các hành động khác bằng cách ra lệnh lắng nghe.

Manindriyavikkhepanivāraṇaṃ aññacintāpaṭisedhanato.

Prevention of distraction of the mind faculty (manindriyavikkhepanivāraṇaṃ) by preventing other thoughts.

Sự ngăn chặn sự phân tán của ý giác (manindriyavikkhepanivāraṇaṃ) là do ngăn cản các ý nghĩ khác.

Purimanti ‘‘suṇāthā’’ti padaṃ.

The former (purimaṃ) is the word "suṇātha" (listen).

Purimaṃ (từ trước) là từ "suṇātha" (hãy lắng nghe).

Etthāti suṇātha, manasi karothā’’ti padadvaye, etasmiṃ vā adhikāre.

Herein (etthā): in the two words "suṇātha, manasi karotha" (listen, pay attention), or in this context.

Ettha (ở đây) là trong hai từ "suṇātha, manasi karotha" (hãy lắng nghe, hãy chú ý), hoặc trong ngữ cảnh này.

Byañjanavipallāsaggāhavāraṇaṃ sotadvāre vikkhepapaṭibāhakattā.

Prevention of grasping distorted expressions (byañjanavipallāsaggāhavāraṇaṃ) because it obstructs distraction at the ear-door.

Sự ngăn chặn việc nắm bắt sai lệch về từ ngữ (byañjanavipallāsaggāhavāraṇaṃ) là do ngăn chặn sự phân tán ở cửa tai.

Na hi yāthāvato suṇantassa saddato vipallāsaggāho hoti.

Indeed, for one who listens properly, there is no grasping of distorted sounds.

Quả thật, đối với người lắng nghe đúng đắn, không có sự nắm bắt sai lệch về từ ngữ.

Atthavipallāsaggāhavāraṇaṃ manindriyavikkhepapaṭibāhakattā.

Prevention of grasping distorted meanings (atthavipallāsaggāhavāraṇaṃ) because it obstructs distraction of the mind faculty.

Sự ngăn chặn việc nắm bắt sai lệch về ý nghĩa (atthavipallāsaggāhavāraṇaṃ) là do ngăn chặn sự phân tán của ý giác.

Na hi sakkaccaṃ dhammaṃ upadhārentassa atthato vipallāsaggāho hoti.

Indeed, for one who carefully comprehends the Dhamma, there is no grasping of distorted meanings.

Quả thật, đối với người cẩn trọng quán sát Pháp, không có sự nắm bắt sai lệch về ý nghĩa.

Dhammassavane niyojeti suṇāthāti vidahanato.

Engages in listening to the Dhamma means by instructing, "Listen."

Niyojeti dhammassavane (sai bảo trong việc lắng nghe Pháp) là do ra lệnh "suṇātha" (hãy lắng nghe).

Dhāraṇūpaparikkhāsūti upaparikkhaggahaṇena tulanatīraṇādike diṭṭhiyā ca suppaṭivedhaṃ saṅgaṇhāti.

In retention and examination it includes perfect penetration by means of grasping through examination, weighing, discerning, and also by right view.

Dhāraṇūpaparikkhāsu (trong việc ghi nhớ và quán sát) là bao gồm sự quán sát đúng đắn (suppaṭivedha) bằng tuệ (diṭṭhi) trong việc cân nhắc, suy xét v.v. thông qua việc nắm bắt và quán sát.

193

Sabyañjanoti ettha yathādhippetamatthaṃ byañjayatīti byañjanaṃ, sabhāvanirutti.

Here, regarding sabyañjana, that which manifests the intended meaning is byañjana, a natural expression.

Sabyañjano (có từ ngữ) ở đây, byañjanaṃ (từ ngữ) là cái biểu thị ý nghĩa mong muốn, tức là cách diễn đạt tự nhiên (sabhāvanirutti).

Saha byañjanenāti sabyañjano, byañjanasampannoti attho.

"With byañjana" means sabyañjana; the meaning is "endowed with expression."

Saha byañjanenāti sabyañjano (cùng với từ ngữ là có từ ngữ), tức là đầy đủ từ ngữ (byañjanasampanna).

Araṇīyato upagandhabbato anuṭṭhātabbato attho, catupārisuddhisīlādiko.

The meaning of attha is that which is to be approached, to be attained, to be undertaken; it refers to the fourfold purity of virtue, etc.

Attho (ý nghĩa) là cái cần được thực hành (araṇīyato), cần được tiếp cận (upagandhabbato), cần được khởi lên (anuṭṭhātabbato), tức là giới Tứ thanh tịnh (catupārisuddhisīla) v.v.

Saha atthenāti sāttho, atthasampannoti attho.

"With meaning" means sāttha; the meaning is "endowed with meaning."

Saha atthenāti sāttho (cùng với ý nghĩa là có ý nghĩa), tức là đầy đủ ý nghĩa (atthasampanna).

Dhammagambhīrotiādīsu dhammo nāma tanti.

In phrases like profound in Dhamma, Dhamma refers to the textual tradition.

Trong Dhammagambhīro (Pháp sâu xa) v.v., dhammo (Pháp) là kinh điển (tanti).

Desanā nāma tassā manasā vavatthāpitāya tantiyā desanā.

Teaching refers to the teaching of that textual tradition, which has been mentally established.

Desanā (sự thuyết giảng) là sự thuyết giảng kinh điển đã được sắp đặt trong tâm.

Attho nāma tantiyā attho.

Meaning refers to the meaning of the textual tradition.

Attho (ý nghĩa) là ý nghĩa của kinh điển.

Paṭivedho nāma tantiyā tantiatthassa ca yathābhūtāvabodho.

Penetration refers to the true understanding of the textual tradition and its meaning.

Paṭivedho (sự thể nhập) là sự giác ngộ đúng như thật về kinh điển và ý nghĩa của kinh điển.

Yasmā cete dhammadesanāatthapaṭivedhā sasādīhi viya mahāsamuddo mandabuddhīhi dukkhogāḷhā alabbhaneyyapatiṭṭhā ca, tasmā gambhīrā.

And because these Dhamma, teaching, meaning, and penetration are difficult to fathom by those of dull intellect, like a great ocean by deer, and have no attainable footing, they are profound.

Và vì các pháp, sự thuyết giảng, ý nghĩa và sự thể nhập này, giống như đại dương đối với các loài bò sát, rất khó lặn sâu (dukkhogāḷhā) và không thể tìm thấy chỗ đứng (alabbhaneyyapatiṭṭhā) đối với những người trí tuệ kém cỏi, nên chúng sâu xa (gambhīrā).

Tena vuttaṃ ‘‘yasmā ayaṃ dhammo…pe… sādhukaṃ manasi karothā’’ti.

Therefore, it is said: "Because this Dhamma... (etc.)... pay close attention."

Vì thế mà nói "Vì Pháp này... (v.v.) ...hãy chú ý kỹ lưỡng".

Ettha ca paṭivedhassa dukkarabhāvato dhammatthānaṃ desanāñāṇassa dukkarabhāvato desanāya dukkhogāhatā, paṭivedhassa pana uppādetuṃ asakkuṇeyyattā tabbisayañāṇuppattiyā ca dukkarabhāvato dukkhogāhatā veditabbā.

Here, the difficulty of penetration makes the Dhamma and its meaning difficult to fathom, and the difficulty of the knowledge of teaching makes the teaching difficult to fathom; the difficulty of producing penetration and the difficulty of the arising of knowledge concerning it should be understood as making it difficult to fathom.

Ở đây, cần hiểu rằng sự thuyết giảng khó lặn sâu là do sự khó khăn trong việc thể nhập (paṭivedha) và sự khó khăn trong việc có được trí tuệ về ý nghĩa của Pháp. Còn sự thể nhập khó lặn sâu là do không thể tạo ra nó và do sự khó khăn trong việc phát sinh trí tuệ liên quan đến nó.

194

Desanaṃ nāma uddisanaṃ.

Teaching refers to indicating.

Desanaṃ (sự thuyết giảng) là sự trình bày.

Tassa niddisanaṃ bhāsananti idhādhippetanti āha ‘‘vitthāratopi naṃ bhāsissāmīti vuttaṃ hotī’’ti.

Its detailed explanation is speaking; this is what is intended here, so it is said: "It means, 'I shall speak of it in detail as well.'"

Sự giải thích, trình bày điều đó được hàm ý ở đây, nên nói "có nghĩa là sẽ thuyết giảng rộng rãi".

Paribyattaṃ kathanaṃ vā bhāsanaṃ.

Or, speaking is a detailed narration.

Việc nói hoặc diễn thuyết một cách khéo léo.

Sāḷikāyiva nigghosoti sāḷikāya ālāpo viya madhuro kaṇṇasukho pemanīyo.

Like the cry of a mynah bird means sweet, pleasant to the ear, and endearing, like the speech of a mynah bird.

Tiếng hót như chim sáo nghĩa là êm dịu, dễ nghe, đáng yêu như tiếng hót của chim sáo.

Paṭibhānanti saddo.

Paṭibhāna is a sound.

Paṭibhāna (biện tài) nghĩa là lời nói.

Udīrayīti uccārīyati, vuccati vā.

He uttered means he pronounced, or he spoke.

Udīrayī (nói ra) nghĩa là được nói ra, hoặc được tuyên bố.

195

Evaṃ vutte ussāhajātāti evaṃ ‘‘suṇātha sādhukaṃ manasi karotha bhāsissāmī’’ti vutte na kira satthā saṅkhepeneva desessati, vitthārenapi bhāsissatīti sañjātussāhā haṭṭhatuṭṭhā hutvā.

Thus spoken, filled with enthusiasm means, when it was thus said, "Listen, pay close attention, I shall speak," they became enthusiastic and delighted, thinking, "Indeed, the Teacher will not teach in brief, but will speak in detail."

Khi được nói như vậy, họ phát khởi sự hăng hái nghĩa là khi được nói như vậy: “Hãy lắng nghe kỹ, hãy chú tâm, tôi sẽ thuyết giảng,” thì họ nghĩ rằng vị Đạo Sư sẽ không chỉ thuyết giảng một cách tóm tắt, mà còn thuyết giảng một cách chi tiết, do đó họ phát khởi sự hăng hái, hoan hỷ.

Idhāti iminā vuccamānaadhikaraṇaṃ tassa puggalassa uppattiṭṭhānabhūtaṃ adhippetanti āha ‘‘desāpadese nipāto’’ti.

Here refers to the place being spoken of, the place of that person's arising; thus, it is said: "A particle indicating place or region."

Idha (ở đây) nghĩa là địa điểm được đề cập bởi từ này, là nơi sinh ra của người đó, được hiểu là như vậy, nên nói “là một giới từ chỉ nơi chốn”.

Lokanti okāsalokaṃ.

World refers to the spatial world.

Loka (thế gian) nghĩa là thế giới không gian.

Idha tathāgato loketi hi jātikhettaṃ, tatthāpi ayaṃ cakkavāḷo adhippeto.

Here, the Tathāgata in the world refers to the field of birth, and within that, this cakkavāḷa (world-system) is intended.

Ở đây, vị Như Lai trong thế gian nghĩa là trường sở sinh, và ở đó, vũ trụ này được hiểu là như vậy.

Samaṇoti sotāpanno.

A recluse is a sotāpanna.

Samaṇa (sa-môn) nghĩa là bậc Dự Lưu.

Dutiyo samaṇoti sakadāgāmī.

A second recluse is a sakadāgāmī.

Dutiyo samaṇo (sa-môn thứ hai) nghĩa là bậc Nhất Lai.

Vuttañhetaṃ ‘‘katamo ca, bhikkhave, samaṇo?

For it is said: "And what, bhikkhus, is a recluse?

Điều này đã được nói: “Này các tỳ khưu, sa-môn là gì?

Idha, bhikkhave, bhikkhu tiṇṇaṃ saṃyojanānaṃ parikkhayā sotāpanno hotī’’ti (a. ni. 4.241) ‘‘katamo ca, bhikkhave, dutiyo samaṇo?

Here, bhikkhus, a bhikkhu, with the destruction of the three fetters, is a sotāpanna." And "And what, bhikkhus, is a second recluse?

Này các tỳ khưu, ở đây, một tỳ khưu do đoạn tận ba kiết sử nên trở thành bậc Dự Lưu” (A.iv.241), và “Này các tỳ khưu, sa-môn thứ hai là gì?

Idha, bhikkhave, bhikkhu tiṇṇaṃ saṃyojanānaṃ parikkhayā rāgadosamohānaṃ tanuttā sakadāgāmī hotī’’ti ca (a. ni. 4.241).

Here, bhikkhus, a bhikkhu, with the destruction of the three fetters and the attenuation of lust, hatred, and delusion, is a sakadāgāmī."

Này các tỳ khưu, ở đây, một tỳ khưu do đoạn tận ba kiết sử, do tham, sân, si giảm thiểu nên trở thành bậc Nhất Lai” (A.iv.241).

Idheva tiṭṭhamānassāti imissā eva indasālaguhāyaṃ tiṭṭhamānassa.

While standing right here means while standing in this very Indasāla Cave.

Khi đang ở đây nghĩa là khi đang ở trong hang Indasāla này.

196

2. Assutavāti ettha (a. ni. ṭī. 1.1.51) sutanti sotadvārānusārena upadhāritaṃ, upadhāraṇaṃ vā, sutaṃ assatthīti sutavā.

2. Here, regarding uninstructed, suta (instruction) refers to what is grasped through the ear-door, or the grasping itself; sutavā is one who has suta.

2. Assutavā (không có nghe) ở đây (A.ṭī.1.1.51), suta (nghe) nghĩa là điều đã được ghi nhớ qua cửa tai, hoặc sự ghi nhớ; người có nghe thì là sutavā (có nghe).

Vā-saddassa hi attho atthitāmattādivasena anekavidho.

For the meaning of the particle vā is manifold, depending on mere existence, etc.

Thật vậy, ý nghĩa của từ vā (có) có nhiều loại tùy theo ý nghĩa của sự hiện hữu, v.v.

Tathā hi ‘‘antavā ayaṃ loko parivaṭumo’’tiādīsu (dī. ni. 1.54; paṭi. ma. 1.140) atthitāmattaṃ attho.

Thus, in phrases like "This world is finite and circumscribed," mere existence is the meaning.

Thật vậy, trong các câu như “Thế gian này có giới hạn và bị bao quanh” (D.i.54; Paṭi.m.1.140), ý nghĩa là sự hiện hữu đơn thuần.

‘‘Dhanavā bhogavā, lābhī annassā’’ti ca ādīsu bahubhāvo.

In "wealthy, possessing riches, one who gains food," it means abundance.

Trong các câu như “Người có tài sản, có của cải, được lợi lộc về lương thực”, ý nghĩa là sự phong phú.

‘‘Rogavā hoti rogābhibhūto’’tiādīsu kāyābādho.

In "sick, afflicted by illness," it means bodily ailment.

Trong các câu như “Người có bệnh, bị bệnh hoạn chi phối”, ý nghĩa là bệnh tật thể xác.

‘‘Kuṭṭhī kuṭṭhacīvarenā’’tiādīsu nindā, ‘‘issukī maccharī saṭho māyāvino keṭubhino’’tiādīsu abhiṇhayogo.

In "a leper with a leper's rag," it means blame; in "envious, stingy, deceitful, cunning, fraudulent," it means constant practice.

Trong các câu như “Người bị bệnh phong với chiếc y phong” ý nghĩa là sự chê bai; trong các câu như “Người có tính ganh tỵ, keo kiệt, xảo trá, lừa dối, gian lận”, ý nghĩa là sự thường xuyên thực hành.

‘‘Daṇḍī chattī alambarī’’tiādīsu (visuddhi. 1.142) saṃsaggo.

In "one with a staff, one with an umbrella, one with a water-strainer," it means association.

Trong các câu như “Người cầm gậy, cầm dù, cầm bình bát” (Visuddhi.1.142), ý nghĩa là sự gắn bó.

‘‘Paṇḍito vāpi tena so’’tiādīsu (dha. pa. 63) upamānaṃ, sadisabhāvoti attho.

In "or he is wise by that," it means comparison, i.e., similarity.

Trong các câu như “Do đó, người ấy là bậc hiền trí” (Dhp.63), ý nghĩa là sự so sánh, tức là sự tương tự.

‘‘Taṃ vāpi dhīrā muniṃ vedayantī’’tiādīsu (su. ni. 213) samuccayo.

In "the wise proclaim him a sage," it means aggregation.

Trong các câu như “Các bậc trí tuệ biết vị ẩn sĩ đó” (Sn.213), ý nghĩa là sự tổng hợp.

‘‘Ke vā ime kassa vā’’tiādīsu (pārā. 296) saṃsayo.

In "Who are these, or whose are they?" it means doubt.

Trong các câu như “Những người này là ai, và của ai?” (Pārā.296), ý nghĩa là sự nghi ngờ.

‘‘Ayaṃ vā imesaṃ samaṇabrāhmaṇānaṃ sabbabālo sabbamūḷho’’tiādīsu (dī. ni. 1.181) vibhāvano.

In "This one, among these recluses and brahmins, is the most foolish, the most deluded," it means distinction.

Trong các câu như “Vị sa-môn, bà-la-môn này là kẻ ngu dốt nhất, kẻ ngu si nhất” (D.i.181), ý nghĩa là sự phân biệt.

‘‘Na vāyaṃ kumāro mattamaññāsī’’tiādīsu (saṃ. ni. 2.154) padapūraṇaṃ.

"This prince did not know moderation," and so on, is a filler word.

Trong các câu như “Đứa bé này không biết chừng mực” (S.ii.154), ý nghĩa là từ đệm.

‘‘Ye hi keci, bhikkhave, samaṇā vā brāhmaṇā vā’’tiādīsu (ma. ni. 1.170) vikappo.

"Whatever recluses or brahmins there are, bhikkhus," and so on, is an alternative.

Trong các câu như “Này các tỳ khưu, bất kỳ sa-môn hay bà-la-môn nào” (M.i.170), ý nghĩa là sự lựa chọn.

‘‘Sakyaputtassa sirīmato (dī. ni. 3.277), sīlavato sīlasampattiyā kalyāṇo kittisaddo abbhuggacchatī’’ti (dī. ni. 2.150; 3.316; a. ni. 5.213; mahāva. 285) ca ādīsu pasaṃsā.

"A good report arises concerning the glorious Sakyaputta, who is virtuous and endowed with virtue," and so on, is praise.

Trong các câu như “Tiếng tăm tốt đẹp của vị Sakyaputta vinh quang, có giới hạnh, với sự thành tựu giới hạnh, lan rộng” (D.iii.277, 2.150; 3.316; A.v.213; Mahāva.285), ý nghĩa là sự tán thán.

‘‘Paññavā hoti udayatthagāminiyā paññāya samannāgato ariyāya nibbedhikāya sammā dukkhakkhayagāminiyā’’tiādīsu (dī. ni. 3.317, 355) atisayo.

"He is wise, endowed with wisdom that discerns rise and fall, noble, penetrative, and leads to the complete destruction of suffering," and so on, is hyperbole.

Trong các câu như “Người có trí tuệ, được trang bị trí tuệ thấy được sự sanh diệt, trí tuệ cao thượng, thấu triệt, dẫn đến sự chấm dứt khổ đau một cách đúng đắn” (D.iii.317, 355), ý nghĩa là sự vượt trội.

Idhāpi atisayo, pasaṃsā vā attho, tasmā yassa pasaṃsitaṃ, atisayena vā sutaṃ atthi, so sutavāti saṃkilesaviddhaṃsanasamatthaṃ pariyattidhammassavanaṃ, taṃ sutvā tathattāya paṭipatti ca ‘‘sutavā’’ti iminā saddena pakāsitā.

Here too, the meaning is hyperbole or praise. Therefore, one who has heard that which is praised or excellent is called "one who has heard" (sutavā). The hearing of the Dhamma of the Pariyatti, which is capable of destroying defilements, and the practice towards that state after hearing it, are declared by the word "sutavā."

Ở đây cũng vậy, ý nghĩa là sự vượt trội, hoặc sự tán thán; do đó, người có sự nghe được tán thán hoặc sự nghe một cách vượt trội, thì gọi là sutavā (có nghe); sự nghe giáo pháp Pariyatti có khả năng phá hủy phiền não, và sự thực hành theo đó sau khi nghe, được thể hiện bằng từ “sutavā” này.

Atha vā sotabbayuttaṃ sutvā kattabbanipphattivasena suṇīti sutavā, tappaṭikkhepena na sutavāti assutavā.

Alternatively, one who hears what is fit to be heard and accomplishes what is to be done is called "sutavā." By its negation, one who has not heard is "assutavā."

Hoặc, người đã nghe những gì nên nghe và đã hoàn thành những gì nên làm thì gọi là sutavā; phủ định điều đó thì gọi là assutavā (không có nghe).

197

Ayañhi a-kāro ‘‘ahetukā dhammā (dha. sa. 2.dukamātikā), abhikkhuko āvāso’’tiādīsu (pāci. 1046, 1047) taṃsahayoganivattiyaṃ icchito.

Indeed, this prefix 'a-' is intended in the sense of the absence of association with something, as in "unwholesome phenomena" (ahetukā dhammā) and "a monastery without bhikkhus" (abhikkhuko āvāso).

Thật vậy, tiền tố a- ở đây được mong muốn có ý nghĩa là sự không hiện hữu của điều đó trong các câu như “các pháp vô nhân” (Dhs.2.dukamātikā), “tu viện không có tỳ khưu” (Pāci.1046, 1047).

‘‘Apaccayā dhammā’’ti (dha. sa. 7.dukamātikā) taṃsambandhībhāvanivattiyaṃ.

In "unconditioned phenomena" (apaccayā dhammā), it signifies the absence of connection with that.

Trong câu “các pháp không có duyên” (Dhs.7.dukamātikā), ý nghĩa là sự không liên hệ với điều đó.

Paccayuppannañhi paccayasambandhīti appaccayuppannattā ataṃsambandhitā ettha jotitā.

For what is arisen from conditions is connected to conditions, thus its non-connection is here indicated by its not being arisen from conditions.

Thật vậy, điều được duyên sanh là liên hệ với duyên, nên ở đây, sự không liên hệ với duyên được chỉ ra bởi sự không phải là điều được duyên sanh.

‘‘Anidassanā dhammā’’ti (dha. sa. 9.dukamātikā) taṃsabhāvanivattiyaṃ.

In "non-visible phenomena" (anidassanā dhammā), it signifies the absence of that nature.

Trong câu “các pháp vô kiến” (Dhs.9.dukamātikā), ý nghĩa là sự không có bản chất đó.

Nidassanañhi daṭṭhabbatā.

For visibility is the state of being seen.

Thật vậy, nidassana (kiến) là khả năng được thấy.

Atha vā passatīti nidassanaṃ, cakkhuviññāṇaṃ, taggahetabbabhāvanivattiyaṃ yathā ‘‘anāsavā dhammā’’ti (dha. sa. 15.dukamātikā), ‘‘appaṭighā dhammā (dha. sa. 10.dukamātikā), anārammaṇā dhammā’’ti (dha. sa. 55.dukamātikā) taṃkiccanivattiyaṃ, ‘‘arūpino dhammā (dha. sa. 11.dukamātikā) acetasikā dhammā’’ti (dha. sa. 57.dukamātikā) tabbhāvanivattiyaṃ.

Alternatively, that which sees is visibility (nidassana), i.e., eye-consciousness; it signifies the absence of the state of being grasped by that, as in "phenomena without taints" (anāsavā dhammā), "phenomena without impact" (appaṭighā dhammā), "phenomena without object" (anārammaṇā dhammā) signifies the absence of that function; "formless phenomena" (arūpino dhammā), "phenomena without mental factors" (acetasikā dhammā) signifies the absence of that state.

Hoặc, điều thấy được gọi là nidassana, tức là nhãn thức; ý nghĩa là sự không có khả năng được nắm giữ bởi điều đó, như trong “các pháp vô lậu” (Dhs.15.dukamātikā), “các pháp vô đối ngại” (Dhs.10.dukamātikā), “các pháp vô sở duyên” (Dhs.55.dukamātikā), ý nghĩa là sự không có chức năng đó; “các pháp vô sắc” (Dhs.11.dukamātikā), “các pháp vô tâm sở” (Dhs.57.dukamātikā), ý nghĩa là sự không có bản chất đó.

Tadaññathā hi ettha pakāsitā.

For here it is declared otherwise.

Thật vậy, ở đây, điều đó được thể hiện khác đi.

‘‘Amanusso’’ti tabbhāvamattanivattiyaṃ.

In "not human" (amanusso), it signifies the mere absence of that state.

Amanusso (phi nhân) nghĩa là sự không có bản chất đó đơn thuần.

Manussamattaṃ natthi, aññaṃ samānanti.

There is no human quality, but it is similar to it.

Không có bản chất con người, nhưng tương tự như vậy.

Sadisatā hi ettha sūcitā.

For similarity is indicated here.

Thật vậy, ở đây, sự tương tự được chỉ ra.

‘‘Assamaṇo samaṇapaṭiñño, anariyo’’ti (a. ni. 3.13) ca taṃsambhāvanīyaguṇanivattiyaṃ.

"A recluse in name only, not a recluse" (assamaṇo samaṇapaṭiñño), "not noble" (anariyo) signifies the absence of qualities worthy of that.

Trong các câu như “kẻ tự xưng là sa-môn nhưng không phải sa-môn, kẻ không phải bậc Thánh” (A.iii.13), ý nghĩa là sự không có phẩm chất đáng có đó.

Garahā hi idha ñāyati.

For reproach is understood here.

Thật vậy, ở đây, sự chê bai được hiểu.

‘‘Kacci bhoto anāmayaṃ, anudarā kaññā’’ti (jā. 2.20.129) tadanappabhāvanivattiyaṃ, ‘‘anuppannā dhammā’’ti (dha. sa. 17.tikamātikā) taṃsadisabhāvanivattiyaṃ.

"Are you well, sir?" (kacci bhoto anāmayaṃ), "a girl without a womb" (anudarā kaññā) signifies the absence of that unpleasant state; "unarisen phenomena" (anuppannā dhammā) signifies the absence of that similar state.

Trong các câu như “Kính thưa ngài, có an lành không? Trinh nữ không có bụng” (Jā.2.20.129), ý nghĩa là sự không có sự hiện hữu của điều đó; “các pháp chưa sanh” (Dhs.17.tikamātikā), ý nghĩa là sự không có bản chất tương tự đó.

Atītānañhi uppannapubbattā uppādidhammānañca paccayekadesanipphattiyā āraddhuppādibhāvato kālavimuttassa ca vijjamānattā uppannānukūlatā pageva paccuppannānanti tabbidūratāva ettha viññāyati ‘‘asekkhā dhammā’’ti (dha. sa. 11.tikamātikā) tadapariyosānanivattiyaṃ.

For past phenomena have previously arisen, and phenomena that are due to arise, due to the partial completion of conditions, have a state of being commenced to arise, and what is free from time exists; thus, suitability for what has arisen is prior to what is present, and here, remoteness from that is understood, as in "phenomena of the Asekha stage" (asekkhā dhammā) signifies the absence of incompleteness.

Thật vậy, do các pháp quá khứ đã từng sanh, và các pháp có tính chất sanh khởi do sự hoàn thành một phần của các duyên, và do sự hiện hữu của điều vượt ngoài thời gian, nên sự tương đồng với các pháp đã sanh từ trước đã được biết rõ; và sự xa cách với các pháp hiện tại được hiểu ở đây; “các pháp vô học” (Dhs.11.tikamātikā), ý nghĩa là sự không có sự kết thúc của điều đó.

Tanniṭṭhānañhi ettha pakāsitanti.

For its completion is declared here.

Thật vậy, ở đây, sự hoàn thành điều đó được thể hiện.

Evamanekesaṃ atthānaṃ jotako.

Thus, it indicates many meanings.

Như vậy, nó là từ chỉ nhiều ý nghĩa khác nhau.

Idha pana ‘‘arūpino dhammā acetasikā dhammā’’tiādīsu viya tabbhāvanivattiyaṃ daṭṭhabbo, aññattheti attho.

Here, however, it should be understood as signifying the absence of that state, as in "formless phenomena" (arūpino dhammā), "phenomena without mental factors" (acetasikā dhammā), meaning "elsewhere."

Nhưng ở đây, nó nên được hiểu là sự không có bản chất đó, như trong các câu “các pháp vô sắc, các pháp vô tâm sở”, nghĩa là ở nơi khác.

Etenassa sutādiñāṇavirahataṃ dasseti.

By this, it shows his lack of knowledge such as hearing.

Bằng cách này, nó cho thấy sự thiếu vắng trí tuệ về sự nghe, v.v.

Tena vuttaṃ ‘‘āgamādhigamābhāvā ñeyyo assutavā itī’’ti.

Therefore, it is said: "He is to be known as 'assutavā' due to the absence of learning and realization."

Do đó, đã nói: “Do không có sự học và sự chứng đắc, người ấy được biết là assutavā (không có nghe)”.

198

Idāni tassa atthaṃ vivaranto yasmā khandhadhātvādikosallenapi maññanāpaṭisedhanasamatthaṃ bāhusaccaṃ hoti.

Now, explaining its meaning, since extensive learning, even through skill in aggregates, elements, and so on, is capable of refuting wrong views.

Bây giờ, khi giải thích ý nghĩa của điều đó, vì sự đa văn có khả năng bác bỏ sự chấp trước ngay cả bằng sự khéo léo về uẩn, giới, v.v.

Yathāha ‘‘kittāvatā nu kho, bhante, bahussuto hoti?

As it is said: "To what extent, venerable sir, is one learned?

Như đã nói: “Bạch Thế Tôn, một tỳ khưu được gọi là đa văn đến mức nào?

Yato kho bhikkhu khandhakusalo hoti dhātu, āyatana, paṭiccasamuppādakusalo hoti, ettāvatā kho bhikkhu bahussuto hotī’’ti, tasmā ‘‘yassa hi khandhadhātuāyatanasaccapaccayākārasatipaṭṭhānādīsūtiādi vuttaṃ.

When a bhikkhu is skilled in aggregates, elements, sense bases, dependent origination, and foundations of mindfulness, to that extent, bhikkhus, is he learned." Therefore, it is said: "He who is skilled in aggregates, elements, sense bases, truths, conditions, aspects, and foundations of mindfulness, and so on."

Này các tỳ khưu, khi một tỳ khưu khéo léo về các uẩn, các giới, các xứ, duyên khởi, các niệm xứ, thì tỳ khưu đó được gọi là đa văn”, do đó đã nói “người mà về các uẩn, giới, xứ, sự thật, duyên, các hành tướng niệm xứ, v.v.”.

Tattha vācuggatakaraṇaṃ uggaho.

Among these, committing to memory is uggaha (learning by heart).

Trong đó, việc học thuộc lòng là uggaha (sự nắm giữ).

Atthaparipucchanaṃ paripucchā.

Questioning the meaning is paripucchā (inquiry).

Việc hỏi về ý nghĩa là paripucchā (sự hỏi).

Kusalehi saha codanāpariharaṇavasena vinicchayakaraṇaṃ vinicchayo.

Making a decision by challenging and defending with the wise is vinicchaya (determination).

Việc phân xử bằng cách chất vấn và giải đáp với những người thiện xảo là vinicchaya (sự phân xử).

Maggaphalanibbānāni adhigamo.

Paths, fruits, and Nibbāna are adhigama (realization).

Các đạo, quả và Nibbāna là adhigama (sự chứng đắc).

199

Bahūnaṃ (dha. sa. mūlaṭī. 1007) nānappakārānaṃ kilesasakkāyadiṭṭhīnaṃ avihatattā tā janenti, tāhi vā janitāti puthujjanā.

Because many various kinds of defilements and wrong views of self are not destroyed, they (ordinary people) generate them, or they are generated by them; thus, they are ordinary people (puthujjana).

Do không đoạn trừ nhiều loại phiền não, tà kiến thân kiến, nên chúng sanh ra chúng, hoặc được sanh ra bởi chúng, nên gọi là puthujjanā (phàm phu).

Avighātameva vā jana-saddo vadati.

Or, the word 'jana' refers to non-destruction itself.

Hoặc từ jana chỉ sự không bị hủy hoại. (dha. sa. mūlaṭī. 1007)

Puthu satthārānaṃ mukhamullokikāti ettha puthu janā satthupaṭiññā etesanti puthujjanāti vacanattho.

In the phrase Puthu satthārānaṃ mukhamullokikā (those who look at the faces of various teachers), the etymological meaning of puthujjanā is 'ordinary people' because they acknowledge various teachers.

Trong cụm từ Puthu satthārānaṃ mukhamullokikā, nghĩa của từ Puthujjanā là những người (janā) có nhiều (puthu) vị thầy tự xưng (satthupaṭiññā) mà họ nhìn vào mặt (mukhamullokikā).

Puthu sabbagatīhi avuṭṭhitāti ettha janetabbā, jāyanti vā ettha sattāti janā, nānāgatiyo, tā puthū etesanti puthujjanā.

In the phrase Puthu sabbagatīhi avuṭṭhitā (those who have not emerged from various destinies), 'janā' refers to those who are to be born, or beings are born therein; and since these various destinies are diverse for them, they are puthujjanā.

Trong cụm từ Puthu sabbagatīhi avuṭṭhitā, cần hiểu là: những chúng sinh (sattā) được sinh ra (jāyanti) hoặc những nơi mà chúng sinh được sinh ra (janetabbā, jāyanti vā ettha sattāti janā) là các nẻo luân hồi (gatiyo) khác nhau (nānā), và chúng có nhiều (puthū) nẻo luân hồi này, nên gọi là Puthujjanā.

Ito pare jāyanti etehīti janā, abhisaṅkhārādayo, te etesaṃ puthū vijjantīti puthujjanā.

Furthermore, 'janā' are those through whom beings are born (e.g., conditioning activities), and since these are numerous for them, they are puthujjanā.

Từ đây trở đi, những gì được sinh ra từ những điều này (jāyanti etehīti janā) là các hành (abhisaṅkhārādayo), và chúng tồn tại riêng rẽ (puthū vijjantīti) ở những người này, nên gọi là Puthujjanā.

Abhisaṅkharaṇādiattho eva vā jana-saddo daṭṭhabbo.

Or, the word 'jana' should be understood in the sense of 'conditioning,' etc.

Hoặc từ "jana" chỉ nên được hiểu theo nghĩa của sự tạo tác (abhisaṅkharaṇa) v.v..

Oghā kāmoghādayo.

Oghā are the floods of sensual desire, etc.

Oghā là các dòng chảy như dục lưu (kāmoghādayo).

Rāgaggiādayo santāpā.

Santāpā are the fires of lust, etc.

Các ngọn lửa tham (rāgaggiādayo) v.v. là santāpā (sự nung đốt).

Te eva, sabbepi vā kilesā pariḷāhā.

These same defilements, or all defilements, are pariḷāhā.

Chúng, hoặc tất cả các phiền não, là pariḷāhā (sự nóng bức).

Puthu pañcasu kāmaguṇesu rattāti ettha jāyatīti jano, rāgo gedhoti evamādiko, puthu jano etesanti puthujjanā.

In the phrase Puthu pañcasu kāmaguṇesu rattā (those attached to various five strands of sensual pleasure), 'jana' refers to what arises, such as craving, greed, and so forth; and since these are diverse for them, they are puthujjanā.

Trong cụm từ Puthu pañcasu kāmaguṇesu rattā, những gì được sinh ra (jāyatīti jano) là tham ái (rāgo), sự ham muốn (gedho) v.v., và những người này có nhiều (puthu) sự sinh khởi (jano) đó, nên gọi là Puthujjanā.

Puthūsu vā janā jātā rattāti evaṃ rāgādiattho eva vā janasaddo daṭṭhabbo.

Or, the word 'jana' should be understood in the sense of attachment, etc., as in 'janā' (beings) born in various states are attached.

Hoặc từ "jana" chỉ nên được hiểu theo nghĩa của tham ái v.v., tức là những người được sinh ra (jātā) trong nhiều (puthūsu) sự tham ái (janā rattāti) như vậy.

Rattāti vatthaṃ viya raṅgajātena cittassa vipariṇāmakarena chandarāgena rattā sārattā.

Rattā (attached) means strongly attached, their minds colored by the dye-like quality of sensual desire, which distorts the mind, like a cloth dyed with color.

Rattā nghĩa là bị nhuộm màu, bị tham ái làm cho tâm biến đổi như một tấm vải bị nhuộm màu, bị say đắm.

Giddhāti abhikaṅkhanasabhāvena abhijjhānena giddhā gedhaṃ āpannā.

Giddhā (greedy) means intensely desirous due to the nature of longing, fallen into greed because of covetousness.

Giddhā nghĩa là bị tham lam, bị lòng tham làm cho ham muốn mãnh liệt, rơi vào sự thèm khát.

Gadhitāti ganthitā viya dummocanīyabhāvena tattha paṭibaddhā.

Gadhitā (bound) means restrained there, like being tied down, due to their inescapable nature.

Gadhitā nghĩa là bị ràng buộc, bị mắc kẹt vào đó một cách khó gỡ như bị thắt nút.

Mucchitāti kilesavasena visaññībhūtā viya anaññakiccā mucchaṃ mohamāpannā.

Mucchitā (infatuated) means, due to defilements, like being senseless, devoted to nothing else, fallen into infatuation and delusion.

Mucchitā nghĩa là bị mê muội, như bị mất trí do phiền não, không còn biết việc gì khác, rơi vào sự mê mờ.

Ajjhosannāti anaññasādhāraṇe viya katvā gilitvā pariniṭṭhapetvā ṭhitā.

Ajjhosannā (engrossed) means having swallowed, thoroughly consumed, and settled, as if making it exclusively their own.

Ajjhosannā nghĩa là đã nuốt chửng, đã hoàn tất và đứng yên như thể đã biến thành của riêng, không ai khác có thể sở hữu.

Laggāti vaṅkadaṇḍake viya āsattā mahāpalipe vā yāva nāsikaggā palipannapuriso viya uddharituṃ asakkuṇeyyabhāvena nimuggā, lagitāti makkaṭālepe ālaggabhāvena paccuḍḍito viya makkaṭo pañcannaṃ indriyānaṃ vasena ālaggitā.

Laggā (stuck) means clinging as if to a crooked stick, or submerged, unable to pull oneself out, like a person immersed in a great mud puddle up to his nose; lagitā (adhered) means clung, like a spider trapped in a spider web, clinging due to the five faculties.

Laggā nghĩa là bị dính mắc, bị mắc kẹt như trên một cành cây cong, hoặc bị chìm đắm đến mức không thể thoát ra được như một người đàn ông bị lún trong vũng bùn lớn đến tận mũi; lagitā nghĩa là bị dính chặt vào năm căn như một con nhện bị dính vào keo dính nhện, không thể thoát ra được.

Palibuddhāti baddhā, upaddutā vā.

Palibuddhā (entangled) means bound, or afflicted.

Palibuddhā nghĩa là bị trói buộc, hoặc bị quấy nhiễu.

Āvuṭāti āvunitā, nivutāti nivāritā.

Āvuṭā (covered) means enveloped; nivutā (shrouded) means obstructed.

Āvuṭā nghĩa là bị bao phủ, nivutā nghĩa là bị ngăn chặn.

Ovutāti paliguṇṭhitā, pariyonaddhā vā.

Ovutā (wrapped) means enshrouded, or completely bound.

Ovutā nghĩa là bị bao bọc, hoặc bị trói buộc.

Pihitāti pidahitā, paṭicchannāti paṭicchāditā.

Pihitā (closed) means shut; paṭicchannā (hidden) means concealed.

Pihitā nghĩa là bị che đậy, paṭicchannā nghĩa là bị che giấu.

Paṭikujjitāti heṭṭhāmukhajātā.

Paṭikujjitā (overturned) means having their face turned downwards.

Paṭikujjitā nghĩa là bị úp mặt xuống.

Puthūnaṃ vā gaṇanapathamatītānantiādinā puthu jano puthujjanoti dasseti.

By phrases such as puthūnaṃ vā gaṇanapathamatītānaṃ (those who have transcended the path of reckoning of the many), it shows that 'puthujana' means 'ordinary people'.

Bằng cách giải thích ‘‘Puthūnaṃ vā gaṇanapathamatītānaṃ’’ v.v., cho thấy rằng người phàm là Puthujjana.

200

‘‘Assutavā’’ti etena avijjandhatā vuttāti āha ‘‘andhaputhujjano vutto hotī’’ti.

It is said that by "Assutavā" (uninstructed), the blindness of ignorance is stated, hence "He is called a blind puthujjana".

Với từ ‘‘Assutavā’’ (kẻ không nghe giáo pháp), sự mù quáng của vô minh được nói đến, nên ngài nói: ‘‘Andhaputhujjano vutto hotī’’ (người phàm mù quáng được nói đến).

Ārakattā (saṃ. ni. ṭī. 2.3.1) kilesehi maggena samucchinnattā.

Ārakattā (due to being far off) from defilements means because they are completely eradicated by the path.

Ārakattā (Saṃ. Ni. Ṭī. 2.3.1) kilesehi (xa lìa các phiền não) do đã đoạn trừ bằng đạo lộ.

Anayeti avaḍḍhiyaṃ, anattheti attho.

Anaye means in un-growth, which is to say, in harm.

Anaye nghĩa là không tăng trưởng, tức là không có lợi ích.

Anaye vā anupāye.

Or anaye means in the wrong way.

Hoặc Anaye nghĩa là không có phương tiện (đúng đắn).

Nairiyanato avattanato.

Nairiyanato means from not moving forward.

Nairiyanato nghĩa là không hành xử.

Ayeti vaḍḍhiyaṃ, atthe, upāye vā.

Aye means in growth, in benefit, or in the right way.

Aye nghĩa là sự tăng trưởng, lợi ích, hoặc phương tiện (đúng đắn).

Araṇīyatoti payirupāsitabbato.

Araṇīyato means from being resorted to.

Araṇīyato nghĩa là đáng được phụng sự.

Niruttinayena padasiddhi veditabbā purimesu atthavikappesu.

The derivation of the word should be understood according to the etymological method in the former interpretations.

Sự thành lập từ ngữ nên được hiểu theo phương pháp ngữ nguyên trong các cách giải thích nghĩa trước đó.

Pacchime pana saddasatthavasenapi.

But in the latter, also according to the rules of grammar.

Còn ở phần sau thì theo phương pháp ngữ pháp.

Yadipi ariya-saddo ‘‘ye hi vo ariyā parisuddhakāyakammantā’’tiādīsu (ma. ni. 1.35) visuddhāsayapayogesu puthujjanesupi vattati.

Although the word 'ariya' also applies to ordinary people in contexts of pure intention and conduct, as in "ye hi vo ariyā parisuddhakāyakammantā" (those noble ones whose bodily actions are pure).

Mặc dù từ "ariya" được dùng cho cả người phàm trong các ngữ cảnh thể hiện ý trong sạch như ‘‘ye hi vo ariyā parisuddhakāyakammantā’’ (Ma. Ni. 1.35) v.v. (những người cao thượng có hành động thân thể trong sạch).

Idha pana ariyamaggādhigamena sabbalokuttarabhāvena ca ariyabhāvo adhippetoti dassento āha ‘‘buddhā’’tiādi.

Here, however, the noble state is intended through the attainment of the noble path and by being completely transcendent of the world, thereby saying, "the Buddhas," etc.

Tuy nhiên, ở đây, trạng thái cao thượng (ariya-bhāvo) được hiểu là do chứng đắc Thánh đạo và do vượt lên trên tất cả thế gian, nên ngài nói: ‘‘Buddhā’’ v.v..

Tattha ‘‘paccekabuddhā tathāgatasāvakā ca sappurisā’’ti idaṃ ariyā sappurisāti idha vuttapadānaṃ atthaṃ asaṅkarato dassetuṃ vuttaṃ.

Among these, "Paccekabuddhas, Tathāgata's disciples, and good people (sappurisā)" is stated to show the meaning of the words "ariyā" (noble ones) and "sappurisā" (good people) mentioned here, without confusion.

Trong đó, ‘‘Paccekabuddhā tathāgatasāvakā ca sappurisā’’ (Các vị Độc Giác Phật, các Thanh Văn của Như Lai và các bậc Chân Nhân) được nói ra để trình bày ý nghĩa của các từ được dùng ở đây là "ariyā" (các bậc Thánh) và "sappurisā" (các bậc Chân Nhân) một cách rõ ràng, không lẫn lộn.

Yasmā pana nippariyāyato ariyasappurisabhāvā abhinnasabhāvā.

However, since the state of being noble and good people (sappurisā) are essentially non-different.

Tuy nhiên, vì trạng thái Thánh nhân và Chân nhân không khác biệt về bản chất một cách tuyệt đối.

Tasmā ‘‘sabbeva vā’’tiādi vuttaṃ.

Therefore, "or all of them" and so forth is stated.

Do đó, ngài đã nói ‘‘Sabbeva vā’’ (hoặc tất cả) v.v..

201

Ettāvatā hi buddhasāvako vutto.

By this much, a disciple of the Buddha is indeed described.

Ettāvatā hi buddhasāvako vutto (Đến đây, một đệ tử của Đức Phật đã được nói đến).

Tassa hi ekantena kalyāṇamitto icchitabbo paratoghosamantarena paṭhamamaggassa anuppajjanato.

For him, a true good friend is absolutely essential, as the first path does not arise without external prompting.

Vì không có sự phát sinh của đạo lộ thứ nhất mà không có sự trợ giúp từ bên ngoài (paratoghosamantarena), nên vị ấy nhất định phải có một thiện hữu tri thức.

Visesato cassa bhagavāva kalyāṇamitto adhippeto.

And specifically, the Blessed One himself is the intended good friend for him.

Đặc biệt, Đức Thế Tôn được xem là kalyāṇamitto (thiện hữu tri thức) của vị ấy.

Vuttañhetaṃ ‘‘mamañhi, ānanda, kalyāṇamittaṃ āgamma jātidhammā sattā jātiyā parimuccantī’’tiādi (saṃ. ni. 5.2).

For this was said: "Indeed, Ānanda, by relying on me as a good friend, beings who are subject to birth are liberated from birth," etc.

Điều này đã được nói: ‘‘Này Ānanda, nhờ có thiện hữu tri thức là Ta mà các chúng sinh bị ràng buộc bởi sinh tử được giải thoát khỏi sinh tử’’ (Saṃ. Ni. 5.2).

So eva ca aveccapasādādhigamena daḷhabhatti nāma.

And he, through the attainment of unwavering faith, is called firm in devotion.

Vị ấy cũng được gọi là daḷhabhatti (có đức tin kiên cố) do đã đạt được niềm tin bất động (aveccappasāda).

Vuttampi cetaṃ ‘‘yaṃ mayā sāvakānaṃ sikkhāpadaṃ paññattaṃ, taṃ mama sāvakā jīvitahetupi nātikkamantī’’ti (udā. 45).

And this was also said: "Whatever training rule I have laid down for my disciples, my disciples do not transgress it even for the sake of their lives."

Điều này cũng đã được nói: ‘‘Giới luật nào mà Ta đã chế định cho các đệ tử, thì các đệ tử của Ta không vi phạm, dù vì mạng sống’’ (Udā. 45).

Kataññutādīhi paccekabuddhā buddhāti ettha kataṃ jānātīti kataññū.

In the phrase Kataññutādīhi paccekabuddhā buddhā (Paccekabuddhas and Buddhas by gratitude, etc.), kataññū means one who knows what has been done (a favor).

Trong cụm từ Kataññutādīhi paccekabuddhā buddhā (Các vị Độc Giác Phật và Chư Phật bởi lòng tri ân v.v.), kataññū là người biết ơn (biết việc đã làm).

Kataṃ viditaṃ pākaṭaṃ karotīti katavedī.

Katavedī means one who makes known, evident, or clear what has been done.

Katavedī là người biểu lộ, làm cho việc đã làm trở nên rõ ràng.

Anekesupi hi kappasatasahassesu kataṃ upakāraṃ jānanti paccekabuddhā pākaṭañca karonti satijananaāmisapaṭiggahaṇādinā, tathā saṃsāradukkhadukkhitassa sakkaccaṃ karonti kiccaṃ, yaṃ attanā kātuṃ sakkā.

For Paccekabuddhas know the kindness done to them even through hundreds of thousands of eons and make it known through inspiring mindfulness, accepting offerings, and so on; similarly, they diligently perform the duty that can be done by themselves for those suffering from the misery of Saṃsāra.

Quả thật, các vị Độc Giác Phật biết ơn sự giúp đỡ đã nhận được trong hàng trăm ngàn đại kiếp, và họ biểu lộ lòng biết ơn đó bằng cách gợi ý về sự tỉnh thức, chấp nhận cúng dường vật chất v.v., và họ tận tâm làm những việc có thể làm cho những người đau khổ trong vòng luân hồi.

Sammāsambuddho pana kappānaṃ asaṅkhyeyyasahassesupi kataṃ upakāraṃ maggaphalānaṃ upanissayañca jānāti, pākaṭañca karoti, sīho viya ca evaṃ sabbattha sakkaccameva dhammadesanaṃ karonto buddhakiccaṃ karoti.

A Sammāsambuddha, however, knows the kindness done even through countless hundreds of thousands of eons, and the prerequisite for the paths and fruits, and makes it known; and like a lion, performing the Buddha's duty by always diligently teaching the Dhamma everywhere.

Tuy nhiên, Đức Chánh Đẳng Chánh Giác biết ơn sự giúp đỡ đã nhận được trong hàng ngàn vô số đại kiếp và cả sự hỗ trợ cho các đạo quả, và Ngài biểu lộ điều đó. Như một con sư tử, Ngài tận tâm thuyết pháp ở khắp mọi nơi như vậy, thực hiện Phật sự.

Yāya paṭipattiyā diṭṭhā nāma honti, tassā appaṭipajjanabhāvo, tattha ca ādarābhāvo ariyānaṃ adassanasīlatā ca, na ca dassane sādhukāritā ca veditabbā.

The failure to undertake the practice by which noble ones are seen, and the lack of reverence therein, and their disinclination to see noble ones, and their lack of commendation in seeing, should be understood.

Cần hiểu rằng sự không thực hành con đường mà nhờ đó các bậc Thánh được nhìn thấy, sự thiếu quan tâm đến con đường đó, sự không có thói quen nhìn thấy các bậc Thánh, và sự không có thiện chí khi nhìn thấy các bậc Thánh.

Cakkhunā adassāvīti etta cakkhu nāma na maṃsacakkhu eva, atha kho dibbacakkhupīti āha ‘‘dibbacakkhunā vā’’ti.

In the phrase Cakkhunā adassāvī (not seeing with the eye), cakkhu (eye) is not merely the physical eye, but also the divine eye, hence it says "or with the divine eye."

Trong cụm từ Cakkhunā adassāvī (không thấy bằng mắt), từ cakkhu không chỉ là nhục nhãn, mà còn là thiên nhãn, nên ngài nói: ‘‘Dibbacakkhunā vā’’ (hoặc bằng thiên nhãn).

Ariyabhāvoti yehi yogato ‘‘ariyā’’ti vuccanti.

Ariyabhāvo (noble state) refers to those qualities of the path and fruit by which one is called "noble" (ariyā).

Ariyabhāvo (Trạng thái Thánh nhân) là những pháp đạo quả mà nhờ sự tu tập (yoga) người ta được gọi là ‘‘ariyā’’ (các bậc Thánh).

Te maggaphaladhammā daṭṭhabbā.

These Dhamma of the path and fruit should be understood.

Những pháp ấy cần được thấy.

202

Tatrāti ñāṇadassanasseva dassanabhāve.

Tatrā (therein) means in the aspect of seeing of knowledge and insight itself.

Tatrā (Trong đó) là trong trạng thái thấy của chính tuệ tri và tuệ quán.

Vatthūti adhippetatthañāpanakāraṇaṃ.

Vatthū (ground/basis) refers to the cause that conveys the intended meaning.

Vatthū (Cơ sở) là nguyên nhân để biết được ý nghĩa mong muốn.

Evaṃ vuttepīti evaṃ aññāpadesena attūpanāyikaṃ katvā vuttepi.

Evaṃ vuttepī (even when thus spoken) means even when spoken in this way, making it relevant to oneself through a different designation.

Evaṃ vuttepī (Mặc dù đã nói như vậy) là mặc dù đã nói như vậy bằng cách áp dụng cho bản thân qua cách nói gián tiếp.

Dhammanti lokuttaradhammaṃ, catusaccadhammaṃ vā.

Dhammaṃ means the supramundane Dhamma, or the Dhamma of the Four Noble Truths.

Dhammaṃ (Pháp) là pháp siêu thế, hoặc pháp Tứ Diệu Đế.

Ariyakaradhammā aniccānupassanādayo vipassiyamānā aniccādayo, cattāri vā ariyasaccāni.

Ariyakaradhammā are the practices that make one noble, such as impermanence as seen in vipassana meditation, or the Four Noble Truths.

Ariyakaradhammā (Các pháp làm nên Thánh nhân) là các pháp như quán vô thường v.v. khi được quán chiếu, tức là vô thường v.v., hoặc Tứ Thánh Đế.

203

Avinītoti na vinīto, adhisīlasikkhādivasena na sikkhito.

Avinīto (undisciplined) means not disciplined, not trained in terms of higher morality, etc.

Avinīto (Người chưa được huấn luyện) là người chưa được huấn luyện, chưa được giáo dục về giới học (adhisīlasikkhā) v.v..

Yesaṃ saṃvaravinayādīnaṃ abhāvena ayaṃ avinītoti vuccati, te tāva dassetuṃ ‘‘duvidho vinayo nāmā’’tiādimāha.

To show those things (such as restraint and discipline) due to the absence of which one is called undisciplined, it first says "There are two kinds of discipline."

Để chỉ ra những điều mà do thiếu chúng mà người này được gọi là chưa được huấn luyện, như sự phòng hộ và giới luật v.v., ngài nói: ‘‘Duvidho vinayo nāmā’’ (Giới luật có hai loại) v.v..

Tattha sīlasaṃvaroti pātimokkhasaṃvaro veditabbo, so ca atthato kāyikavācasiko avītikkamo.

Among these, sīlasaṃvaro (restraint of morality) should be understood as the Pātimokkha restraint, which in essence is the non-transgression of bodily and verbal actions.

Trong đó, sīlasaṃvaro (sự phòng hộ giới) nên được hiểu là sự phòng hộ Giới bổn (pātimokkha), và về mặt ý nghĩa, đó là sự không vi phạm về thân và khẩu.

Satisaṃvaroti indriyarakkhā, sā ca tathāpavattā sati eva.

Satisaṃvaro (restraint of mindfulness) is the guarding of the senses, which is mindfulness occurring in that manner.

Satisaṃvaro (sự phòng hộ niệm) là sự bảo vệ các căn, và đó chính là niệm đang diễn ra như vậy.

Ñāṇasaṃvaroti ‘‘sotānaṃ saṃvaraṃ brūmī’’ti (su. ni. 1040) vatvā ‘‘paññāyete pidhīyare’’ti vacanato sotasaṅkhātānaṃ taṇhādiṭṭhiduccaritaavijjāavasiṭṭhakilesānaṃ saṃvaro pidahanaṃ samucchedañāṇanti veditabbaṃ.

Ñāṇasaṃvaro (restraint of knowledge) is to be understood as the restraint or suppression of defilements such as craving, wrong view, misconduct, and ignorance, which are called 'ears,' as stated in "I declare the restraint of the ears" and by the saying "They are shut by wisdom," meaning the knowledge of eradication.

Ñāṇasaṃvaro (sự phòng hộ trí tuệ) nên được hiểu là sự phòng hộ, sự che đậy, sự đoạn trừ bằng trí tuệ đối với các phiền não còn sót lại như tham ái, tà kiến, ác hạnh, vô minh, được gọi là "sota" (dòng chảy), theo lời dạy ‘‘paññāyete pidhīyare’’ (chúng được che đậy bằng trí tuệ) sau khi nói ‘‘sotānaṃ saṃvaraṃ brūmī’’ (Ta nói về sự phòng hộ các dòng chảy) (Su. Ni. 1040).

Khantisaṃvaroti adhivāsanā, sā ca tathāpavattā khandhā, adoso vā.

Khantisaṃvaro (restraint of patience) is endurance, which is the aggregates occurring in that manner, or non-hatred.

Khantisaṃvaro (sự phòng hộ nhẫn nại) là sự chịu đựng (adhivāsanā), và đó chính là các uẩn đang diễn ra như vậy, hoặc là vô sân.

Paññāti eke, taṃ aṭṭhakathāya virujjhati.

Some say it is wisdom, but that contradicts the commentaries.

Một số người cho rằng đó là trí tuệ, nhưng điều đó mâu thuẫn với Chú giải.

Vīriyasaṃvaro kāmavitakkādīnaṃ vinodanavasena pavattaṃ vīriyameva.

Vīriyasaṃvaro (restraint of energy) is energy itself, manifested in the suppression of sensual thoughts, etc.

Vīriyasaṃvaro (sự phòng hộ tinh tấn) chính là tinh tấn được thực hành để loại bỏ các tà tư duy dục (kāmavitakkādīnaṃ vinodanavasena).

Tena tena guṇaṅgena tassa tassa aguṇaṅgassa pahānaṃ tadaṅgapahānaṃ.

The abandonment of a particular unwholesome quality by a specific wholesome quality is tadaṅgapahānaṃ (abandonment by substitution).

Sự đoạn trừ một phần xấu xa bằng một phần tốt đẹp tương ứng được gọi là tadaṅgapahānaṃ (đoạn trừ từng phần).

Vikkhambhanena pahānaṃ vikkhambhanapahānaṃ.

Abandonment by suppression is vikkhambhanapahānaṃ (abandonment by suppression).

Sự đoạn trừ bằng cách trấn áp được gọi là vikkhambhanapahānaṃ (đoạn trừ bằng trấn áp).

Sesapadatthayepi eseva nayo.

The same method applies to the meanings of the remaining terms.

Đối với các ý nghĩa từ ngữ còn lại cũng theo cách tương tự.

204

Iminā pātimokkhasaṃvarenātiādi sīlasaṃvarādīnaṃ vivaraṇaṃ.

Iminā pātimokkhasaṃvarenātiādi (by this Pātimokkha restraint, etc.) is the explanation of the restraint of morality, etc.

Iminā pātimokkhasaṃvarenā (bằng sự phòng hộ Giới bổn này) v.v. là sự giải thích về sự phòng hộ giới v.v..

Tattha samupetoti ettha iti-saddo ādisattho.

Here, in the term samupeto (endowed with), the word iti means 'and so on'.

Trong đó, đối với từ samupeto (được bao gồm), từ iti ở đây có nghĩa là khởi đầu (và những từ tương tự).

Tena ‘‘sahagato samupagato’’tiādinā vibhaṅge (vibha. 511) āgataṃ saṃvaravibhaṅgaṃ dasseti.

By that, it indicates the analysis of restraint ( saṃvara-vibhaṅga) found in the Vibhaṅga, beginning with 'accompanied, approached'.

Do đó, nó chỉ ra phần phân tích về sự chế ngự (saṃvaravibhaṅga) được đề cập trong Vibhaṅga (vibha. 511) với các từ như "sahagato" (đi cùng) và "samupagato" (tiếp cận), v.v.

Esa nayo sesesupi.

This method applies to the rest as well.

Phương pháp này cũng áp dụng cho những trường hợp còn lại.

Yaṃ panettha vattabbaṃ, taṃ anantarasutte āvi bhavissati.

What needs to be said in this regard will become evident in the immediately following Sutta.

Điều gì cần nói ở đây sẽ trở nên rõ ràng trong kinh kế tiếp.

205

Kāyaduccaritādīnanti dussīlyasaṅkhātānaṃ kāyavacīduccaritādīnaṃ muṭṭhassaccasaṅkhātassa pamādassa abhijjhādīnaṃ vā akkhantiaññāṇakosajjānañca.

Kāyaduccaritādīnaṃ (of physical misconduct, etc.) refers to bodily and verbal misconduct, etc., which constitute immorality, as well as heedlessness, which constitutes forgetfulness, or covetousness (abhijjhā), etc., intolerance, ignorance, and laziness.

Kāyaduccaritādīnaṃ (những ác hạnh thân, v.v.) có nghĩa là những ác hạnh thân và khẩu, v.v., được gọi là sự phá giới; sự phóng dật được gọi là sự thất niệm; sự bất nhẫn, vô minh và biếng nhác do tham ái, v.v.

Saṃvaraṇatoti pidahanato thakanato.

Saṃvaraṇato (from restraining) means from covering, from stopping.

Saṃvaraṇato có nghĩa là từ sự che đậy, sự ngăn chặn.

Vinayanatoti kāyavācācittānaṃ virūpappavattiyā vinayanato apanayanato, kāyaduccaritādīnaṃ vā vinayanato, kāyādīnaṃ vā jimhappavattiṃ vicchinditvā ujukaṃ nayanatoti attho.

Vinayanato (from subduing) means from subduing or removing the improper activities of body, speech, and mind, or vinayanato of bodily misconduct, etc., or by severing the crooked activity of the body, etc., and leading it straight; such is the meaning.

Vinayanato có nghĩa là từ sự điều phục, sự loại bỏ những hành vi sai trái của thân, khẩu và ý; hoặc từ sự điều phục những ác hạnh thân, v.v.; hoặc có nghĩa là sau khi cắt đứt những hành vi sai trái của thân, v.v., dẫn dắt chúng đi đúng hướng.

Paccayasamavāye uppajjanārahānaṃ kāyaduccaritādīnaṃ tathā tathā anuppādanameva saṃvaraṇaṃ vinayanañca veditabbaṃ.

The non-arising in such and such a way of bodily misconduct, etc., which are capable of arising when conditions are present, should be understood as saṃvaraṇaṃ (restraining) and vinayanaṃ (subduing).

Sự không cho phép những ác hạnh thân, v.v., đáng lẽ phải phát sinh khi các điều kiện hội tụ, không phát sinh theo cách này hay cách khác, nên được hiểu là saṃvaraṇaṃ (sự chế ngự) và vinayanaṃ (sự điều phục).

206

Yaṃ pahānanti sambandho.

The connection is: "that abandonment".

Sự đoạn trừ đó là sự liên kết.

‘‘Nāmarūpaparicchedādīsu vipassanāñāṇesū’’ti kasmā vuttaṃ, nanu nāmarūpaparicchedapaccayapariggahakaṅkhāvitaraṇāni na vipassanāñāṇāni sammasanākārena appavattanato?

Why is it said: " In vipassanā-ñāṇas (insight knowledges) such as the discernment of nāma-rūpa (mentality-materiality)"? Are not the discernment of nāma-rūpa, the comprehension of conditions, and the overcoming of doubt not vipassanā-ñāṇas, as they do not proceed in the manner of reflection?

Tại sao lại nói "trong các tuệ quán như sự phân biệt danh sắc, v.v."? Há sự phân biệt danh sắc, sự nắm giữ các duyên, và sự vượt qua nghi ngờ không phải là các tuệ quán vì chúng không phát sinh dưới hình thức quán xét sao?

Saccametaṃ.

That is true.

Điều đó là đúng.

Vipassanāñāṇassa pana adhiṭṭhānabhāvato evaṃ vuttaṃ.

However, it is said thus because they serve as the foundation of vipassanā-ñāṇa.

Tuy nhiên, điều này được nói vì chúng là nền tảng của tuệ quán.

‘‘Nāmarūpamattamidaṃ, natthi ettha attā vā attaniyaṃ vā’’ti evaṃ pavattañāṇaṃ nāmarūpavavatthānaṃ.

The knowledge that proceeds with "This is merely nāma-rūpa; there is no self or what belongs to a self here" is nāmarūpa-vavatthānaṃ (the discernment of nāma-rūpa).

Tuệ giác phát sinh như "đây chỉ là danh sắc, không có tự ngã hay cái thuộc về tự ngã ở đây" được gọi là nāmarūpavavatthānaṃ (sự phân biệt danh sắc).

Sati vijjamāne khandhapañcakasaṅkhāte kāye, sayaṃ vā satī tasmiṃ kāye diṭṭhīti sakkāyadiṭṭhi.

Sakkāya-diṭṭhi (identity view) is the view that exists in the body, consisting of the five aggregates, or the view that the self exists in that body.

Sakkāyadiṭṭhi (thân kiến) là tà kiến phát sinh khi có thân thể bao gồm năm uẩn, hoặc có kiến chấp trong thân thể đó.

‘‘Rūpaṃ attato samanupassatī’’ti (saṃ. ni. 3.81; 4.345) evaṃ pavattā micchādiṭṭhi.

It is the wrong view that proceeds with "one regards rūpa as self".

Đó là tà kiến phát sinh như "người ấy quán sát sắc là tự ngã" (saṃ. ni. 3.81; 4.345).

Tasseva rūpārūpassa kammāvijjādipaccayapariggaṇhanañāṇaṃ paccayapariggaho.

The knowledge of comprehending the conditions, such as kamma and ignorance, of that very rūpa-arūpa, is paccayapariggaho (comprehension of conditions).

Tuệ giác nắm giữ các duyên như nghiệp, vô minh, v.v., của chính sắc và vô sắc đó được gọi là paccayapariggaho (sự nắm giữ các duyên).

‘‘Natthi hetu natthi paccayo sattānaṃ saṃkilesāyā’’ti (dī. ni. 1.168) ādinayappavattā ahetukadiṭṭhi.

Ahetuka-diṭṭhi (view of non-causality) is the view that proceeds in the manner of "There is no cause, no condition for the defilement of beings," and so on.

Ahetukadiṭṭhi (vô nhân kiến) là tà kiến phát sinh theo cách như "không có nhân, không có duyên cho sự ô nhiễm của chúng sinh" (dī. ni. 1.168), v.v.

‘‘Issarapurisapajāpatipakatiaṇukālādīhi loko pavattati nivattati cā’’ti pavattā visamahetudiṭṭhi.

Visamahetu-diṭṭhi (view of unequal causes) is the view that proceeds with "The world arises and ceases from God, Purisa, Pajāpati, Prakṛti, atoms, time, and so on."

Visamahetudiṭṭhi (tà kiến về nhân không đúng) là tà kiến phát sinh như "thế giới vận hành và ngừng vận hành do thần linh, người đàn ông, Prajāpati, tự nhiên, nguyên tử, thời gian, v.v.".

Tassevāti paccayapariggahasseva.

Tasseva (of that very) refers to the comprehension of conditions itself.

Tasseva có nghĩa là của chính sự nắm giữ các duyên.

Kaṅkhāvitaraṇenāti yathā etarahi nāmarūpassa kammādipaccayato uppatti, evaṃ atītānāgatesupīti tīsupi kālesu vicikicchāpanayanañāṇena.

Kaṅkhāvitaraṇena (by overcoming doubt) means by the knowledge of removing doubt in all three times, that is, just as nāma-rūpa now arises from conditions such as kamma, so too in the past and future.

Kaṅkhāvitaraṇena (bằng sự vượt qua nghi ngờ) có nghĩa là bằng tuệ giác loại bỏ sự phân vân trong cả ba thời, rằng cũng như danh sắc hiện tại phát sinh từ các duyên như nghiệp, thì trong quá khứ và vị lai cũng vậy.

Kathaṃkathībhāvassāti ‘‘ahosiṃ nu kho ahamatītamaddhāna’’nti (ma. ni. 1.18; saṃ. ni. 2.20) ādinayappavattāya saṃsayappavattiyā.

Kathaṃkathībhāvassa (of the state of perplexity) refers to the proceeding of doubt that arises in the manner of "Was I in the past?" and so on.

Kathaṃkathībhāvassa (của trạng thái nghi ngờ) có nghĩa là của sự phân vân phát sinh theo cách như "phải chăng tôi đã từng tồn tại trong quá khứ?" (ma. ni. 1.18; saṃ. ni. 2.20), v.v.

Kalāpasammasanenāti ‘‘yaṃ kiñci rūpaṃ atītānāgatapaccuppanna’’ntiādinā (ma. ni. 1.361; 2.113; 3.86, 89) khandhapañcakaṃ ekādasasu okāsesu pakkhipitvā sammasanavasena pavattena nayavipassanāñāṇena.

Kalāpasammasanena (by reflecting on groups) means by the insight knowledge that proceeds by reflecting on the five aggregates, grouped into eleven aspects, in the manner of "Whatever rūpa, past, future, present," and so on.

Kalāpasammasanena (bằng sự quán xét tổng hợp) có nghĩa là bằng tuệ quán theo phương pháp phát sinh bằng cách đặt năm uẩn vào mười một trường hợp, như "bất cứ sắc nào thuộc quá khứ, vị lai, hiện tại" (ma. ni. 1.361; 2.113; 3.86, 89), v.v.

Ahaṃ mamāti gāhassāti attattaniyagahaṇassa.

Ahaṃ mamāti gāhassa (of the grasping of 'I' and 'mine') refers to the grasping of self and what belongs to a self.

Ahaṃ mamāti gāhassa (của sự chấp thủ 'tôi' và 'của tôi') có nghĩa là của sự chấp thủ tự ngã và cái thuộc về tự ngã.

Maggāmaggavavatthānenāti maggāmaggañāṇavisuddhiyā.

Maggāmaggavavatthānenā (by discerning the path and not-path) refers to the purification of knowledge of the path and not-path.

Maggāmaggavavatthānena (bằng sự phân biệt đạo và phi đạo) có nghĩa là bằng sự thanh tịnh của tuệ giác về đạo và phi đạo.

Amagge maggasaññāyāti obhāsādike amagge ‘‘maggo’’ti uppannasaññāya.

Amagge maggasaññāya (by perceiving the path in the not-path) refers to the perception that arises in the not-path, such as in luminosities, as 'the path'.

Amagge maggasaññāya (bằng sự nhận thức đạo trong phi đạo) có nghĩa là bằng sự nhận thức phát sinh như "đây là đạo" trong những điều không phải đạo như ánh sáng, v.v.

207

Yasmā sammadeva saṅkhārānaṃ udayaṃ passanto ‘‘evameva saṅkhārā anurūpakāraṇato uppajjanti, na pana ucchijjantī’’ti gaṇhāti, tasmā vuttaṃ ‘‘udayadassanena ucchedadiṭṭhiyā’’ti.

Because one who truly sees the arising of formations grasps, "Formations arise only from appropriate causes, and do not get cut off," therefore it is said, " by seeing arising, of the annihilation view."

Vì khi thấy sự sinh khởi của các hành một cách chân chánh, người ấy nắm giữ rằng "các hành chỉ phát sinh do các nguyên nhân phù hợp, chứ không bị đoạn diệt", nên đã nói "bằng sự thấy sự sinh khởi, đoạn trừ đoạn kiến".

Yasmā pana saṅkhārānaṃ vayaṃ passanto ‘‘yadipime saṅkhārā avicchinnā vattanti, uppannuppannā pana appaṭisandhikā nirujjhante vā’’ti passati, tassevaṃ passato kuto sassataggāho, tasmā vuttaṃ ‘‘vayadassanena sassatadiṭṭhiyā’’ti.

However, because one who sees the passing away of formations sees, "Even if these formations continue without interruption, what has arisen will cease without further rebirth," how can there be a grasping of eternalism for such a person? Therefore it is said, " by seeing passing away, of the eternalist view."

Tuy nhiên, vì khi thấy sự hoại diệt của các hành, người ấy thấy rằng "mặc dù các hành này liên tục vận hành, nhưng mỗi khi phát sinh, chúng hoại diệt mà không tái tục", thì làm sao người thấy như vậy có thể có thường kiến? Do đó, đã nói "bằng sự thấy sự hoại diệt, đoạn trừ thường kiến".

Bhayadassanenāti bhayatupaṭṭhānañāṇena.

Bhayadassanena (by seeing danger) refers to the knowledge of manifestation as danger.

Bhayadassanena (bằng sự thấy sự đáng sợ) có nghĩa là bằng tuệ giác về sự đáng sợ.

Sabhayeti sabbabhayānaṃ ākarabhāvato sakaladukkhavūpasamasaṅkhātassa paramassāsassa paṭipakkhabhāvato ca sabhaye khandhapañcake.

Sabhaye (in what is fearful) refers to the five aggregates, which are the source of all fears and are opposed to the ultimate comfort, which is the cessation of all suffering.

Sabhaye (trong sự đáng sợ) có nghĩa là trong năm uẩn đáng sợ, vì chúng là nguồn gốc của mọi nỗi sợ hãi, và vì chúng đối lập với sự an ủi tối thượng được gọi là sự chấm dứt mọi khổ đau.

Abhayasaññāyāti ‘‘abhayaṃ khema’’nti uppannasaññāya.

Abhayasaññāya (by the perception of fearlessness) refers to the perception that arises as "fearless, safe."

Abhayasaññāya (bằng sự nhận thức không sợ hãi) có nghĩa là bằng sự nhận thức phát sinh như "không sợ hãi, an toàn".

Assādasaññā nāma pañcupādānakkhandhesu assādavasena pavattasaññā, yā ‘‘ālayābhiniveso’’tipi vuccati.

Assādasaññā (perception of gratification) is the perception that proceeds with gratification in the five aggregates of clinging, which is also called "attachment and obsession."

Assādasaññā (tưởng vị ngọt) là sự nhận thức phát sinh theo cách vị ngọt trong năm thủ uẩn, điều này cũng được gọi là "ái luyến và bám víu".

Abhiratisaññā tattheva abhirativasena pavattasaññā, yā ‘‘nandī’’tipi vuccati.

Abhiratisaññā (perception of delight) is the perception that proceeds with delight in the same, which is also called "enjoyment."

Abhiratisaññā (tưởng hoan hỷ) là sự nhận thức phát sinh theo cách hoan hỷ trong chính những điều đó, điều này cũng được gọi là "nandī" (hỷ lạc).

Amuccitukamyatā ādānaṃ.

Amuccitukamyatā (desire not to be freed) is grasping.

Amuccitukamyatā (không muốn giải thoát) là sự chấp thủ.

Anupekkhā saṅkhārehi anibbindanaṃ, sālayatāti attho.

Anupekkhā (disregard) is not becoming dispassionate towards formations; the meaning is attachment.

Anupekkhā (không quán xét) là sự không chán ghét các hành, có nghĩa là sự ái luyến.

Dhammaṭṭhitiyaṃ paṭiccasamuppāde paṭilomabhāvo sassatucchedaggāho, paccayākārapaṭicchādakamoho vā, nibbāne paṭilomabhāvo saṅkhāresu rati, nibbānapaṭicchādakamoho vā.

Paṭilomabhāvo (being contrary) in the Dhammaṭṭhiti (established natural law) of dependent origination is the grasping of eternalism and annihilationism, or ignorance that conceals the aspect of conditions; paṭilomabhāvo in Nibbāna is delight in formations, or ignorance that conceals Nibbāna.

Dhammaṭṭhitiyaṃ (trong sự an trú của các pháp), trong duyên khởi, paṭilomabhāvo (trạng thái nghịch lý) là thường kiến và đoạn kiến, hoặc là sự si mê che lấp trạng thái duyên khởi; nibbāne paṭilomabhāvo (trạng thái nghịch lý trong Niết Bàn) là sự hoan hỷ trong các hành, hoặc là sự si mê che lấp Niết Bàn.

Saṅkhāranimittaggāhoti yādisassa kilesassa appahīnattā vipassanā saṅkhāranimittaṃ na muñcati, so kileso, yo ‘‘saṃyogābhiniveso’’tipi vuccati.

Saṅkhāranimittaggāho (grasping of the sign of formations) refers to that defilement due to which, because it is not abandoned, insight does not release the sign of formations; it is also called "the obsession of fetters."

Saṅkhāranimittaggāho (sự chấp thủ tướng hành) là phiền não mà do sự chưa đoạn trừ của nó, tuệ quán không buông bỏ tướng hành; phiền não đó cũng được gọi là "saṃyogābhiniveso" (sự bám víu vào các kiết sử).

Saṅkhāranimittaggahaṇassa atikkamanameva vā pahānaṃ.

Or, the transcendence of grasping the sign of formations is pahānaṃ (abandonment).

Hoặc chính sự vượt qua sự chấp thủ tướng hành là pahānaṃ (sự đoạn trừ).

208

Pavatti eva pavattibhāvo, pariyuṭṭhānanti attho.

Activity itself is pavattibhāvo (the state of activity), meaning obsession.

Pavatti (sự tiếp diễn) eva pavattibhāvo (chính là trạng thái tiếp diễn), có nghĩa là sự vây hãm.

Nīvaraṇādidhammānanti ettha ādi-saddena nīvaraṇapakkhiyā kilesā vitakkavicārādayo ca gayhanti.

Here, in nīvaraṇādidhammānaṃ (of obstructive dhammas, etc.), the word ādi (etc.) includes defilements related to hindrances and thoughts, reflections, and so on.

Trong nīvaraṇādidhammānaṃ (của các pháp chướng ngại, v.v.), từ ādi (v.v.) bao gồm các phiền não thuộc phe chướng ngại và các tầm, tứ, v.v.

209

Catunnaṃ ariyamaggānaṃ bhāvitattā accantaṃ appavattibhāvena yaṃ pahānanti sambandho.

The connection is: "that abandonment which is due to the complete non-arising, because the four noble paths have been cultivated."

Sự đoạn trừ đó là sự liên kết, bằng cách làm cho chúng không bao giờ phát sinh do sự tu tập bốn Thánh Đạo.

Kena pahānanti?

By what abandonment?

Bằng cách nào mà sự đoạn trừ?

Ariyamaggehevāti viññāyamānoyamattho tesaṃ bhāvitattā appavattivacanato.

This meaning is understood as "by the noble paths" because of the statement of non-arising due to their cultivation.

Điều đó được hiểu là "bằng các Thánh Đạo", vì việc nói về sự không phát sinh của chúng là do sự tu tập các Thánh Đạo.

Samudayapakkhikassāti ettha cattāropi maggā catusaccābhisamayāti katvā tehi pahātabbena tena tena samudayena saha pahātabbattā samudayasabhāgattā, saccavibhaṅge ca sabbakilesānaṃ samudayabhāvassa vuttattā ‘‘samudayapakkhikā’’ti diṭṭhiādayo vuccanti.

In samudayapakkhikassa (of what belongs to the origin), since all four paths are an penetration of the four noble truths, and since defilements such as views are to be abandoned together with each corresponding origin and are of the nature of origin, and since in the analysis of truths, all defilements are stated to be the origin, they are called "belonging to the origin."

Trong samudayapakkhikassa (của phe tập khởi), vì cả bốn Đạo đều là sự chứng ngộ Tứ Diệu Đế, và vì chúng phải được đoạn trừ cùng với tập khởi tương ứng mà chúng phải đoạn trừ, và vì chúng có bản chất của tập khởi, và vì trong Vibhaṅga về các sự thật đã nói rằng tất cả các phiền não đều là bản chất của tập khởi, nên các kiến chấp, v.v., được gọi là "samudayapakkhikā" (thuộc phe tập khởi).

Paṭippassaddhattaṃ vupasantatā.

Paṭippassaddhattaṃ (being tranquillized) is being appeased.

Paṭippassaddhattaṃ là sự lắng dịu.

Saṅkhatanissaṭatā saṅkhārasabhāvābhāvo.

Saṅkhatanissaṭatā (being free from formations) is the absence of the nature of formations.

Saṅkhatanissaṭatā là sự không có bản chất của các hành.

Pahīnasabbasaṅkhatanti virahitasabbasaṅkhataṃ, visaṅkhāranti attho.

Pahīnasabbasaṅkhataṃ (abandoning all formations) means being devoid of all formations, meaning dis-formation (visaṅkhāra).

Pahīnasabbasaṅkhataṃ là không có tất cả các hành, có nghĩa là không hành.

Pahānañca taṃ vinayo cāti pahānavinayo purimena atthena, dutiyena pana pahīyatīti pahānaṃ, tassa vinayoti yojetabbaṃ.

Pahānavinayo (abandonment and subduing) is abandonment and subduing, according to the first meaning; according to the second, it should be connected as 'abandonment' because it is abandoned, and 'subduing' of that.

Sự đoạn trừ và sự điều phục là pahānavinayo theo nghĩa trước; còn theo nghĩa thứ hai, sự đoạn trừ là cái được đoạn trừ, và sự điều phục của nó nên được kết hợp.

210

Bhinnasaṃvarattāti naṭṭhasaṃvarattā, saṃvarābhāvatoti attho.

Bhinnasaṃvarattā (due to broken restraint) means due to destroyed restraint, meaning due to the absence of restraint.

Bhinnasaṃvarattā (do sự phá vỡ giới luật) có nghĩa là do sự hủy hoại giới luật, do không có giới luật.

Tena asamādinnasaṃvaropi saṅgahito hoti.

Thereby, one who has not undertaken restraint is also included.

Do đó, người chưa thọ giới cũng được bao gồm.

Samādānena hi sampādetabbo saṃvaro tadabhāve na hotīti.

For, the restraint that should be accomplished by undertaking it does not exist in its absence.

Vì giới luật phải được hoàn thành bằng sự thọ nhận, nên nếu không có sự thọ nhận thì giới luật không tồn tại.

Evañhi loke vattāro honti ‘‘mahā vata no bhogo, so naṭṭho tathā akatattā’’ti.

Indeed, people in the world say, "Alas, our great wealth is destroyed because it was not done so."

Quả thật, người đời thường nói như vậy: "Tài sản của chúng ta thật lớn lao, nhưng nó đã bị hủy hoại vì không được làm như vậy."

Ariyeti ariyo.

Ariye means noble one.

Ariye có nghĩa là bậc Thánh.

Paccattavacanañhetaṃ.

This is a nominative singular form.

Đây là từ ở số ít.

Eseseti eso so eva, atthato anaññoti attho.

Esese means 'that very one', meaning not different in essence.

Esese có nghĩa là chính cái đó, về mặt ý nghĩa thì không khác.

Tajjāteti atthato taṃsabhāvo, sappuriso ariyasabhāvo, ariyo ca sappurisasabhāvoti attho.

Tajjāte (of that kind) means of that nature in essence: a good person is of noble nature, and a noble one is of good person's nature; such is the meaning.

Tajjāte có nghĩa là về mặt ý nghĩa là bản chất của cái đó, người thiện là bản chất của bậc Thánh, và bậc Thánh là bản chất của người thiện.

211

Taṃ atthanti ‘‘sabbadhammamūlapariyāya’’nti evaṃ vuttamatthaṃ.

Taṃ atthaṃ (that meaning) refers to the meaning stated as "the root discourse of all dhammas."

Taṃ atthaṃ (ý nghĩa đó) có nghĩa là ý nghĩa đã được nói như "căn bản của tất cả các pháp".

Kasmā panettha puggalādhiṭṭhānā desanā katāti?

Why is the teaching here given based on individuals?

Tại sao ở đây sự thuyết giảng lại được thực hiện dựa trên cá nhân?

Yadettha vattabbaṃ, taṃ ‘‘yasmā puthujjano apariññātavatthuko’’tiādinā (ma. ni. aṭṭha. 1.2) sayameva vakkhati.

What needs to be said in this regard, he himself will explain beginning with "Because an ordinary person has not comprehended the object," and so on.

Điều gì cần nói ở đây, chính người ấy sẽ nói rõ trong chú giải (ma. ni. aṭṭha. 1.2) với các từ như "vì phàm phu là người chưa hiểu rõ đối tượng", v.v.

Dhammo adhiṭṭhānaṃ etissāti dhammādhiṭṭhānā, sabhāvadhamme nissāya pavattitadesanā.

The Dhamma is its basis, therefore it is Dhamma-based (dhammādhiṭṭhānā); a teaching that proceeds relying on intrinsic phenomena.

Pháp là y cứ của điều này, nên gọi là pháp y cứ (dhammādhiṭṭhānā), tức là lời thuyết giảng dựa trên các pháp tự tánh.

Dhammavaseneva pavattā paṭhamā, puggalavasena uṭṭhahitvā puggalavaseneva gatā tatiyā, itarā dhammapuggalānaṃ vomissakavasena.

The first (teaching) proceeds solely by way of Dhamma; the third, having arisen by way of individuals, proceeds solely by way of individuals; the other (second) is by way of a mixture of Dhamma and individuals.

Loại thứ nhất được thuyết giảng chỉ theo phương diện pháp; loại thứ ba khởi lên từ phương diện cá nhân và đi theo phương diện cá nhân; còn loại kia là sự pha trộn giữa pháp và cá nhân.

Kasmā pana bhagavā evaṃ vibhāgena dhammaṃ desetīti?

But why does the Blessed One teach the Dhamma with such a division?

Vì sao Thế Tôn lại thuyết giảng Pháp theo cách phân chia như vậy?

Veneyyajjhāsayena desanāvilāsena ca.

Due to the disposition of those to be trained and the skillfulness of the teaching.

Là do căn cơ của người có thể được giáo hóa và do sự khéo léo trong thuyết giảng.

Ye hi veneyyā dhammādhiṭṭhānāya dhammadesanāya sukhena atthaṃ paṭivijjhanti, tesaṃ tathā dhammaṃ deseti.

For, to those trainees who easily comprehend the meaning through a Dhamma-based Dhamma teaching, he teaches the Dhamma in that manner.

Những người có thể được giáo hóa nào dễ dàng thấu hiểu ý nghĩa qua lời thuyết giảng pháp y cứ, Ngài thuyết Pháp cho họ như vậy.

Esa nayo sabbattha.

This method applies everywhere.

Nguyên tắc này áp dụng cho mọi trường hợp.

Yassā ca dhammadhātuyā suppaṭividdhattā desanāvilāsappatto hoti, sāyaṃ suppaṭividdhā, tasmā desanāvilāsappatto dhammissaro dhammarājā yathā yathā icchati, tathā tathā dhammaṃ desetīti evaṃ iminā veneyyajjhāsayena desanāvilāsena ca evaṃ vibhāgena dhammaṃ desetīti veditabbo.

And that Dhamma-element, by the thorough understanding of which the skillfulness of teaching is attained, is thus thoroughly understood; therefore, the Lord of Dhamma, the King of Dhamma, who has attained skillfulness in teaching, teaches the Dhamma however he wishes. It should thus be understood that he teaches the Dhamma with such a division due to the disposition of those to be trained and the skillfulness of the teaching.

Và do sự thấu hiểu sâu sắc về yếu tố pháp (dhammadhātu) mà đạt được sự khéo léo trong thuyết giảng, điều này đã được thấu hiểu sâu sắc. Do đó, bậc Pháp chủ (Dhammissara), Pháp vương (Dhammarājā) đã đạt được sự khéo léo trong thuyết giảng, thuyết Pháp theo cách Ngài mong muốn. Như vậy, cần phải hiểu rằng Ngài thuyết Pháp theo cách phân chia như thế là do căn cơ của người có thể được giáo hóa và sự khéo léo trong thuyết giảng.

212

Chadhāturoti pathavidhātu āpo-tejo-vāyo-ākāsadhātu viññāṇadhātūti imesaṃ channaṃ dhātūnaṃ vasena chadhāturo.

Having six elements (chadhāturo) refers to having six elements by way of the earth element, water, fire, air, space, and consciousness elements.

Sáu giới (chadhāturo) là sáu giới: địa giới, thủy giới, hỏa giới, phong giới, không giới, và thức giới.

‘‘Cakkhunā rūpaṃ disvā somanassaṭṭhāniyaṃ rūpaṃ upavicaratī’’tiādinā (dī. ni. 3.324) vuttānaṃ channaṃ somanassūpavicārānaṃ, channaṃ domanassaupekkhūpavicārānañca vasena aṭṭhārasamanopavicāro.

Having eighteen mental investigations (aṭṭhārasamanopavicāro) by way of the six investigations of joy and the six investigations of sorrow and equanimity mentioned in "Seeing a form with the eye, one investigates a joyous form," and so on.

Mười tám loại tư duy liên quan đến ý (aṭṭhārasamanopavicāro) là do sáu loại tư duy liên quan đến hỷ đã được nói đến, như “Khi thấy sắc bằng mắt, tư duy liên quan đến sắc đáng hỷ” và sáu loại tư duy liên quan đến ưu và sáu loại tư duy liên quan đến xả.

Saccādhiṭṭhānādivasena caturādhiṭṭhāno.

Having four bases (caturādhiṭṭhāno) by way of the bases of truth, and so on.

Bốn loại y cứ (caturādhiṭṭhāno) là do y cứ vào chân lý, v.v.

Paññācakkhunā diṭṭhadhammikassa samparāyikassa ca atthassa adassanato andho, diṭṭhadhammikasseva dassanato ekacakkhu, dvinnampi dassanato dvicakkhu, veditabbo.

One who is blind (andho) is to be understood as one who does not see the present and future good with the eye of wisdom; one-eyed (ekacakkhu) as one who sees only the present good; two-eyed (dvicakkhu) as one who sees both.

Cần phải hiểu rằng: mù (andho) là do không thấy lợi ích hiện tại và tương lai bằng tuệ nhãn; một mắt (ekacakkhu) là do chỉ thấy lợi ích hiện tại; hai mắt (dvicakkhu) là do thấy cả hai.

213

Svāyaṃ niddisīti sambandho.

It is connected as "He declared."

Vị ấy đã chỉ dạy – là sự liên kết.

Svāyanti ca so ayaṃ, yathāvuttadesanāvibhāgakusalo bhagavāti attho.

So ayaṃ means "he, the Blessed One, skilled in the aforementioned division of teaching."

Vị ấy (svāyaṃ) có nghĩa là vị ấy, tức là Thế Tôn, bậc thiện xảo trong việc phân chia thuyết giảng như đã nói.

Apariññātavatthukoti tīhi pariññāhi apariññātakkhandho.

One whose foundation is not fully comprehended (apariññātavatthuko) refers to one whose aggregates are not fully comprehended by the three types of full comprehension.

Đối tượng chưa được liễu tri (apariññātavatthuko) là uẩn chưa được liễu tri bằng ba loại liễu tri.

Khandhā hi pariññātavatthu.

For the aggregates are fully comprehended foundations.

Vì các uẩn là đối tượng được liễu tri.

Apariññāmūlikāti parijānanābhāvanimittā tasmiṃ sati bhāvato.

Rooted in non-full comprehension (apariññāmūlikā) means that because of the absence of full comprehension, they exist when that (absence) is present.

Có gốc rễ từ sự không liễu tri (apariññāmūlikā) là do sự hiện hữu của nó khi có sự thiếu vắng của việc liễu tri.

Pariññānañhi avijjādayo kilesā paṭipakkhā tammūlikā ca sabbamaññanāti.

For ignorance and other defilements are opponents to full comprehension, and all conceit is rooted in them.

Vì các phiền não như vô minh là đối nghịch với sự liễu tri, và tất cả mọi sự cho là đều có gốc rễ từ chúng.

Ariyānaṃ adassāvīti ettha iti-saddo ādiattho.

In Ariyānaṃ adassāvī (not seeing noble ones), the word iti has the meaning of 'and so on'.

Ở đây, trong cụm từ không thấy các bậc Thánh (ariyānaṃ adassāvī), từ “iti” có nghĩa là “vân vân”.

Tena ‘‘ariyadhammassa akovido’’tiādikaṃ puthujanassa visesanabhāvena pavattaṃ pāḷisesaṃ gaṇhāti puthujjananiddesabhāvato.

Thereby, it embraces the remainder of the Pāli text, such as "unskilled in the Dhamma of the noble ones," which occurs as a specific characteristic of an ordinary person, because it is an explanation of an ordinary person.

Do đó, nó bao gồm phần còn lại của đoạn Pāḷi được dùng để mô tả phàm phu, như “không thiện xảo trong Pháp của bậc Thánh”, v.v., vì đó là sự chỉ định về phàm phu.

Tenāha ‘‘evaṃ puthujjanaṃ niddisī’’ti.

Therefore, he said, "Thus he described the ordinary person."

Vì vậy, Ngài nói “đã chỉ định phàm phu như vậy”.

214

Suttanikkhepavaṇṇanā niṭṭhitā.

The explanation of the Sutta's exposition is concluded.

Hoàn thành phần giải thích tóm tắt bài kinh.

215

Pathavīvāravaṇṇanā

Explanation of the Earth Chapter

Giải thích về địa giới

216

Tassāti puthujjanassa.

Of that refers to the ordinary person.

Của vị ấy (tassā) là của phàm phu.

Vasati ettha ārammaṇakaraṇavasenāti ārammaṇampi vatthūti vuccati pavattiṭṭhānabhāvatoti āha ‘‘pathavīādīsu vatthūsū’’ti.

That in which one dwells by way of the object and the cause of action, that object is also called foundation (vatthu) because it is the place of occurrence. Therefore, he says, "in the foundations such as earth (pathavīādīsu vatthūsu)."

Cái mà trú ngụ ở đây theo phương diện đối tượng và công cụ được gọi là đối tượng (vatthu) do là nơi phát sinh. Vì vậy, Ngài nói “trên các đối tượng như địa giới, v.v.”.

Sakkāyadhammānampi ārammaṇādinā satipi maññanāhetubhāve maññanāhetukatteneva tesaṃ nibbattitoti vuttaṃ ‘‘sabbasakkāyadhammajanitaṃ maññana’’nti.

Even though phenomena pertaining to personality view (sakkāyadhamma) have the characteristic of being the cause of conceit by way of being objects and so on, it is said "conceit generated by all phenomena pertaining to personality view (sabbasakkāyadhammajanitaṃ maññanaṃ)" because it arises due to them being the cause of conceit.

Mặc dù các pháp hữu thân (sakkāyadhamma) cũng là nguyên nhân của sự cho là theo phương diện đối tượng, v.v., nhưng sự cho là đó phát sinh từ việc chúng là nguyên nhân của sự cho là. Vì vậy, đã nói “sự cho là phát sinh từ tất cả các pháp hữu thân”.

Ettha ca pathavīdhātu sesadhātūnaṃ sasambhārāsambhārabhāvā satipi pamāṇato samabhāve sāmatthiyato adhikānadhikabhāvena veditabbā.

Here, the earth element, even if equal in measure to the other elements due to their composite and non-composite nature, should be understood as superior or inferior in power.

Ở đây, địa giới so với các giới khác, dù có cùng số lượng, nhưng cần phải hiểu là có sự hơn kém về năng lực do là có các yếu tố cấu thành và không có các yếu tố cấu thành.

Sambhārantīti sambhārā, parivārā.

Sambhārā means that which is gathered, i.e., accessories.

Những gì cấu thành nên gọi là các yếu tố cấu thành (sambhārā), tức là các thành phần phụ thuộc.

Taṃtaṃkalāpehi lakkhaṇapathaviyā sesadhammā yathārahaṃ paccayabhāvena parivārabhāvena ca pavattanti.

The other phenomena proceed as conditions and as accessories, appropriately, to the characteristic earth element in their respective kalāpas (units).

Các pháp khác, tùy theo từng cụm, phát sinh như là duyên và như là thành phần phụ thuộc của địa giới theo đặc tính của nó.

Tenāha ‘‘sā hi vaṇṇādīhi sambhārehi saddhiṃ pathavīti sasambhārapathavī’’ti.

Therefore, he says, "That earth with its accessories such as color and so on, is composite earth (sasambhārapathavī)."

Vì vậy, Ngài nói “Đó là địa giới có các yếu tố cấu thành, vì nó có các yếu tố cấu thành như màu sắc, v.v.”.

Pathavitoti ettha puthulaṭṭhena puthuvī, puthuvī eva pathavī.

In Pathavito, puthuvī means "broad" by the meaning of breadth, and puthuvī itself is pathavī.

Trong cụm từ từ địa giới (pathavito), “puthuvī” là rộng lớn, “puthuvī” chính là “pathavī”.

Sā hi satipi paricchinnavuttiyaṃ sabbesaṃ sakalāpabhāvānaṃ ādhārabhāvena pavattamānā puthulā patthaṭā vitthiṇṇāti vattabbataṃ arahati, na pana taṃ anupavisitvā pavattamānā āpādayo.

Though it exists in a limited sphere, as it functions as the basis for all composite phenomena, it deserves to be called broad, spread out, and extensive; but not water and so on, which exist by entering into it.

Mặc dù có sự giới hạn trong hoạt động, nhưng nó xứng đáng được gọi là rộng lớn, trải rộng, bao la vì nó là nền tảng cho tất cả các cụm pháp. Còn các giới như thủy giới, v.v., không đi vào trong nó thì không thể nói như vậy.

Sasambhārapathaviyā pana puthulabhāve vattabbameva natthi.

However, there is no need to speak of the breadth of composite earth.

Đối với địa giới có các yếu tố cấu thành thì không cần phải nói về sự rộng lớn của nó.

Ārammaṇapathaviyaṃ vaḍḍhanapharaṇaṭṭhehi puthulaṭṭho, itarasmiṃ ruḷhiyāva daṭṭhabbo.

In the case of earth as an object (ārammaṇapathavī), "broad" refers to the aspects of growing and pervading; in other cases, it should be seen as a conventional term.

Trong địa giới làm đối tượng, sự rộng lớn được thấy qua khía cạnh phát triển và lan tỏa; trong trường hợp khác, nó được thấy qua nghĩa thông thường.

Ārammaṇapathavīti jhānassa ārammaṇabhūtaṃ pathavīsaṅkhātaṃ paṭibhāganimittaṃ.

Earth as an object (ārammaṇapathavī) refers to the counter-image (paṭibhāganimitta) called earth, which is the object of jhāna.

Địa giới làm đối tượng (ārammaṇapathavī) là tướng đối phần (paṭibhāganimitta) được gọi là địa giới, là đối tượng của thiền định.

Tenāha ‘‘nimittapathavītipi vuccatī’’ti.

Therefore, he says, "It is also called nimitta-earth (nimittapathavī)."

Vì vậy, Ngài nói “cũng được gọi là tướng địa giới (nimittapathavī)”.

Āgamanavasenāti pathavīkasiṇabhāvanāgamanavasena.

By way of coming (āgamanavasena) refers to the coming into being of the earth kasiṇa meditation.

Theo cách đến (āgamanavasena) là theo cách đến của sự tu tập địa biến xứ (pathavīkasiṇa).

Tathā hi vuttaṃ ‘‘āpo ca devā pathavī, tejo vāyo tadāgamu’’nti (dī. ni. 2.340).

For it is said, "Water, O deities, and earth, fire, air — they then came."

Như đã nói: “Này chư thiên, thủy giới và địa giới, hỏa giới và phong giới đã đến đó”.

217

Sabbāpīti catubbidhā pathavīpi.

All (sabbāpi) refers to all four kinds of earth.

Tất cả (sabbāpī) là cả bốn loại địa giới.

Anussavādimattaladdhā maññanā vatthu hotiyeva.

Conceit, obtained merely through hearsay and so on, is indeed an object.

Sự cho là chỉ đạt được qua lời truyền tụng, v.v., cũng là đối tượng.

Tathā hi ‘‘kakkhaḷaṃ kharigata’’ntiādinā (vibha. 173) lakkhaṇapathavīpi uddharīyati.

For thus, characteristic earth is also quoted by "hard and solidified" and so on.

Như đã nói, địa giới theo đặc tính cũng được đề cập là “cứng rắn, thô cứng”, v.v.

Yaṃ paneke vadanti ‘‘lakkhaṇe diṭṭhe maññanā natthi, sañjānātīti vuttasaññā ca diṭṭhiggāhassa mūlabhūtā piṇḍaggāhitā, sā lakkhaṇe nakkhamati, tasmā lakkhaṇapathavī na gahetabbā’’ti, tadayuttaṃ lakkhaṇapaṭivedhassa idha anadhippetattā.

But what some say — "When a characteristic is seen, there is no conceit; and the perception stated as 'one perceives' (sañjānāti) is the aggregate apprehension (piṇḍaggāhitā) which is the root of perception-grasping, and that does not apply to the characteristic; therefore, characteristic earth should not be taken" — is inappropriate, as the penetration of characteristics is not intended here.

Nhưng một số người nói rằng: “Khi thấy đặc tính, không có sự cho là; và tưởng (saññā) được nói là ‘nhận biết’ là sự nắm bắt tổng thể, là gốc rễ của sự chấp kiến, điều đó không phù hợp với đặc tính. Vì vậy, không nên lấy địa giới theo đặc tính.” Điều đó không đúng, vì sự thâm nhập đặc tính không phải là điều được đề cập ở đây.

Tenāha ‘‘lokavohāraṃ gahetvā’’ti.

Therefore, he says, "taking conventional usage (lokavohāraṃ gahetvā)."

Vì vậy, Ngài nói “lấy cách nói thông thường của thế gian”.

Na ca sabbasaññā piṇḍaggāhikā, nāpi diṭṭhiggāhasseva mūlabhūtā, tasmā lakkhaṇapathaviyāpi kāyadvārānusārena aññathā ca upaṭṭhitāya maññanā pavattateva.

And not all perception is aggregate apprehension, nor is it solely the root of perception-grasping; therefore, conceit arises even regarding characteristic earth when it presents itself through the door of the body or otherwise.

Không phải tất cả tưởng đều là nắm bắt tổng thể, cũng không phải chỉ là gốc rễ của sự chấp kiến. Vì vậy, ngay cả đối với địa giới theo đặc tính, khi nó hiện hữu qua cửa thân và theo cách khác, sự cho là vẫn phát sinh.

Teneva ca ‘‘anussavādimattaladdhā’’ti vuttaṃ.

And for this reason, it was said, "obtained merely through hearsay and so on."

Và chính vì thế mà đã nói “chỉ đạt được qua lời truyền tụng, v.v.”.

Pathavitoti paccate nissakkavacananti dassento ‘‘pathavīti sañjānātī’’ti āha.

Indicating that Pathavito is a ablative case word, he says, "perceives as earth (pathavīti sañjānāti)."

Để chỉ ra rằng “từ địa giới (pathavito)” là cách nói của ngữ cách xuất xứ, Ngài nói “nhận biết là địa giới (pathavīti sañjānātī)”.

Yasmā catubbidhampi pathaviṃ ‘‘pathavī’ti sañjānanto tena tena nayena pathavīkoṭṭhāseneva sañjānātīti vuccati, na āpādikoṭṭhāsena, tasmā vuttaṃ ‘‘pathavibhāgena sañjānātī’’ti.

Since one who perceives all four kinds of earth as "earth" is said to perceive it in terms of the earth-portion in that particular way, not in terms of the water-portion, it is said, "perceives by way of the earth-aspect (pathavibhāgena sañjānātī)."

Vì khi một người nhận biết cả bốn loại địa giới là “địa giới”, người ấy được nói là nhận biết theo từng phần của địa giới, chứ không phải theo phần của thủy giới, v.v. Vì vậy, đã nói “nhận biết theo phần địa giới”.

Lokavohāraṃ gahetvāti lokasamaññaṃ avijahitvā.

Taking conventional usage (lokavohāraṃ gahetvā) means not abandoning worldly designation.

Lấy cách nói thông thường của thế gian (lokavohāraṃ gahetvā) là không từ bỏ cách gọi thông thường của thế gian.

Etena lakkhaṇapathaviyampi vohāramukhenevassā pavattīti dasseti.

By this, he shows that its occurrence, even in characteristic earth, is through the avenue of convention.

Với điều này, Ngài chỉ ra rằng ngay cả đối với địa giới theo đặc tính, sự hoạt động của nó cũng là thông qua cách nói thông thường.

218

Yadi lokavohārena tattha pavatti, ko ettha doso, nanu ariyāpi ‘‘ayañhi bhante mahāpathavī’’tiādinā lokavohārena pavattantīti?

If it occurs there by worldly convention, what fault is there in this? Do not even the noble ones use worldly convention, saying, "Indeed, venerable sir, this great earth," and so on?

Nếu sự hoạt động ở đó là theo cách nói thông thường của thế gian, thì có lỗi gì ở đây? Chẳng phải các bậc Thánh cũng nói theo cách nói thông thường của thế gian, như “Này chư Tỳ-kheo, đại địa này”, v.v., sao?

Na ettha vohāramatte avaṭṭhānaṃ adhippetaṃ, atha kho vohāramukhena micchābhinivesoti dassento ‘‘saññāvipallāsena sañjānātī’’ti āha.

It is not merely the dwelling upon convention that is intended here, but rather a wrong adherence through the avenue of convention; showing this, he says, "perceives with perversion of perception (saññāvipallāsena sañjānātī)."

Ở đây, không phải chỉ dừng lại ở cách nói thông thường là điều được đề cập, mà là sự chấp thủ sai lầm thông qua cách nói thông thường. Vì vậy, Ngài nói “nhận biết bằng tưởng điên đảo (saññāvipallāsena sañjānātī)”.

Tassattho – ayonisomanasikārasambhūtāya ‘‘subha’’ntiādinayappavattāya viparītasaññāya sañjānātīti.

Its meaning is: one perceives with a perverted perception, arisen from unwise attention, proceeding in the manner of "beautiful" and so on.

Ý nghĩa của điều đó là: nhận biết bằng tưởng sai lệch, phát sinh từ tác ý không như lý (ayoniso manasikāra), theo cách như “đẹp”, v.v.

Etena dubbalā taṇhāmānadiṭṭhimaññanā dassitāti daṭṭhabbaṃ.

By this, it should be understood that weak conceit of craving, pride, and views are shown.

Với điều này, cần phải hiểu rằng sự cho là (maññanā) yếu kém của tham ái, kiêu mạn, tà kiến đã được chỉ ra.

Yadi evaṃ kasmā saññā gahitāti?

If so, why is perception taken?

Nếu vậy, vì sao lại lấy tưởng (saññā)?

Pākaṭabhāvato.

Because of its conspicuousness.

Vì sự rõ ràng của nó.

Yathā nāma aggimhi mathiyamāne yadā dhūmo upalabbhati, kiñcāpi tadā vijjateva pāvako avinābhāvato, pākaṭabhāvato pana dhūmo jātoti vuccati, na aggi jātoti, evaṃsampadamidaṃ daṭṭhabbaṃ.

Just as when fire is being rubbed, when smoke is detected, although fire is present due to its inseparability, it is said that smoke has arisen due to its conspicuousness, not that fire has arisen. This should be understood similarly.

Ví như khi lửa được cọ xát, khi khói xuất hiện, mặc dù lửa vẫn tồn tại do không thể tách rời, nhưng người ta nói khói đã sinh ra chứ không nói lửa đã sinh ra vì sự rõ ràng của khói. Điều này cũng tương tự như vậy.

Yadipi tattha maññanākiccaṃ atthi, na pana vibhūtaṃ apākaṭabhāvato saññākiccameva vibhūtaṃ, taṃ pana maññanānukūlaṃ maññanāsahitaṃ cāti āha ‘‘saññāvipallāsena sañjānātī’’ti.

Even though the function of conceit is present there, it is not evident due to its inconspicuousness; only the function of perception is evident, and that is conducive to conceit and accompanied by conceit. Therefore, he says, "perceives with perversion of perception (saññāvipallāsena sañjānātī)."

Mặc dù ở đó có hành động của sự cho là (maññanākiccaṃ), nhưng nó không rõ ràng vì không hiển lộ. Chỉ có hành động của tưởng (saññākiccaṃ) là rõ ràng, và điều đó phù hợp với sự cho là, đi kèm với sự cho là. Vì vậy, Ngài nói “nhận biết bằng tưởng điên đảo”.

Evaṃ pathavībhāgaṃ amuñcantoyeva vā sañjānātīti sambandho.

Thus, the connection is "or one perceives without abandoning the earth aspect itself."

Như vậy, sự liên kết là: nhận biết mà không rời bỏ phần địa giới.

Yo hi vuttappabhedāya pathaviyā pathavibhāgaṃ amuñcantoyeva avijahantoyeva sīsapiṇḍe suvaṇṇasaññī viya anattādisabhāvaṃyeva taṃ attādivasena sañjānāti, tassa vasena vuttaṃ ‘‘pathavī’’tiādi.

Indeed, whoever, with regard to the earth of the stated classifications, without discarding or abandoning the earth element, like one who perceives gold in a lump of lead, perceives that very element, which has the nature of non-self and so on, as self and so on; it is with reference to such a person that "earth" and so on is said.

Người nào, đối với đất đã được phân loại như đã nói, không buông bỏ, không từ bỏ phần đất, mà nhận thức cái bản chất vô ngã, v.v., là ngã, v.v., giống như người nhận lầm cục chì là vàng, thì vì người đó mà đã nói "đất", v.v.

Na vattabbaṃ puthujjanaggāhassa yuttimaggananivāraṇatoti dassento āha ‘‘ummattako viya…pe… gaṇhātī’’ti.

Showing that it should not be said that it is for the purpose of preventing the ordinary person's erroneous grasp from seeking a valid path, he says, "like a madman... etc. ... grasps."

Để chỉ ra rằng không nên nói sự chấp thủ của phàm phu ngăn cản con đường hợp lý, đã nói "giống như người điên...v.v... nắm giữ."

Ariyānaṃ adassāvitādibhedanti ariyānaṃ adassāvitādivisesaṃ vadantena bhagavatāva ettha yathāvuttasañjānane kāraṇaṃ vuttanti yojanā.

The connection is that the Blessed One himself, when speaking of the special qualities of not seeing, etc., among the Noble Ones, stated the reason for such a perception as mentioned here, namely, "the distinction of not seeing, etc., for the Noble Ones."

"Phân biệt của các bậc Thánh" v.v. là sự kết hợp rằng chính Đức Thế Tôn, khi nói về sự đặc biệt của các bậc Thánh như không thấy, v.v., đã nói về lý do cho sự nhận thức như đã nói ở đây.

219

Evanti ‘‘pathavibhāgena sañjānātī’’tiādinā vuttappakārena.

Thus means in the manner stated, beginning with "perceives by means of the earth element."

"Như vậy" là theo cách đã nói bằng "nhận thức theo phần đất", v.v.

Sañjānitvāti pubbakālakiriyāniddesoti āha ‘‘aparabhāge…pe… gaṇhātī’’ti.

Having perceived is a reference to a preceding action, so he says, "in a later stage... etc. ... grasps."

"Sau khi nhận thức" là chỉ định hành động quá khứ, nên đã nói "trong phần sau...v.v... nắm giữ."

Papañcasaṅkhāti papañcakoṭṭhāsā.

Papañca-saṅkhā means divisions of papañca.

"Các phần của papañca" là các phần của papañca.

Papañcanti sattā saṃsāre cirāyanti etehīti papañcā, maññanti ‘‘etaṃ mamā’’tiādinā parikappenti etāhīti maññanāti dvīhipi pariyāyehi taṇhādayova vuttāti āha ‘‘taṇhāmānadiṭṭhipapañcehi idha maññanānāmena vuttehī’’ti.

Because beings remain long in saṃsāra through these, they are papañca. Because they conceive, "this is mine" and so on, by these, they are maññanā (conceiving); thus, by both these terms, only craving and so on are spoken of, so he says, "by the papañcas of craving, conceit, and wrong view, which are here called maññanā."

Chúng sinh tồn tại lâu dài trong luân hồi nhờ chúng, nên chúng là papañca; chúng sinh tưởng tượng "cái này là của tôi", v.v., nhờ chúng, nên chúng là maññanā (sự tưởng tượng). Đã nói rằng bằng cả hai cách này, chỉ có tham, mạn, v.v., được nói đến, nên đã nói "bằng các papañca là tham, mạn, tà kiến, ở đây được gọi bằng tên maññanā."

Ajaññassa jaññato, aseyyādikassa seyyādito gahaṇato diṭṭhimaññanā viya taṇhāmānamaññanāpi aññathā gāho evāti āha ‘‘aññathā gaṇhātī’’ti.

Just as wrong view (diṭṭhi-maññanā) is a misconception from perceiving the ignoble as noble, the inferior as superior, etc., so too is craving and conceit (taṇhā-māna-maññanā) a misconception. Thus, he says, "misconceives."

Vì sự chấp thủ về tham và mạn cũng là sự chấp thủ sai lầm, giống như chấp thủ tà kiến, do chấp thủ cái không biết là biết, cái không cao quý là cao quý, v.v., nên đã nói "nắm giữ một cách khác."

Ārammaṇābhiniropanādinā bhinnasabhāvānampi vitakkādīnaṃ sādhāraṇo upanijjhāyanasabhāvo viya anugijjhanuṇṇatiparāmasanasabhāvānampi taṇhādīnaṃ sādhāraṇena ārammaṇaparikappanākārena pavatti maññanāti daṭṭhabbaṃ.

It should be understood that maññanā is the common way craving and so on, whose natures are coveting, elation, and clinging, manifest through the common mode of conceiving objects, similar to how thinking and so on, though differing in nature due to their focusing on objects, have a common nature of close observation.

Cần phải hiểu rằng maññanā là sự diễn tiến của tham, v.v., với cách thức tưởng tượng đối tượng chung, giống như bản chất quán sát chung của tầm, v.v., dù có bản chất khác nhau do sự áp đặt đối tượng, v.v., và bản chất của sự khát khao, sự kiêu ngạo, sự chấp thủ.

Tenāha ‘‘tīhi maññanāhi maññatī’’tiādi.

Therefore, he says, "he conceives with three kinds of conceiving" and so on.

Vì vậy, đã nói "tưởng tượng bằng ba sự tưởng tượng" v.v.

Assāti puthujjanassa, udayabbayānupassanādīsu viya sukhumanayenapi maññanāpavatti atthīti vibhāvanasukhatāya thūlaṃyeva taṃ dassetukāmo ‘‘oḷārikanayenā’’tiāha.

For him (assā), that is, for the ordinary person. To show that the manifestation of conceiving also occurs subtly, as in contemplating rise and fall and so on, and being desirous of ease of elucidation, he says, "in a gross manner."

"Của người đó" là của phàm phu. Có sự diễn tiến của maññanā ngay cả theo cách vi tế, giống như trong sự quán chiếu sinh diệt, v.v. Để dễ dàng làm rõ điều đó, muốn chỉ ra điều thô thiển, nên đã nói "theo cách thô thiển."

Oḷārike hi vibhāge dassite sukhumavibhāvanā sukarāti dassetuṃ ayamatthayojanā vuccatīti sambandho.

The connection is that this explanation of meaning is stated to show that when gross divisions are presented, subtle elucidation becomes easy.

Liên quan đến điều này, để chỉ ra rằng khi các phần thô thiển được trình bày, sự làm rõ các phần vi tế sẽ dễ dàng, nên sự giải thích ý nghĩa này được nói đến.

Ajjhattikāti indriyabaddhā sattasantānapariyāpannā niyakajjhattā vuttā vibhaṅge paṭisambhidāmagge ca.

Internal refers to that which is bound to the faculties, belonging to the continuum of beings, one's own internal, stated in the Vibhaṅga and the Paṭisambhidāmagga.

"Nội tại" là những gì bị ràng buộc bởi các căn, thuộc dòng chảy của chúng sinh, thuộc về bản thân, đã được nói đến trong Vibhaṅga và Paṭisambhidāmagga.

220

Vibhaṅgeti dhātuvibhaṅge (vibha. 173).

In the Vibhaṅga refers to the Dhātuvibhaṅga (Vibha. 173).

Trong Vibhaṅga là trong Dhātuvibhaṅga.

Bāhirāti anindriyabaddhā saṅkhārasantānapariyāpannā.

External refers to that which is not bound to the faculties, belonging to the continuum of formations.

"Bên ngoài" là những gì không bị ràng buộc bởi các căn, thuộc dòng chảy của các hành.

Kakkhaḷanti thaddhaṃ.

Hard means firm.

"Cứng rắn" là chắc chắn.

Kharigatanti pharusaṃ.

Rough means coarse.

"Thô ráp" là nhám.

Kakkhaḷabhāvo kakkhaḷattaṃ.

The state of being hard is hardness.

Bản chất cứng rắn là kakkhaḷattaṃ.

Kakkhaḷabhāvoti kakkhaḷasabhāvo.

Hardness means hard nature.

"Bản chất cứng rắn" là bản chất cứng rắn.

Bahiddhāti indriyabaddhato bahiddhābhūtaṃ.

External refers to that which is external to what is bound to the faculties.

"Bên ngoài" là cái nằm ngoài cái bị ràng buộc bởi các căn.

Anupādinnanti na upādinnaṃ.

Unappropriated means not appropriated.

"Không bị chấp thủ" là không bị chấp thủ.

Ayoti kāḷalohaṃ.

Iron means black iron.

"Ayo" là sắt đen.

Lohanti jātilohaṃ vijātilohaṃ kittimalohaṃ pisācalohanti catubbidhaṃ.

Metal is fourfold: natural metals, hybrid metals, artificial metals, and demon metals.

"Loha" là kim loại, có bốn loại: kim loại tự nhiên, kim loại không tự nhiên, kim loại nhân tạo, kim loại ma quỷ.

Tattha ayo sajjhu suvaṇṇaṃ tipu sīsaṃ tambalohaṃ vekantakalohanti imāni satta jātilohāni nāma.

Among these, iron, silver, gold, tin, lead, copper, and vekantaka metal are called natural metals.

Trong đó, sắt, bạc, vàng, thiếc, chì, đồng, vekantaka – bảy loại này được gọi là kim loại tự nhiên.

Nāganāsikālohaṃ vijātilohaṃ nāma.

Nāganāsikā metal is called hybrid metal.

Kim loại nāganāsikā được gọi là kim loại không tự nhiên.

Kaṃsalohaṃ vaṭṭalohaṃ ārakuṭanti tīṇi kittimalohāni nāma.

Bell metal (kaṃsaloha), vaṭṭaloha, and ārakuṭa are three artificial metals.

Đồng thau, đồng vụn, ārakuṭa – ba loại này được gọi là kim loại nhân tạo.

Morakkhakaṃ puthukaṃ malinakaṃ capalakaṃ salakaṃ āṭalaṃ bhattakaṃ dusilohanti aṭṭha pisācalohāni nāma.

Morakkhaka, puthuka, malinaka, capalaka, salaka, āṭala, bhattaka, and dusiloha are eight demon metals.

Morakkhaka, puthuka, malinaka, capalaka, salaka, āṭala, bhattaka, dusiloha – tám loại này được gọi là kim loại ma quỷ.

Tesu vekantakalohaṃ nāma sabbalohacchedanasamatthā ekā lohajāti.

Among these, vekantaka metal is a type of metal capable of cutting all metals.

Trong số đó, kim loại vekantaka là một loại kim loại có khả năng cắt tất cả các loại kim loại khác.

Tathā hi taṃ vikantati chindatīti vikantakanti vuccati.

Indeed, it is called vikantaka because it cuts and severs.

Vì vậy, nó được gọi là vikantaka (cắt xuyên) vì nó cắt xuyên.

Vikantakameva vekantakaṃ.

Vikantaka itself is vekantaka.

Vikantaka chính là vekantaka.

Nāganāsikālohaṃ lohasadisaṃ lohavijāti haliddādivijāti viya.

Nāganāsikā metal is like metal, a hybrid metal, similar to a hybrid turmeric.

Kim loại nāganāsikā giống kim loại, là một loại kim loại không tự nhiên, giống như các loại nghệ, v.v.

Tathā hi taṃ lohākāraṃ lohamalaṃ viya ghanasaṃhataṃ hutvā tiṭṭhati, tāpetvā tāḷitaṃ pana bhinnaṃ bhinnaṃ hutvā visarati mudu maṭṭhaṃ kammaniyaṃ vā na hoti.

Indeed, it is solid and compact like metal dross, but when heated and hammered, it shatters into pieces and disperses; it is not soft, smooth, or workable.

Vì vậy, nó có hình dạng kim loại, tồn tại dưới dạng rắn đặc như cặn kim loại, nhưng khi nung nóng và đập, nó vỡ vụn và phân tán, không mềm, mịn hay dễ uốn.

Tiputambe missetvā kataṃ kaṃsalohaṃ.

Bell metal is made by mixing tin and copper.

Đồng thau được làm bằng cách trộn thiếc và đồng.

Sīsatambe missetvā kataṃ vaṭṭalohaṃ.

Vaṭṭaloha is made by mixing lead and copper.

Đồng vụn được làm bằng cách trộn chì và đồng.

Jasatambe missetvā kataṃ ārakuṭaṃ.

Ārakuṭa is made by mixing zinc and copper.

Ārakuṭa được làm bằng cách trộn kẽm và đồng.

Teneva taṃ karaṇena nibbattattā kittimalohanti vuccati.

Therefore, because it is produced by such making, it is called artificial metal.

Vì được tạo ra bằng cách đó, nên nó được gọi là kittimaloha (kim loại nhân tạo).

Yaṃ pana kevalaṃ rasakadhātu viniggataṃ, taṃ ‘‘pittala’’ntipi vadanti.

That which is purely extracted from quicksilver ore is also called "pittala" (brass).

Cái gì chỉ thoát ra từ khoáng chất rasaka, thì người ta cũng gọi là "pittala" (đồng vàng).

Taṃ idha nādhippetaṃ, yathāvuttaṃ missakameva katvā yojitaṃ kittimanti vuttaṃ.

That is not intended here; rather, the aforementioned mixture is considered artificial.

Điều đó không được đề cập ở đây; chỉ có sự pha trộn như đã nói được gọi là kittima (nhân tạo).

Morakkhakādīni evaṃnāmānevetāni.

Morakkhaka and so on are simply named thus.

Morakkhaka v.v. là những cái có tên như vậy.

Tesu yasmā pañca jātilohāni pāḷiyaṃ visuṃ vuttāneva, tasmā vekantakalohena saddhiṃ vuttāvasesaṃ sabbaṃ idha lohanti veditabbaṃ.

Among these, since five natural metals are separately mentioned in the Pāḷi, everything else mentioned with vekantaka metal here should be understood as metal.

Trong số đó, vì năm loại kim loại tự nhiên đã được nói riêng trong Pāḷi, nên tất cả những gì còn lại được nói cùng với kim loại vekantaka ở đây cần được hiểu là loha (kim loại).

221

Tipūti setatipu.

Tin means white tin.

"Tipū" là thiếc trắng.

Sīsanti kāḷatipu.

Lead means black tin.

"Sīsa" là thiếc đen (chì).

Sajjhanti rajataṃ.

Silver means rajata.

"Sajjha" là bạc.

Muttāti hatthikumbhajādikā aṭṭhavidhāpi muttā.

Pearls mean all eight kinds of pearls, such as those originating from elephant's temples.

"Muttā" là tám loại ngọc trai, như ngọc trai sinh ra từ bướu voi, v.v.

Tathā hi hatthikumbhaṃ varāhadāṭhā bhūjaṅgasīsaṃ valāhakūṭaṃ veḷū macchasīro saṅkho sippīti aṭṭha muttāyoniyo.

Indeed, the eight sources of pearls are: elephant's temple, boar's tusk, serpent's head, thundercloud, bamboo, fish's head, conch, and oyster.

Vì vậy, có tám nguồn ngọc trai: bướu voi, nanh heo rừng, đầu rắn, đỉnh mây, tre, đầu cá, vỏ ốc, vỏ sò.

Tattha hatthikumbhajā pītavaṇṇā pabhāhīnā.

Among these, elephant's temple-born pearls are yellow and lusterless.

Trong đó, ngọc trai sinh từ bướu voi có màu vàng, không sáng.

Varāhadāṭhā varāhadāṭhavaṇṇāva.

Boar's tusk-born pearls are exactly the color of a boar's tusk.

Ngọc trai sinh từ nanh heo rừng có màu giống nanh heo rừng.

Bhujaṅgasīsajā nīlādivaṇṇā suvisuddhā vaṭṭalā ca.

Serpent's head-born pearls are blue and so on in color, very pure, and round.

Ngọc trai sinh từ đầu rắn có màu xanh, v.v., rất tinh khiết và tròn.

Valāhakajā bhāsurā dubbibhāgarūpā rattibhāge andhakāraṃ vidhamantiyo tiṭṭhanti, devūpabhogā eva ca honti.

Cloud-born pearls are brilliant, indivisible in form, and stand dispelling darkness at night; they are for the use of devas.

Ngọc trai sinh từ mây sáng chói, khó phân biệt hình dạng, xua tan bóng tối vào ban đêm, và chỉ dành cho chư thiên sử dụng.

Veḷujā karakupalasamānavaṇṇā na bhāsurā, te ca veḷū amanussagocare eva padese jāyanti.

Bamboo-born pearls are the color of a rough stone, not brilliant, and those bamboos grow only in places frequented by non-humans.

Ngọc trai sinh từ tre có màu giống đá cuội, không sáng, và những cây tre đó chỉ mọc ở những nơi không có người.

Macchasīrajā pāṭhīnapiṭṭhisamānavaṇṇā vaṭṭalā laghavo ca honti pabhāvihīnā, te ca macchā samuddamajjhe eva jāyanti.

Fish's head-born pearls are the color of a fish's back, round, light, and lusterless; and those fish are born only in the middle of the ocean.

Ngọc trai sinh từ đầu cá có màu giống lưng cá lóc, tròn và nhẹ, không sáng, và những con cá đó chỉ sinh sống giữa biển.

Saṅkhajā saṅkhodaracchavivaṇṇā kolappamāṇāpi honti pabhāvihīnāva.

Conch-born pearls are the color of a conch shell, sometimes the size of a pigeon, and lusterless.

Ngọc trai sinh từ vỏ ốc có màu giống vỏ ốc, có thể lớn bằng quả táo, nhưng không sáng.

Sippijā pabhāvisesayuttā honti nānāsaṇṭhānā.

Oyster-born pearls possess special brilliance and come in various shapes.

Ngọc trai sinh từ vỏ sò có độ sáng đặc biệt và nhiều hình dạng khác nhau.

Evaṃ jātito aṭṭhavidhāsupi muttāsu yā macchasaṅkhasippijā, tā sāmuddikā honti, bhujaṅgajāpi kāci sāmuddikā honti, itarā asāmuddikā.

Thus, among the eight kinds of pearls by origin, those born from fish, conch, and oyster are oceanic; some born from serpents are also oceanic; the others are non-oceanic.

Trong số tám loại ngọc trai theo nguồn gốc như vậy, những loại sinh từ cá, ốc, sò là ngọc trai biển; một số loại sinh từ rắn cũng là ngọc trai biển; những loại khác không phải ngọc trai biển.

Yasmā bahulaṃ sāmuddikāva muttā loke dissanti, tatthāpi sippijāva, itarā kādācikā.

Since oceanic pearls are commonly seen in the world, and especially oyster-born pearls, while the others are occasional.

Vì ngọc trai biển thường được thấy trên thế gian, đặc biệt là ngọc trai sò, còn những loại khác thì hiếm khi gặp.

Tasmā sammohavinodaniyaṃ (vibha. aṭṭha. 173) ‘‘muttāti sāmuddikā muttā’’ti vuttaṃ.

Therefore, in the Sammohavinodanī (Vibha.aṭṭha. 173), it is said, "Pearl means an oceanic pearl."

Vì vậy, trong Sammohavinodanī (Vibha. Aṭṭha. 173) đã nói "muttā là ngọc trai biển."

222

Maṇīti ṭhapetvā pāḷiāgate veḷuriyādike seso jotirasādibhedo sabbopi maṇi.

Gem refers to all other gems of various kinds such as jotirasa, excluding those like beryl mentioned in the Pāḷi.

"Maṇī" là tất cả các loại đá quý khác, như jotirasa, v.v., ngoại trừ những loại như veḷuriya, v.v., đã được đề cập trong Pāḷi.

Veḷuriyanti vaṃsavaṇṇamaṇi.

Beryl means a bamboo-colored gem.

"Veḷuriya" là ngọc bích có màu tre.

Saṅkhoti sāmuddikasaṅkho.

Conch shell means an oceanic conch shell.

"Saṅkho" là ốc biển.

Silāti kāḷasilā paṇḍusilā setasilādibhedā aṭṭhapi silā.

Stone refers to all eight kinds of stone, such as black stone, pale stone, and white stone.

"Silā" là tám loại đá, như đá đen, đá vàng nhạt, đá trắng, v.v.

Rajatanti kahāpaṇādikaṃ vuttāvasesaṃ rajatasammataṃ.

Silver refers to that which is considered silver, such as kahāpaṇas, excluding what has already been mentioned.

"Rajata" là bạc được coi là bạc, ngoài những gì đã nói như kahāpaṇa, v.v.

Jātarūpanti suvaṇṇaṃ.

Gold means suvaṇṇa.

"Jātarūpa" là vàng.

Lohitaṅgoti rattamaṇi.

Coral means a red gem.

"Lohitaṅgo" là hồng ngọc.

Masāragallanti kabaramaṇi tiṇādīsu bahibhārā tālanāḷikerādayopi tiṇaṃ nāma.

Jasper means a variegated gem. Among grasses and so on, external heavy objects like palm trees and coconut trees are also called grass.

"Masāragalla" là đá quý lốm đốm. Trong số "cỏ" v.v., những loại có phần bên ngoài nặng như cây thốt nốt, cây dừa, v.v., cũng được gọi là tiṇaṃ (cỏ).

Antosāraṃ khadirādi antamaso dārukhaṇḍampi kaṭṭhaṃ nāma.

Wood with pith, like acacia, even a piece of timber, is called wood.

Cái có lõi bên trong như cây khaya, cho đến một mảnh gỗ nhỏ nhất cũng được gọi là kaṭṭhaṃ (gỗ).

Muggamattato yāva muṭṭhippamāṇā marumbā sakkharā nāma.

Gravel the size of a mung bean up to the size of a fist is called saccharine gravel.

Những viên sỏi từ kích thước hạt đậu xanh đến nắm tay được gọi là sakkharā.

Muggamattato paṭṭhāya heṭṭhā vālikā nāma.

From the size of a mung bean downwards, it is called sand.

Từ kích thước hạt đậu xanh trở xuống được gọi là cát.

Kaṭhalanti kapālakhaṇḍaṃ.

Potsherd means a piece of broken pottery.

"Kaṭhala" là mảnh sành.

Bhūmīti sasambhārapathavī.

Earth means earth with its constituents.

"Bhūmī" là đất với các thành phần của nó.

Pāsāṇoti antomuṭṭhiyaṃ asaṇṭhahanato paṭṭhāya yāva hatthippamāṇaṃ pāsāṇaṃ, hatthippamāṇato pana paṭṭhāya upari pabbatoti.

Rock refers to a stone from the size that cannot be held in the palm of the hand up to the size of a forearm; from the size of a forearm upwards, it is a mountain.

"Pāsāṇo" là đá từ kích thước không thể cầm gọn trong nắm tay cho đến kích thước bằng bàn tay; từ kích thước bằng bàn tay trở lên là pabbato (núi).

Ayaṃ ayoādīsu vibhāganiddeso.

This is the exposition of the analysis regarding iron, etc.

Đây là phần giải thích chi tiết về sắt và các loại khác.

Nimittapathavīti paṭibhāganimittabhūtaṃ pathavikasiṇaṃ.

Nimitta-paṭhavi (earth-sign) means the earth kasiṇa that has become the counter-sign (paṭibhāga-nimitta).

Địa tướng (nimittapathavī) là địa biến xứ (pathavikasiṇa) đã trở thành đối tướng (paṭibhāganimitta).

Tampi hi ‘‘rūpāvacaratikacatukkajjhānaṃ kusalato ca vipākato ca kiriyato ca catutthassa jhānassa vipāko ime dhammā bahiddhārammaṇā’’ti vacanato ‘‘bāhirā pathavī’’ti vuccati.

Indeed, even that is called "external earth" by the saying: "These phenomena, which are the vipāka (result) of the fourth jhāna, arising from the meritorious, resultant, and functional jhānas of the rūpāvacara (fine-material realm) threefold and fourfold divisions, have an external object."

Vì nó cũng được gọi là “đất bên ngoài” theo cách nói “các pháp này là quả của thiền thứ tư, thiện, dị thục và duy tác của tam thiền và tứ thiền sắc giới, là đối tượng bên ngoài.”

Tena vuttaṃ ‘‘yā ca ajjhattārammaṇattike nimittapathavī, taṃ gahetvā’’ti.

Therefore, it is said: " taking that earth-sign which is among the internal objects."

Do đó đã nói “lấy địa tướng thuộc về nội xứ”.

Uggahanimittañcettha taṃgatikameva daṭṭhabbaṃ, nimittuppattito pana pubbe bhūmiggahaṇeneva gahitanti.

Here, the apprehension sign (uggaha-nimitta) should be understood as belonging to the same category. However, before the arising of the sign, it is already taken by the apprehension of the ground itself.

Ở đây, thủ tướng (uggahanimitta) cũng nên được hiểu là thuộc về loại đó, nhưng trước khi tướng phát sinh, nó đã được nắm bắt bằng cách nắm bắt cảnh giới.

223

Tīhi maññanāhīti vuttaṃ maññanāttayaṃ saparasantānesu saṅkhepato yojetvā dassetuṃ ‘‘ahaṃ pathavī’’tiādi vuttaṃ.

To briefly illustrate the three kinds of perception (maññanā) mentioned as " by three perceptions," applying them to one's own and others' continuities, the phrase " I am earth" and so forth is stated.

Để giải thích ba loại tưởng (maññanāttaya) đã nói “bằng ba loại tưởng” bằng cách tóm tắt và phối hợp chúng trong tự thân và tha thân, câu “ta là đất” v.v. đã được nói.

Tattha ahaṃ pathavītiādīnā ajjhattavisayaṃ diṭṭhimaññanaṃ mānamaññanañca dasseti attābhinivesāhaṃkāradīpanato.

Here, " I am earth" and so forth indicate the perception of views (diṭṭhi-maññanā) and the perception of conceit (māna-maññanā) regarding the internal sphere, due to its elucidation of clinging to self and the conceit of "I."

Trong đó, các câu “ta là đất” v.v. chỉ ra tà kiến tưởng (diṭṭhimaññana) và ngã mạn tưởng (mānamaññana) liên quan đến nội xứ, vì chúng biểu thị sự chấp thủ vào ngã và ngã mạn.

Mama pathavīti iminā taṇhāmaññanaṃ mānamaññanampi vā pariggahabhūtāyapi pathaviyā seyyādito mānajappanato.

By " my earth," it indicates the perception of craving (taṇhā-maññanā), or even the perception of conceit (māna-maññanā), due to the reiteration of conceit regarding the earth, even if it is merely possessed, in terms of superiority, etc.

Bằng câu “đất của ta” này, chỉ ra ái tưởng (taṇhāmaññana) hoặc ngã mạn tưởng, vì nó biểu thị sự so sánh ngã mạn về đất đã được nắm giữ như là sở hữu, v.v.

Sesapadadvayepi iminānayena maññanāvibhāgo veditabbo.

The analysis of perception in the remaining two phrases should also be understood in this manner.

Trong hai từ còn lại cũng nên hiểu sự phân loại tưởng theo cách này.

Tattha pathavikasiṇajjhānalābhī jhānacakkhunā gahitajhānārammaṇaṃ ‘‘attā’’ti abhinivisanto tañca seyyādito dahanto atthato ‘‘ahaṃ pathavī’’ti maññati nāma, tameva ‘‘ayaṃ mayhaṃ attā’’ti gahaṇe pana ‘‘mama pathavī’’ti maññati nāma.

Here, one who has attained a kasiṇa-jhāna of earth, clinging to the jhāna-object apprehended by the jhāna-eye as "self," and considering it superior, etc., actually " perceives, 'I am earth,'" and when taking that very thing as "this is my self," he then " perceives, 'my earth.'"

Trong đó, người đắc thiền địa biến xứ, khi chấp thủ đối tượng thiền đã được nắm bắt bằng thiền nhãn là “ngã” và so sánh nó với các thứ hơn kém, thì thực chất là “tưởng rằng ta là đất”; còn khi nắm giữ nó là “đây là ngã của ta” thì là “tưởng rằng đất của ta”.

Tathā taṃ ‘‘parapuriso’’ti vā ‘‘devo’’ti vā vādavasena ‘‘ayameva paresaṃ attā’’ti vā abhinivisanto ‘‘paro pathavī, parassa pathavī’’ti maññati nāma.

Similarly, clinging to it as "another person" or "a deity," or asserting "this is indeed the self of others," he then " perceives, 'others are earth, earth belongs to others.'"

Tương tự, khi chấp thủ nó là “người khác” hoặc “chư thiên” hoặc “đây là ngã của người khác” theo cách nói, thì là “tưởng rằng người khác là đất, đất của người khác”.

Iminā nayena sesapathavīsupi yathārahaṃ catukkaṃ niddhāretabbaṃ.

In this manner, the tetrad should be determined appropriately for the remaining kinds of earth as well.

Theo cách này, trong các loại đất còn lại cũng nên xác định bốn loại một cách phù hợp.

224

Evaṃ ‘‘pathaviṃ maññatī’’ti ettha catukkavasena maññanaṃ dassetvā idāni maññanāvatthuṃ maññanāyo ca vibhajitvā anekavihitaṃ tassa maññanākāraṃ dassetuṃ ‘‘atha vā’’tiādimāha.

Having thus shown perception in terms of a tetrad in "perceives earth," he now states " or else" and so forth, to analyze the basis of perception and the modes of perception, and to show that kind of perception in many ways.

Như vậy, sau khi chỉ ra tưởng theo bốn loại trong cụm từ “tưởng về đất”, bây giờ để phân loại đối tượng của tưởng và các loại tưởng, và để chỉ ra nhiều loại hình thái tưởng của nó, đã nói “hoặc là” v.v.

Tattha ayanti yathāvutto puthujjano.

Here, this one means the ordinary person as described.

Trong đó, ayaṃ (này) là phàm phu như đã nói.

Chandarāganti bahalarāgaṃ.

Sensual desire means intense passion.

Chandarāgaṃ (dục ái) là tham ái mạnh mẽ.

Assādetīti nikāmeti, ‘‘ime kesā mudusiniddhakuñcitanīlobhāsā’’tiādinā tattha rasaṃ vindati.

Enjoys means delights in, finds flavor therein, as in "these hairs are soft, smooth, curly, and dark-lustrous."

Assādetī (nếm vị ngọt) là ưa thích, tìm thấy hương vị trong đó bằng cách nói “tóc này mềm mại, bóng mượt, xoăn, đen nhánh” v.v.

Abhinandatīti sappītikāya taṇhāya abhimukho nandati pamodati.

Rejoices in means rejoices with joy and delights in the presence of craving.

Abhinandatī (hoan hỷ) là hoan hỷ, vui mừng với ái có hỷ.

Abhivadatīti uppannaṃ taṇhābhinandanāvegaṃ hadayena sandhāretuṃ asakkonto ‘‘aho me kesā’’ti vācaṃ nicchāreti.

Expresses aloud means, unable to suppress the arising surge of craving and delight in his heart, he utters the words, "Oh, my hair!"

Abhivadatī (nói ra) là không thể kìm nén được sự hân hoan của ái đã phát sinh trong lòng, bèn thốt lên lời “Ôi tóc của ta!”

Ajjhosāya tiṭṭhatīti balavataṇhābhinivesena gilitvā pariniṭṭhāpetvā tiṭṭhati.

Clings fast means he swallows it with strong craving and attachment, and settles there.

Ajjhosāya tiṭṭhatī (an trú) là bị nuốt chửng bởi sự chấp thủ ái mạnh mẽ và an trú trong đó.

Aññataraṃ vā pana rajjanīyavatthunti kesādito aññataraṃ vā karacaraṇādippabhedaṃ niyakajjhattapariyāpannaṃ rāguppattihetubhūtaṃ vatthuṃ.

Or any other object giving rise to passion refers to any object other than hair, etc., such as hands and feet, which are included within one's own internal sphere and are causes for the arising of passion.

Aññataraṃ vā pana rajjanīyavatthu (hoặc bất kỳ đối tượng đáng tham ái nào khác) là bất kỳ đối tượng nào khác ngoài tóc, v.v., thuộc về nội thân của mình, như tay, chân, v.v., là nguyên nhân phát sinh tham ái.

Itīti iminā siniddhādippakārenāti patthayitabbākāraṃ parāmasati.

Thus refers to the desired characteristic, such as smoothness.

Itī (như vậy) là chỉ đến hình thái mong muốn theo cách mềm mại, v.v.

Tattha nandiṃ samannānetīti tesu bhāvīsu kesādīsu siddhaṃ viya katvā nandiṃ taṇhaṃ samannāharati samupacāreti.

Here, brings delight into being means he brings forth, he establishes, delight or craving, as if it had already manifested in those future hairs, etc.

Trong đó, nandiṃ samannānetī (tạo ra sự hoan hỷ) là tạo ra, tích lũy sự hoan hỷ, ái như thể đã thành tựu trong những thứ như tóc, v.v. sẽ có trong tương lai.

Paṇidahatīti patthanaṃ ṭhapeti.

Aspires means he makes an aspiration.

Paṇidahatī (đặt nguyện) là đặt ra sự mong ước.

225

Sampattiṃ nissāya ‘‘seyyohamasmī’’ti, vipattiṃ nissāya ‘‘hīnohamasmī’’ti mānaṃ janetīti yojanā.

The combination is: "relying on gain, he generates the conceit 'I am superior'; relying on loss, he generates the conceit 'I am inferior'."

Câu này được hiểu là: dựa vào sự thành tựu mà sinh ra ngã mạn “ta là hơn”, dựa vào sự thất bại mà sinh ra ngã mạn “ta là kém”.

Pathavīkoṭṭhāsabhūtānaṃ kesādīnaṃ sampattivipattīhi mānajappanā pathaviyā maññanā hotīti āha ‘‘evaṃ ajjhattikaṃ pathaviṃ mānamaññanāya maññatī’’ti.

He states, " Thus, one perceives the internal earth by the perception of conceit," meaning that the generation of conceit through the gain and loss of hairs, etc., which are parts of the earth, constitutes the perception of earth.

Sự so sánh ngã mạn qua sự thành tựu và thất bại của tóc, v.v., là những phần của đất, chính là tưởng về đất, do đó đã nói “như vậy, tưởng về đất nội thân bằng ngã mạn tưởng”.

Avayavabyatirekena samudāyassa abhāvato samudāyo jīvābhiniveso avayavepi hotīti dassento ‘‘taṃ jīvaṃ taṃ sarīranti āgatanayena pana kesaṃ ‘jīvo’ti abhinivisatī’’ti āha.

Since there is no aggregate apart from its constituents, the clinging to life in the aggregate also occurs in its constituents. Thus, he states, " In the manner of 'that is life, that is body,' one clings to hair as 'life'."

Vì không có tổng thể tách rời khỏi các bộ phận, nên sự chấp thủ sinh mạng vào tổng thể cũng có ở các bộ phận, do đó đã nói “theo cách ‘đó là sinh mạng, đó là thân’, chấp thủ tóc là ‘sinh mạng’”.

‘‘Kesā nāmete issaravihitā pajāpatinissitā aṇusañcayo pakatipariṇāmo’’tiādinā nayenapettha diṭṭhimaññanā veditabbā.

Here, the perception of views should also be understood in the manner of "These hairs are made by a creator god, depend on Prajāpati, are an aggregation of atoms, a transformation of nature," and so forth.

Ở đây, tà kiến tưởng (diṭṭhimaññanā) cũng nên được hiểu theo cách nói “tóc này là do đấng tối cao tạo ra, do Phạm thiên tạo ra, là sự tích tụ của các nguyên tử, là sự biến hóa của tự nhiên” v.v.

226

Imissā pavattiyāti nikantimānadiṭṭhīnaṃ pariyādānasamugghāṭappavattiyā.

Of this arising means of the arising of the eradication and utter destruction of craving, conceit, and wrong views.

Imissā pavattiyā (bằng sự diễn tiến này) là bằng sự diễn tiến của việc loại bỏ và nhổ bỏ ái, ngã mạn và tà kiến.

‘‘Etaṃ mamā’’tiādinā yadipi tissannampi maññanānaṃ sambhavo dassito.

Although the possibility of all three perceptions is shown by "This is mine," etc.

Mặc dù khả năng phát sinh cả ba loại tưởng đã được chỉ ra bằng câu “cái này là của ta” v.v.

Taṇhāmānamaññanānaṃ pana heṭṭhā dassitattā diṭṭhimaññanā evettha visesato uddhaṭāti veditabbaṃ.

However, since the perceptions of craving and conceit have been shown previously, it should be understood that the perception of views is especially highlighted here.

Nhưng vì ái tưởng và ngã mạn tưởng đã được chỉ ra ở dưới, nên nên hiểu rằng ở đây đặc biệt nhấn mạnh tà kiến tưởng.

Tenāha ‘‘evampi ajjhattikaṃ pathaviṃ diṭṭhimaññanāya maññatī’’ti.

Therefore, he states, " Thus, one also perceives the internal earth by the perception of views."

Do đó đã nói “như vậy, tưởng về đất nội thân bằng tà kiến tưởng”.

227

Bāhirampi pathaviṃ tīhi maññanāhi maññatīti yojanā.

The combination is: One perceives even external earth by the three perceptions.

Câu này được hiểu là: tưởng về đất ngoại thân bằng ba loại tưởng.

Taṃ pana maññanāvidhiṃ dassetuṃ ‘‘katha’’nti āha.

But to show that method of perception, he asks, " How?"

Nhưng để chỉ ra phương pháp tưởng đó, đã nói “làm sao?”.

Tassattho heṭṭhā vuttanayena veditabbo.

Its meaning should be understood in the manner stated previously.

Ý nghĩa của nó nên được hiểu theo cách đã nói ở dưới.

228

Ayaṃ jīvoti ayaṃ kāḷalohaṃ ‘‘jīvo attā’’ti abhinivisati ekacce nigaṇṭhā viya.

This life means this black iron, like some Jain ascetics, clings to "life, self."

Ayaṃ jīvo (sinh mạng này) là người này chấp thủ sắt đen là “sinh mạng, ngã” như một số Ni-kiền-tử (nigaṇṭhā).

Evaṃ bāhiraṃ pathaviṃ diṭṭhimaññanāya maññatīti etthāpi ‘‘yā ceva kho pana ajjhattikā pathavīdhātu, yā ca bāhirā pathavīdhātū’’tiādinā nayena ānetvā vattabbo.

The statement, " Thus, one perceives external earth by the perception of views," should also be introduced and explained in the manner of "Whatever internal earth element there is, and whatever external earth element there is," and so forth.

Trong câu “như vậy, tưởng về đất ngoại thân bằng tà kiến tưởng” này cũng nên được nói bằng cách dẫn giải theo cách “dù là địa đại nội thân hay địa đại ngoại thân” v.v.

229

Pathavīkasiṇaṃ attato samanupassatītiādīsu yaṃ vattabbaṃ, taṃ heṭṭhā vuttameva.

What needs to be said regarding "one regards the earth kasiṇa as self," etc., has already been said below.

Những gì cần nói trong các câu “quán sát địa biến xứ là tự ngã” v.v. thì đã nói ở dưới rồi.

Ayampi ca nayo ‘‘rūpaṃ attato samanupassatī’’ti ettheva antogadhoti daṭṭhabbo kasiṇānampi rūpasamaññāsambhāvato.

And this method should be understood as included within "one regards materiality as self," since kasiṇas can also be designated as materiality.

Và cách này cũng nên được hiểu là bao hàm trong câu “quán sát sắc là tự ngã”, vì các biến xứ cũng có thể được gọi là sắc.

Pathaviṃ maññatīti ettha yādiso maññanāvatthumaññanānaṃ vitthāranayo vutto, tādiso ito paraṃ vuttanayovāti āha ‘‘ito paraṃ saṅkhepeneva kathayissāmā’’ti, atādiso pana vitthāratopi kathayissatīti attho.

Regarding " perceives earth," he states, " From now on, we shall explain it concisely," implying that the detailed method of the basis of perception and perceptions described here will be followed; otherwise, he will explain it in detail.

Trong câu “tưởng về đất”, cách thức mở rộng đối tượng tưởng và các loại tưởng đã được nói, thì cách nói từ đây trở đi cũng tương tự, do đó đã nói “từ đây trở đi sẽ nói tóm tắt”, nghĩa là những gì không tương tự thì sẽ nói chi tiết.

230

Tasmāti yasmā ‘‘pathaviyā’’ti idaṃ bhummavacanaṃ, tasmā, so attaparattadupakaraṇānaṃ ādhārabhāvena taṃ maññanāvatthuṃ kappetīti attho.

Therefore, because "on earth" is in the locative case, he posits earth as the object of perception, as the basis for things related to oneself, others, and both.

Tasmā (do đó) là: vì “pathaviyā” là từ ở cách sở hữu, do đó, người đó tưởng tượng đối tượng tưởng đó như là nền tảng của tự thân, tha thân và các dụng cụ.

Tenāha ‘‘ahaṃ pathaviyā’’tiādi.

Therefore, he states, " I am on earth" and so forth.

Do đó đã nói “ta ở trên đất” v.v.

Nanu ca indriyabaddhānindriyabaddhapabhedassa dhammappabandhassa sasambhārapathavī ca ādhāranissayo, itarā ārammaṇanissayo tadārammaṇassāti ettha nibbirodhoti?

But is there no conflict here, that the earth with its constituents is the basis-support for the sequence of phenomena, both sentient and insentient, while the other (external earth) is the object-support for that object?

Chẳng phải địa đại cùng với các thành phần của nó là nền tảng và nương tựa cho dòng pháp có phân loại là có căn và không có căn, và địa đại kia là nương tựa cho đối tượng của nó, thì ở đây không có mâu thuẫn sao?

Na, maññanāvatthuṃ nissayabhāvena parikappanato.

No, because the object of perception is posited as a support.

Không, vì đối tượng của tưởng được giả định là nền tảng.

Ayañhi ‘‘aha’’nti diṭṭhimaññanāya mānamaññanāya ca vatthubhūtassa attano pathavisannissayaṃ katvā ‘‘ahaṃ pathaviyā’’ti maññati, taṇhāmaññanāya vatthubhūtassa upakaraṇassa pathaviṃ sannissayaṃ katvā ‘‘mayhaṃ kiñcanaṃ palibodho pathaviyā’’ti maññati.

This person, taking his own self, which is the basis for the perception of views and the perception of conceit, to be dependent on earth, " perceives, 'I am on earth'"; and taking the earth, which is the basis for the perception of craving, to be dependent on equipment, " perceives, 'my possessions, my impediments, are on earth'."

Người này, khi lấy đất làm nương tựa cho tự ngã là đối tượng của tà kiến tưởng và ngã mạn tưởng “ta”, thì tưởng rằng “ta ở trên đất”; khi lấy đất làm nương tựa cho dụng cụ là đối tượng của ái tưởng, thì tưởng rằng “tài sản, chướng ngại của ta ở trên đất”.

Parotiādīsupi iminā nayena attho veditabbo.

In " others" and so forth, the meaning should be understood in this manner.

Trong các từ “người khác” v.v. cũng nên hiểu ý nghĩa theo cách này.

231

Yvāyaṃ atthanayoti sambandho.

This method of meaning is the connection.

Cách giải thích ý nghĩa này là mối liên hệ.

Vutto paṭisambhidāmagge.

Stated in the Paṭisambhidāmagga.

Vutto (đã nói) trong Paṭisambhidāmagga.

Eteneva nayenāti yvāyaṃ ‘‘so kho pana me attā imasmiṃ rūpe’’ti samudāyassa ādhārabhāvadīpano atthanayo vutto, eteneva nayena.

In this very manner refers to this very method of meaning that reveals the aggregate as a basis, as in "that very self of mine is in this form."

Eteneva nayenā (theo cách này) là: cách giải thích ý nghĩa đã nói về việc chỉ ra tổng thể là nền tảng trong câu “tự ngã của ta ở trong sắc này”, chính là theo cách này.

Na hi avayavabyatirekena samudāyo labbhati, tasmā samudāye vuttavidhi avayavepi labbhatīti adhippāyo.

For an aggregate is not obtained apart from its constituents; therefore, the method described for the aggregate is also obtained for its constituents.

Vì không thể có tổng thể tách rời khỏi các bộ phận, do đó ý nghĩa là phương pháp đã nói về tổng thể cũng có thể áp dụng cho các bộ phận.

Tenāha so kho pana me ayaṃ attā imissā pathaviyāti maññantoti.

Therefore, he states, " perceiving, 'this very self of mine is on this earth.'"

Do đó đã nói “người đó tưởng rằng tự ngã này của ta ở trên đất này”.

Tasmiṃyeva panassa attanīti ettha assāti puthujjanassa.

In " in that very self of his," his refers to the ordinary person.

Trong câu “trong chính tự ngã đó của người ấy”, assa (của người ấy) là của phàm phu.

Tasmiṃyeva attanīti ajjhattikabāhirapathavīsannissaye attani.

“In that very self” means in the self that is dependent on the internal and external earth element.

Tasmiṃyeva attanī (trong chính tự ngã đó) có nghĩa là trong tự ngã nương tựa vào đất nội và ngoại.

‘‘Pathaviyā maññatī’’ti padassāyaṃ vaṇṇanā.

This is an explanation of the phrase ‘He conceives in earth’.

Đây là lời giải thích cho từ ngữ “Pathaviyā maññatī” (tưởng về đất).

Evaṃ ‘‘pathaviyā maññatī’’ti ettha attavasena diṭṭhimānataṇhāmaññanaṃ dassetvā idāni paravasena dassetuṃ ‘‘yadā panā’’tiādi vuttaṃ.

Thus, after showing the conception of view, conceit, and craving based on oneself in the phrase ‘He conceives in earth’, now, to show it based on another, the passage beginning with ‘But when’ was stated.

Như vậy, sau khi trình bày sự tưởng về tà kiến, kiêu mạn và tham ái theo cách tự ngã trong cụm từ “pathaviyā maññatī”, bây giờ để trình bày theo cách tha ngã, cụm từ “yadā panā” (khi nào thì) v.v. đã được nói đến.

Tattha assāti parassa.

Therein, ‘of him’ means of another.

Trong đó, assā (của nó) có nghĩa là của người khác.

Tadāti paravasena maññanāyaṃ.

‘Then’ means in conceiving based on another.

Tadā (lúc đó) là trong sự tưởng theo cách tha ngã.

Diṭṭhimaññanā eva yujjati tattha niccābhinivesādayo sambhavantīti katvā.

Only conception of view is appropriate because there, clinging to permanence and so forth can arise.

Chỉ có sự tưởng về tà kiến là thích hợp vì trong đó có thể phát sinh sự chấp thủ thường hằng v.v.

Avadhāraṇena mānataṇhāmaññanā nivatteti.

The emphatic particle excludes conception of conceit and craving.

Với sự nhấn mạnh, sự tưởng về kiêu mạn và tham ái được loại bỏ.

Na hi ‘‘seyyohamasmī’’tiādinā, ‘‘mayha’’nti ca pavattalakkhaṇā mānataṇhā parasmiṃ parassa santakabhāvena gahite ca pavattantīti adhippāyo.

For the intention is that conceit and craving, characterized by occurring as ‘I am superior’ and so forth, and ‘mine’, do not occur regarding another taken as belonging to another.

Thật vậy, kiêu mạn và tham ái, có đặc tính là phát sinh với “Tôi tốt hơn” v.v. và “của tôi”, không phát sinh đối với người khác được chấp nhận là thuộc về người khác; đó là ý nghĩa.

Itarāyopīti mānataṇhāmaññanāyopi.

“Also for the other” means also for the conception of conceit and craving.

Itarāyopī (cũng là cái khác) có nghĩa là sự tưởng về kiêu mạn và tham ái.

Icchanti aṭṭhakathācariyā.

The Commentarial teachers desire it.

Các vị giáo thọ sư của Chú giải mong muốn (điều này).

Parassapi hi pathavīsannissayena sampattiissariyādikassa vasena attani seyyādibhāvaṃ dahato paṇidahato ca cittaṃ tathābhāvāya mānataṇhāmaññanā sambhavantīti ācariyānaṃ adhippāyo.

For the teachers’ intention is that even regarding another, when one’s mind is directed or aspires to a superior state for oneself, based on the earth element, due to wealth and power, etc., the conception of conceit and craving can arise.

Thật vậy, ý nghĩa của các vị giáo thọ sư là sự tưởng về kiêu mạn và tham ái cũng có thể phát sinh trong tâm của người khác, khi người đó đặt hoặc xác định trạng thái ưu việt v.v. trong tự ngã dựa trên sự giàu có, quyền lực v.v. nương tựa vào đất.

‘‘Paro pathavī parassa pathavī’’ti etthāpi ime dve pakārā sādhippāyā niddhāretabbā.

In ‘another is earth’ and ‘another’s earth’, these two types should also be determined with specific intentions.

Trong “Paro pathavī, parassa pathavī” (người khác là đất, đất của người khác), hai loại này cũng phải được xác định với ý nghĩa.

232

‘‘Pathavito sañjānātī’’ti, ‘‘ādito’’ti ca ādīsu anissakkavacanepi to-saddo diṭṭhoti āha ‘‘pathavitoti nissakkavacana’’nti.

Seeing that the suffix to appears even in the ablative case in ‘Pathavito sañjānātī’ (He perceives from earth) and ‘ādito’ (from the beginning), he says: “‘Pathavito’ is in the ablative case.”

Trong “Pathavito sañjānātī” (nhận thức từ đất) và “ādito” (từ ban đầu) v.v., mặc dù là cách nói không phải xuất xứ, nhưng từ “to” được thấy, nên nói “pathavito (từ đất) là cách nói xuất xứ”.

Saupakaraṇassāti hiraññasuvaṇṇagatassa dāsaporisādinā vittupakaraṇena saupakaraṇassa, attano vā parassa vā tesaṃ upakaraṇassa vāti attho.

“With its accessories” means with its accessories, such as gold and silver, and servants, laborers, etc., or with the accessories belonging to oneself or another.

Saupakaraṇassa (cùng với phương tiện) có nghĩa là cùng với các phương tiện như vàng bạc, người hầu, nô lệ, hoặc các phương tiện đó thuộc về mình hay người khác.

Yathāvuttappabhedatoti lakkhaṇādiajjhattikādivuttappakāravibhāgato.

“According to the divisions previously stated” means according to the divisions of characteristics and internal/external types previously stated.

Yathāvuttappabhedato (theo sự phân loại đã nói) có nghĩa là theo sự phân biệt các loại đã nói như đặc tính, nội tại v.v.

Uppattiṃ vā niggamanaṃ vāti ‘‘taṃ aṇḍaṃ ahosi hemamayaṃ, tasmiṃ sayaṃ brahmā uppanno’’ti brahmaṇḍavādavasena vā ‘‘dvīhi aṇūhi dviaṇuka’’nti evaṃ pavattaaṇukavādavasena vā pathavito uppattiṃ vā ‘‘sabboyaṃ loko issarato viniggato’’ti issaravādavasena issarakuttato pathavito niggamanaṃ vā maññamānoti yojanā.

“Origin or emanation” is to be construed as: conceiving origin from earth based on the Brahman egg theory, such as ‘that egg was golden, and Brahmā himself arose in it’, or based on the atomic theory, such as ‘two atoms form a di-atomic particle’; or conceiving emanation from earth, from the Creator’s activity, based on the Creator theory, such as ‘this whole world emanated from the Creator’.

Uppattiṃ vā niggamanaṃ vā (sự phát sinh hoặc sự xuất xứ) có nghĩa là sự phát sinh từ đất theo thuyết vũ trụ của Phạm Thiên (Brahmāṇḍavāda) như “quả trứng đó là vàng, Phạm Thiên tự sinh ra trong đó”, hoặc theo thuyết nguyên tử (Aṇukavāda) như “từ hai nguyên tử thành hai nguyên tử”, hoặc sự xuất xứ từ đất từ Đấng Sáng Tạo (Issarakutta) theo thuyết Đấng Sáng Tạo (Issaravāda) như “tất cả thế giới này xuất xứ từ Đấng Sáng Tạo”; đó là cách kết nối ý nghĩa của “maññamāno” (tưởng).

Pathavito vā añño āpādiko attāti adhippāyo.

The intention is: “Another self” is an activator other than the earth.

Pathavito vā añño (hoặc khác với đất) có nghĩa là tự ngã là người tạo ra.

Ettha ca purimasmiṃ atthavikappe kārakalakkhaṇaṃ nissakkavacanaṃ, dutiyasmiṃ upapadalakkhaṇanti daṭṭhabbaṃ.

Here, in the first alternative meaning, the ablative case has the characteristic of an agent, and in the second, it has the characteristic of an accompanying noun.

Và ở đây, trong cách diễn giải ý nghĩa thứ nhất, từ xuất xứ có đặc tính là tác nhân, trong cách diễn giải thứ hai, có đặc tính là bổ ngữ.

Attano pariggahabhūtapathavito sukhappattiṃ tato eva ca parehi seyyādibhāvaṃ kappentassa vasenapettha taṇhāmānamaññanā veditabbā.

Here, the conception of craving and conceit should be understood regarding one who assumes the attainment of happiness from the earth belonging to oneself, and superiority over others from that very earth.

Trong trường hợp này, taṇhāmānamaññanā (sự tưởng về tham ái và kiêu mạn) phải được hiểu là theo cách của người tưởng tượng sự đạt được hạnh phúc từ đất thuộc sở hữu của mình và sự ưu việt hơn người khác từ đó.

Apareti sārasamāsācariyā.

“Others” means the teachers of the Sārasamāsa.

Apare (những người khác) có nghĩa là các vị giáo thọ sư của Sārasamāsa.

Tato aññaṃ appamāṇaṃ attānaṃ gahetvāti pubbe bhāvitaāpādiappamāṇakasiṇavasena vā kāpilakāṇādadiṭṭhivasena vā appamāṇaṃ byāpinaṃ attānaṃ gahetvā.

“Having taken the self as immense, other than that” means having taken the self as immense and pervasive, either based on previously cultivated immensity-kasiṇas or based on the Kapila or Kaṇāda views.

Tato aññaṃ appamāṇaṃ attānaṃ gahetvā (chấp thủ tự ngã vô lượng khác với đó) có nghĩa là chấp thủ tự ngã vô lượng, bao trùm, theo cách của kasina vô lượng đã được tu tập trước đó, hoặc theo quan điểm của Kāpilaka và Kaṇāda.

Pathavitoti pacchā abhāvitaavaḍḍhitapathavīkasiṇasaṅkhātapathavito.

“From earth” means from the earth element, which is characterized as the uncultivated, undeveloped earth kasiṇa.

Pathavito (từ đất) có nghĩa là từ đất được xem là kasina đất chưa được tu tập, chưa được phát triển sau đó.

Bahiddhāpi me attāti ito pathavito bahipi me attāti adhippāyo.

“My self is also outside” means my self is also outside this earth; such is the intention.

Bahiddhāpi me attā (tự ngã của tôi cũng ở bên ngoài) có nghĩa là tự ngã của tôi cũng ở bên ngoài đất này.

233

Kevalanti anavasesaṃ.

“Completely” means without remainder.

Kevalaṃ (hoàn toàn) có nghĩa là không còn gì.

Mahāpathaviṃ taṇhāvasena mamāyati, ayañca nayo catudīpissariye ṭhitassa dīpacakkavattino ca labbheyya, maṇḍalikarājamahāmattakuṭumbikānampi vasena labbhateva tesampi yathāpariggahaṃ anavasesetvā maññanāya sambhavato.

This method of cravingly appropriating the entire great earth can apply to a universal monarch who rules the four continents, and it can also apply to provincial kings, great ministers, and householders, because the conception of appropriating without remainder can arise for them according to their possessions.

Mahāpathaviṃ taṇhāvasena mamāyati (sở hữu đại địa theo cách tham ái), cách này có thể được áp dụng cho một vị chuyển luân vương trị vì bốn châu lục, và cũng có thể áp dụng cho các vị vua chư hầu, đại thần, và gia chủ, vì sự tưởng không còn gì của họ cũng có thể phát sinh tùy theo sở hữu của họ.

‘‘Evaṃ mamā’’ti gāhassa ‘‘esohamasmiṃ, eso me attā’’ti gāhavidhūratāya vuttaṃ ‘‘ekā taṇhāmaññanā eva labbhatī’’ti.

It is stated, “only a conception of craving is found,” because such appropriation as ‘mine’ is distant from the appropriation ‘this is I, this is my self’.

Để nói rằng sự chấp thủ “Như vậy là của tôi” khác với sự chấp thủ “Đây là tôi, đây là tự ngã của tôi”, nên đã nói “ekā taṇhāmaññanā eva labbhatī” (chỉ có một sự tưởng về tham ái là được chấp nhận).

Iminā nayenāti vuttamatidesaṃ vibhāvetuṃ ‘‘sā cāya’’ntiādi vuttaṃ.

To elucidate the previously stated inference “in this way,” the passage beginning with “and this” was stated.

Để làm rõ sự mở rộng đã nói bằng iminā nayenā (theo cách này), cụm từ “sā cāyaṃ” v.v. đã được nói đến.

Tattha sā cāyanti sā ca ayaṃ taṇhāmaññanā yojetabbāti sambandho.

Therein, “and this” is to be connected as ‘and this conception of craving is to be construed’.

Trong đó, sā cāyaṃ (và cái này) có nghĩa là sự tưởng về tham ái này phải được kết nối.

Yathā pana diṭṭhimaññanāmaññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanā sambhavanti, evaṃ taṇhāmaññanāmaññitena vatthunā attānaṃ seyyādito dahato tañca attaniyaṃ niccaṃ tathā taṃsāmibhūtaṃ attānañca parikappentassa itaramaññanāpi sambhavantīti sakkā viññātuṃ.

Just as conceptions of craving and conceit arise when affection and conceit are generated towards an object conceived by a view, so too can the other conceptions be understood to arise when one, through an object conceived by craving, regards oneself as superior and so forth, and perpetually conceives that self as one’s own and as the owner of it.

Như sự tưởng về tham ái và kiêu mạn có thể phát sinh khi tạo ra sự yêu thích và kiêu mạn trong đối tượng được tưởng bởi tà kiến, thì cũng có thể hiểu rằng các sự tưởng khác cũng phát sinh khi người đó xác định tự ngã là ưu việt hơn từ đối tượng được tưởng bởi tham ái, và khi người đó tưởng tượng về tự ngã đó là thường hằng và là chủ của nó.

‘‘Me’’ti hi iminā atthaggahaṇamukheneva attaniyasambandho pakāsīyatīti.

For the relationship of self-possession is expressed by the meaning conveyed by ‘mine’.

Thật vậy, mối quan hệ tự ngã được biểu lộ thông qua việc nắm giữ ý nghĩa bằng từ “me” (của tôi).

234

Abhinandatīti iminā taṇhādiṭṭhābhinivesānaṃ saṅgahitattā te dassento ‘‘assādeti parāmasati cā’’ti āha.

Since “rejoices” includes craving and attachment to views, to show these, he says: “he savors and grasps.”

Vì abhinandatī (hoan hỷ) bao gồm sự tham ái và chấp thủ tà kiến, để trình bày chúng, nên nói “assādeti parāmasati cā” (nếm trải và chấp thủ).

Diṭṭhivippayuttacittuppādavasena cetassa dvayassa asaṅkarato pavatti veditabbā, ekacittuppādepi vā adhipatidhammānaṃ viya pubbābhisaṅkhāravasena tassa tassa balavabhāvena pavatti.

Their occurrence should be understood as distinct due to the distinction of the two, depending on states of mind disconnected from view, or, in a single state of mind, their occurrence due to the predominance of one or the other, like dominant factors, based on prior volition.

Sự phát sinh của hai điều này phải được hiểu là không lẫn lộn theo cách của các tâm sở không đi kèm với tà kiến, hoặc là sự phát sinh của chúng theo sức mạnh của từng cái, giống như các pháp chủ đạo, ngay cả trong một tâm sở duy nhất, do sự chuẩn bị trước.

Etasmiṃ attheti taṇhādiṭṭhivasena abhinandanatthe.

“In this context” means in the context of rejoicing due to craving and view.

Etasmiṃ atthe (trong ý nghĩa này) có nghĩa là trong ý nghĩa hoan hỷ theo cách tham ái và tà kiến.

Etanti ‘‘pathaviṃ abhinandatī’’ti etaṃ padaṃ.

“This” means this phrase, ‘rejoices in earth’.

Etaṃ (cái này) là từ “pathaviṃ abhinandatī” (hoan hỷ về đất).

Yesaṃ vineyyānaṃ yehi pakāravisesehi dhammānaṃ vibhāvane kate visesādhigamo hoti, tesaṃ tehi pakāravisesehi dhammavibhāvanaṃ.

The “elegance of teaching” is the elucidation of phenomena in particular ways for those to be trained, for whom a special attainment arises when phenomena are elucidated in those particular ways.

Đối với những người cần được giáo hóa, khi các pháp được trình bày bằng những cách đặc biệt nào thì sự chứng đắc đặc biệt sẽ xảy ra, thì việc trình bày các pháp cho họ bằng những cách đặc biệt đó.

Yesaṃ pana yena ekeneva pakārena dhammavibhāvane kate visesādhigamo hoti, tesampi taṃ vatvā dhammissaratāya tadaññaniravasesappakāravibhāvanañca desanāvilāso.

And for those for whom a special attainment arises when phenomena are elucidated in only one particular way, it is also the elucidation of all other various ways, after stating that one way, due to the Buddha’s mastery of the Dhamma.

Đối với những người mà sự chứng đắc đặc biệt xảy ra khi các pháp được trình bày chỉ bằng một cách duy nhất, thì sau khi nói điều đó, việc trình bày tất cả các cách khác không còn lại gì nữa, do quyền năng của pháp, đó là desanāvilāso (sự khéo léo trong thuyết pháp).

Tenāha ‘‘pubbe maññanāvasena kilesuppattiṃ dassetvā idāni abhinandanāvasena dassento’’ti.

Therefore he says: “having previously shown the arising of defilements through conception, now showing it through rejoicing.”

Vì vậy, nói “pubbe maññanāvasena kilesuppattiṃ dassetvā idāni abhinandanāvasena dassento” (sau khi trình bày sự phát sinh phiền não theo cách tưởng trước đó, bây giờ trình bày theo cách hoan hỷ).

Dhammadhātuyāti sammāsambodhiyā.

“In the Dhamma-element” means in perfect self-awakening (sammāsambodhi).

Dhammadhātuyā (về pháp giới) có nghĩa là về chánh đẳng chánh giác.

Sā hi sabbañeyyadhammaṃ yathāsabhāvato dhāreti upadhāreti, sakalañca vineyyasattasaṅkhātadhammappabandhaṃ apāyadukkhasaṃsāradukkhapatanato dhāreti, sayañca aviparītapavattiākārā dhātūti dhammadhātūti idhādhippetā.

For it (sammāsambodhi) holds and maintains all knowable phenomena according to their true nature, and it protects the entire lineage of beings to be trained from falling into suffering in the lower realms and the suffering of saṃsāra, and it itself is a “dhātu” (element) because its occurrence is unerring; this is what is intended here by Dhamma-element.

Vì nó chứa đựng và duy trì tất cả các pháp cần được biết theo bản chất của chúng, và nó duy trì toàn bộ dòng pháp của chúng sinh cần được giáo hóa khỏi sự rơi vào khổ cảnh và khổ luân hồi, và tự nó là một giới có đặc tính vận hành không sai lệch, nên ở đây được hiểu là dhammadhātu (pháp giới).

Sabbaññutaññāṇapadaṭṭhānañhi maggañāṇaṃ, maggañāṇapadaṭṭhānañca sabbaññutaññāṇaṃ sammāsambodhīti.

For the knowledge of the path is the proximate cause of omniscience, and omniscience is the proximate cause of the knowledge of the path, which is perfect self-awakening.

Thật vậy, trí tuệ đạo là nền tảng của trí tuệ toàn tri, và trí tuệ toàn tri là nền tảng của trí tuệ đạo, đó là chánh đẳng chánh giác.

Suppaṭividdhattāti suṭṭhu paṭividdhabhāvato, sammā adhigatattāti attho.

“Because of being well-penetrated” means because of being well-penetrated, which is to say, truly comprehended.

Suppaṭividdhattā (do đã thấu hiểu tốt) có nghĩa là do đã thấu hiểu một cách hoàn hảo, tức là đã chứng đắc một cách đúng đắn.

Abhikaṅkhanasampaggahaparāmasanānaṃ vasena ārammaṇe parikappanāpavatti maññanā.

Conception (maññanā) is the act of formulating thoughts about an object based on desire, strong inclination, and grasping.

Sự vận hành của sự tưởng tượng trong đối tượng theo cách mong muốn, chấp thủ và chấp trước là maññanā (tưởng).

Tattha ‘‘mamaṃ, aha’’nti ca abhinivesanaṃ parikappanaṃ.

Therein, the “formulation” is the clinging to ‘mine’ and ‘I’.

Trong đó, sự chấp thủ “của tôi, tôi” là parikappanaṃ (sự tưởng tượng).

Yena ajjhosānaṃ hoti, ayaṃ abhinandanāti ayametesaṃ viseso.

“Rejoicing” is that by which attachment occurs; this is the distinction among them.

Cái mà do đó có sự quyết định, cái đó là abhinandanā (sự hoan hỷ); đây là sự khác biệt giữa chúng.

Suttādiaviruddhāyeva attanomati icchitabbā, na itarāti suttena tassā saṅgahaṃ dassetuṃ ‘‘vuttañceta’’ntiādi vuttaṃ.

It is stated, “and this has been said,” etc., to show that one’s own view, if not contrary to the suttas and so forth, is to be desired, but not otherwise, and thus it is included in the Sutta.

Chỉ có ý kiến của mình không trái với kinh điển mới được chấp nhận, không phải ý kiến khác; để trình bày sự bao gồm của nó trong kinh điển, nên nói “vuttañceta” (và điều này đã được nói) v.v.

Desanāvilāsavibhāvanassa pana sahetukahetusampayuttadukādidesanāya nibaddhatā niddhāretabbā.

However, the elegance of teaching should be determined by its connection to the teaching of dyads such as ‘with causes’ and ‘connected with causes’.

Tuy nhiên, sự khéo léo trong thuyết pháp phải được xác định là gắn liền với việc thuyết giảng về các cặp như có nhân và đi kèm với nhân.

235

Tassāti tena.

“Of that” means by that.

Tassā (của nó) có nghĩa là bởi cái đó.

Ñātasaddasambandhena hetaṃ kattari sāmivacanaṃ.

For this is the genitive case used in the sense of an agent, connected with the word ‘known’.

Đây là cách nói sở hữu trong vai trò chủ ngữ với sự liên hệ của từ “ñāta” (đã biết).

Tasmāti apariññātattā.

“Therefore” means because of not being fully understood.

Tasmā (do đó) có nghĩa là do chưa được hiểu rõ.

‘‘Apariññāta’’nti paṭikkhepamukhena yaṃ parijānanaṃ vuttaṃ, taṃ atthato tividhā pariññā hotīti taṃ sarūpato pavattiākārato ca vibhāvento ‘‘yo hī’’tiādimāha.

That full understanding which was expressed by way of negation as ‘not fully understood’ actually consists of three kinds of full understanding, and elucidating it according to its nature and mode of occurrence, he says: “for he who…” etc.

Cái được gọi là sự hiểu rõ theo cách phủ định “apariññāta” (chưa được hiểu rõ), về mặt ý nghĩa, có ba loại hiểu rõ; để làm rõ điều đó theo bản chất và cách vận hành, nên nói “yo hī” (thật vậy, ai) v.v.

236

Tattha yāya paññāya vipassanābhūmiṃ parijānāti paricchindati, sā parijānanapaññā ñātapariññā.

Therein, the wisdom by which one fully understands and delimits the domain of insight is the full understanding of what is to be known (ñātāpariññā).

Trong đó, trí tuệ mà nhờ đó người ta hiểu rõ và phân biệt được cảnh giới quán chiếu, trí tuệ hiểu rõ đó là ñātapariññā (sự hiểu rõ bằng tri kiến).

Sā hi tebhūmakadhammajātaṃ ‘‘ayaṃ vipassanābhūmī’’ti ñātaṃ viditaṃ pākaṭaṃ karontīyeva lakkhaṇarasādito ajjhattikādivibhāgato ca paricchijja jānāti.

For it (this wisdom) discerns and knows the class of phenomena belonging to the three planes, making it known, understood, and manifest as "this is the ground for insight (vipassanā)," by way of characteristics, functions, etc., and by way of internal, etc., divisions.

Quả thật, trí tuệ đó làm cho các pháp thuộc ba cõi được biết, được rõ, được hiển lộ là “đây là cảnh giới của tuệ quán” (vipassanābhūmi), và phân định biết rõ chúng từ tướng trạng, phận sự, v.v. và từ sự phân chia nội phần, v.v.

Idha pana pathavīdhātuvasena veditabbāti vuttaṃ ‘‘pathavīdhātuṃ parijānātī’’tiādi.

Here, however, it is to be understood by way of the earth element, hence it is said "discerning the earth element" and so on.

Nhưng ở đây, cần phải biết theo cách của địa đại, nên đã nói “hiểu rõ địa đại”, v.v.

Tīraṇapariññāti kīraṇavasena parijānanakapaññā.

Tīraṇapariññā means the wisdom of discerning by way of examination.

Phân biệt tri là trí tuệ biết rõ theo cách phân biệt.

Sā hi parivārehi aniccatādiākārehi aniccatādisabhāvassa upādānakkhandhapañcakassa tīraṇavasena sammasanavasena taṃ paricchijja jānāti.

For it discerns and knows the five aggregates of clinging, which have the nature of impermanence, etc., by way of examining (sammasana) them through their associated factors and aspects such as impermanence.

Quả thật, trí tuệ đó phân định biết rõ năm uẩn chấp thủ với bản chất vô thường, v.v. bằng cách xem xét, suy xét theo các phương diện vô thường, v.v. (là các yếu tố phụ trợ).

Aggamaggenāti arahattamaggena.

By the highest path means by the path of Arahantship.

Bằng đạo tối thượng là bằng A-la-hán đạo.

So hi anavasesato chandarāgaṃ pajahati.

For it abandons craving without remainder.

Quả thật, đạo đó đoạn trừ tham ái một cách không còn sót lại.

Aggamaggenāti vā aggabhūtena maggena, lokuttaramaggenāti attho.

By the highest path also means by the foremost path, which is to say, the supramundane path.

Hoặc bằng đạo tối thượng có nghĩa là bằng đạo tối cao, tức là đạo siêu thế.

Ubhayathāpi hi samucchedapahānakārī eva paññā nippariyāyena pahānapariññāti dasseti.

In either case, it shows that the wisdom which effects abandonment by cutting off (samucchedapahāna) is, in the ultimate sense, the knowledge of abandonment (pahānapariññā).

Dù theo cách nào, trí tuệ thực hiện sự đoạn trừ tận gốc rễ cũng được xem là đoạn trừ tri theo nghĩa trực tiếp.

237

Nāmarūpavavatthānanti etena paccayapariggahopi saṅgahitoti daṭṭhabbo nāmarūpassa hetuvavatthānabhāvato.

It should be understood that the discernment of nāmarūpa also includes the comprehension of conditions (paccayapariggaha), because nāmarūpa has the nature of being discerned by its causes.

Với câu “sự phân định danh sắc”, cần phải hiểu rằng sự nắm giữ nhân duyên cũng được bao gồm, vì danh sắc có sự phân định nhân duyên.

Sopi hi hetupaccayamukhena nāmarūpassa vavatthānamevāti.

For that too is merely the discernment of nāmarūpa through its causes and conditions.

Quả thật, sự nắm giữ nhân duyên cũng chính là sự phân định danh sắc qua phương diện nhân duyên.

Kalāpasammasanādivasena tīraṇapariññā aniccādivasena sammasanabhāvato.

Tīraṇapariññā (discernment-knowledge) is by way of contemplating in terms of impermanence, etc., through the method of contemplating aggregates (kalāpasammasana), etc.

Phân biệt tri theo cách suy xét từng cụm, v.v. vì có sự suy xét theo vô thường, v.v.

Tasmāti yasmā tā pariññāyo natthi, tasmā.

Therefore means: because those discernments (pariññā) are absent, therefore.

Do đó có nghĩa là: vì những tri đó không có, do đó.

Atha vā tasmā apariññātattāti yasmā apariññātā pathavī, tasmā apariññātattā pathaviyā taṃ pathaviṃ maññati ca abhinandati cāti.

Alternatively, "Therefore, because it is not discerned" means: because the earth is not discerned, therefore, because of the non-discernment of the earth, one conceives and delights in that earth.

Hoặc do đó, vì không được hiểu rõ có nghĩa là: vì địa đại không được hiểu rõ, do đó người ấy tưởng tượng và hoan hỷ với địa đại đó vì địa đại không được hiểu rõ.

238

Pathavīvāravaṇṇanā niṭṭhitā.

The explanation of the Earth Chapter is concluded.

Phần giải thích về Địa Đại đã xong.

239

Āpovārādivaṇṇanā

Explanation of the Water Chapter, etc.

Giải thích về Thủy Đại, v.v.

240

Āpaṃ āpatoti ettha appoti, appāyatīti vā āpo, yasmiṃ saṅghāte sayaṃ atthi, taṃ ābandhanavasena byāpetvā tiṭṭhati, paribrūhetīti vā attho.

In "Water, from water," "āpo" means that which pervades or expands. It means that within the aggregate where it exists, it pervades and maintains it by way of binding, or it nourishes it.

Trong câu “nước, từ nước”, nước có nghĩa là "thẩm thấu" hoặc "lan tỏa". Nghĩa là: trong khối tổng hợp nào mà nó tự tồn tại, nó sẽ lan tỏa và duy trì khối đó bằng cách kết nối, hoặc nó sẽ nuôi dưỡng.

Atthānaṃ adhi ajjhattaṃ.

Ajjhattaṃ means that which is within the self.

Ajjhattaṃ (nội phần) là bên trong tự thân.

Pati pati attānanti paccattaṃ.

Paccattaṃ means each and every self.

Paccattaṃ (riêng biệt) là từng tự thân một.

Ubhayenapi sattasantānapariyāpannameva vadati.

Both terms refer to that which is included within the continuum of a being.

Cả hai đều nói về những gì thuộc về dòng tương tục của chúng sinh.

Āpo āpogatantiādīsu ābandhanameva āpo, tadeva āposabhāvaṃ gatattā āpogataṃ, sabhāveneva āpabhāvaṃ pattanti attho.

In phrases like "water, gone to water-nature," "āpo" is just the binding, and "āpogataṃ" means having gone to that very nature of water, that is, having attained the nature of water by its own essence.

Trong các câu như “nước, đã thành nước”, v.v. nước chính là sự kết nối; nó đã thành bản chất của nước nên được gọi là đã thành nước, có nghĩa là nó đã đạt đến bản chất của nước một cách tự nhiên.

Sinehanavasena sineho, soyeva sinehanasabhāvaṃ gatattā sinehagataṃ.

Sineho is by way of cohesion; sinehagataṃ means having gone to that very nature of cohesion.

Sineho (chất lỏng) theo cách dính kết; chính chất lỏng đó đã thành bản chất dính kết nên được gọi là đã thành chất lỏng.

Bandhanattaṃ rūpassāti avinibbhogarūpassa bandhanabhāvo, avippakiraṇavasena sampiṇḍananti attho.

The binding nature of matter means the binding nature of undifferentiated matter, that is, cohesion by way of non-dispersion.

Sự kết dính của sắc là trạng thái kết dính của sắc không thể tách rời, có nghĩa là sự kết tụ lại mà không bị phân tán.

Uggaṇhantoti yathāparicchinne āpomaṇḍale yathā uggahanimittaṃ upalabbhati, tathā nimittaṃ gaṇhanto.

Perceiving means perceiving the sign (nimitta) in the water-mandala as it is delimited, in the way a sign is perceived.

Khi nắm giữ có nghĩa là khi nắm giữ tướng trạng như nó được nhận biết trong một vòng nước đã được phân định.

Vuttoti ‘‘āpasmi’’nti ettha vuttaāpo.

Mentioned refers to the water mentioned in "in water."

Đã nói là nước đã nói trong câu “trong nước”.

So hi sasambhāraāpo, na ‘‘āpokasiṇa’’nti ettha vuttaāpo.

That is water with its constituents, not the water mentioned in "water kasiṇa."

Quả thật, đó là nước có các thành phần, không phải nước đã nói trong câu “địa thủy biến xứ” (āpokasiṇa).

Sesanti ārammaṇasammutiāpānaṃ sarūpavibhāvanaṃ.

The rest is the explanation of the inherent nature of water as a conventional object.

Phần còn lại là sự phân biệt bản chất của các loại nước giả định là đối tượng.

‘‘Āpaṃ āpato pajānātī’’tiādipāḷiyā atthavibhāvanañceva tattha tattha maññanāvibhāgadassanañca pathaviyaṃ vuttasadisamevāti.

The explanation of the meaning of the Pāli passage "One discerns water from water" and so on, and the showing of the distinction of conceiving here and there, is similar to what was said for earth.

Sự phân biệt ý nghĩa của đoạn kinh “hiểu rõ nước, từ nước”, v.v. và sự trình bày sự phân biệt về tưởng tượng ở từng chỗ đó cũng tương tự như đã nói về địa đại.

Tattha ‘‘pathavīkasiṇameko sañjānātī’’tiādinā (dī. ni. 3.360; a. ni. 10.25) vuttaṃ, idha ‘‘āpokasiṇameko sañjānātī’’tiādinā vattabbaṃ.

There, it was said "one discerns the earth kasiṇa" and so on; here, it should be said "one discerns the water kasiṇa" and so on.

Ở đó đã nói “có người nhận biết một địa biến xứ”, v.v. (Dī. Ni. 3.360; A. Ni. 10.25); ở đây cần phải nói “có người nhận biết một thủy biến xứ”, v.v.

Tattha ca ‘‘pathavīti sañjānātī’’ti vuttaṃ, idha pana ‘‘āpoti sañjānātī’’tiādinā vattabbanti evamādi eva viseso.

And there, it was said "one discerns it as earth"; here, it should be said "one discerns it as water" and so on. This is the difference.

Và ở đó đã nói “nhận biết là đất”, ở đây cần phải nói “nhận biết là nước”, v.v. Sự khác biệt chỉ là như vậy.

Sesaṃ tādisameva.

The rest is similar.

Phần còn lại là tương tự.

Tena vuttaṃ ‘‘pathaviyaṃ vuttasadisamevā’’ti.

Therefore, it is said, "similar to what was said for earth."

Vì vậy đã nói “cũng tương tự như đã nói về địa đại”.

Yo panettha viseso, taṃ dassetuṃ ‘‘kevala’’ntiādi vuttaṃ.

To show the difference that exists here, "only" and so on is stated.

Để trình bày sự khác biệt ở đây, đã nói “chỉ”, v.v.

Tattha mūlarasoti mūlaṃ paṭicca nibbattaraso.

There, root-sap means sap produced from the root.

Ở đó, mūlaraso (vị rễ) là vị sinh ra từ rễ.

Khandharasādīsupi eseva nayo.

The same method applies to stem-sap, etc.

Trong khandharasādi (vị thân, v.v.) cũng theo cách này.

Khīrādīni pākaṭāneva.

Milk, etc. are well-known.

Sữa, v.v. thì rõ ràng rồi.

Yathā pana bhesajjasikkhāpade (pārā. 618-625), na evamidha niyamo atthi.

However, there is no such rule here as in the rule concerning medicine.

Tuy nhiên, không có quy định như trong giới học về dược phẩm (pārā. 618-625) ở đây.

Yaṃ kiñci khīraṃ khīrameva.

Any kind of milk is milk itself.

Bất cứ loại sữa nào cũng là sữa.

Sesesupi eseva nayo.

The same method applies to the rest.

Trong các phần còn lại cũng theo cách này.

Bhummānīti āvāṭādīsu ṭhitaudakāni.

Bhummāni are waters located in pits, etc.

Bhummānī (nước đất) là nước ở trong các hố, v.v.

Antalikkhānīti pathaviṃ appattāni vassodakāni, pattāni pana bhummāneva.

Antalikkhāni are rainwater that has not reached the ground; once it reaches the ground, it becomes bhummāni.

Antalikkhānī (nước không trung) là nước mưa chưa chạm đất; còn nước đã chạm đất thì là nước đất.

Evaṃ vuttā cāti ca-saddena himodakakappavināsakaudakapathaviyāantoudakapathavīsandhārakaudakādiṃ pubbe avuttampi samuccinoti.

And thus stated: By the word "ca" (and), it includes even what was not stated before, such as the water that destroys the kalpa with ice water, the internal water of the earth, and the water that supports the earth.

Và đã nói như vậy từ ca-sắc (và) cũng bao gồm những loại nước chưa được nói đến trước đây như nước băng, nước hủy diệt kiếp, nước trong lòng đất, nước duy trì đất, v.v.

241

Tejaṃ tejatoti ettha tejanaṭṭhena tejo, tejanaṃ nāma dahanapacanādisamatthaṃ nisānaṃ, yaṃ uṇhattanti vuccati.

Tejaṃ tejato: Here, tejo (fire/heat) is in the sense of burning/making fierce. Burning/making fierce means that which is capable of burning, cooking, etc., which is called "heat".

Trong câu “lửa, từ lửa”, lửa có nghĩa là theo cách làm nóng. Làm nóng là sự sắc bén có khả năng đốt cháy, nấu chín, v.v., được gọi là hơi ấm.

Yena cāti yena tejogatena kupitena.

And by which: By which heat-element, when agitated.

Và bởi cái gì có nghĩa là bởi cái đã thành lửa đã bị kích động.

Santappatīti ayaṃ kāyo samantato tappati ekāhikajarādibhāvena usumajāto hoti.

Is tormented: This body is tormented all around; it becomes feverish due to a one-day fever, etc.

Bị nóng lên có nghĩa là thân này bị nóng lên khắp nơi, trở nên có hơi nóng do bị sốt một ngày, v.v.

Yena ca jīrīyatīti yena ayaṃ kāyo jīrīyati, indriyavekallataṃ balaparikkhayaṃ valitādibhāvañca pāpuṇāti.

And by which it decays: By which this body decays, reaching a state of impaired faculties, loss of strength, and wrinkles, etc.

Và bởi cái gì bị già đi có nghĩa là thân này bị già đi bởi cái gì, đạt đến tình trạng suy yếu các giác quan, suy giảm sức lực, có nếp nhăn, v.v.

Yena ca pariḍayhatīti yena kupitena ayaṃ kāyo parito ḍayhati, so ca puggalo ḍayhāmīti satadhotasappigosītacandanādilepañceva tālavaṇṭavātañca paccāsīsati.

And by which it is scorched: By which, when agitated, this body is scorched all around, and that person longs for ointments like satadhotasappi and gosītacandana, and a fan made of palm leaves.

Và bởi cái gì bị cháy rụi có nghĩa là thân này bị cháy rụi khắp nơi bởi cái bị kích động; và người đó mong muốn được xoa bóp bằng bơ đã rửa trăm lần, bằng bột gỗ đàn hương Gosīta, v.v. và quạt bằng quạt lá cọ, v.v.

Yena ca asitapītakhāyitasāyitaṃ sammā pariṇāmaṃ gacchatīti yena asitaṃ vā odanādi, pītaṃ vā pānakādi, khāyitaṃ vā piṭhakhajjakādi, sāyitaṃ vā ambapakkamadhuphāṇitādi sammadeva paripākaṃ gacchati, rasādibhāvena vivekaṃ gacchatīti attho.

And by which what is eaten, drunk, chewed, and tasted is properly digested: By which what is eaten, such as rice; or drunk, such as beverages; or chewed, such as pastries and snacks; or tasted, such as ripe mangoes, honey, and treacle, is properly digested; meaning, it separates into essences, etc.

Và bởi cái gì mà đồ ăn, thức uống, đồ nhai, đồ nếm được tiêu hóa đúng cách có nghĩa là bởi cái gì mà đồ ăn như cơm, v.v., đồ uống như nước giải khát, v.v., đồ nhai như bánh ngọt, v.v., đồ nếm như xoài chín, mật ong, đường phèn, v.v. được tiêu hóa hoàn toàn, tức là được phân tách thành vị, v.v.

Ettha ca sarīrassa pakatiusumaṃ atikkamitvā uṇhabhāvo santāpo, sarīradahanavasena pavatto mahādāho paridāho, satavāraṃ tāpetvā udake pakkhipitvā uddhaṭasappi satadhotasappi, rasarudhiramaṃsamedaaṭṭhiaṭṭhimiñjasukkā rasādayo.

Here, the body's becoming hot beyond its natural warmth is santāpa (torment/fever); the great burning that occurs due to the body being consumed is paridāha (scorching); clarified butter heated a hundred times, then plunged into water and removed, is satadhotasappi; and essences, blood, flesh, fat, bones, bone marrow, and semen are rasādayo (essences, etc.).

Ở đây, sự nóng bức vượt quá hơi ấm tự nhiên của cơ thể là sự nóng bức (santāpo); sự cháy bỏng lớn xảy ra do cơ thể bị đốt cháy là sự cháy rụi (paridāho); bơ đã được đun nóng trăm lần, nhúng vào nước rồi lấy ra là bơ đã rửa trăm lần (satadhotasappi); vị, máu, thịt, mỡ, xương, tủy xương, tinh dịch là các vị, v.v. (rasādayo).

Tattha purimā tayo tejā catusamuṭṭhānā, pacchimo kammasamuṭṭhānova.

Among these, the first three types of fire/heat arise from four causes, while the last one arises only from kamma.

Trong số đó, ba loại lửa đầu tiên có bốn nguồn gốc, loại cuối cùng chỉ có nguồn gốc từ nghiệp.

242

Tejobhāvaṃ gatattā tejogataṃ.

Having attained the state of fire/heat, it is tejagataṃ (gone to fire/heat).

Đã thành bản chất lửa nên là đã thành lửa.

Usmāti uṇhākāro.

Usmā: The nature of heat.

Hơi ấm là trạng thái nóng.

Usmāva usmābhāvaṃ gatattā usmāgataṃ.

Heat itself, having attained the state of heat, is usmāgataṃ (gone to heat).

Chính hơi ấm đó đã thành bản chất hơi ấm nên là đã thành hơi ấm.

Usumanti caṇḍausumaṃ.

Usuma: Intense heat.

Usuma là hơi nóng dữ dội.

Tadeva usumagataṃ, sabhāveneva usumabhāvaṃ pattanti attho.

That same is usumagataṃ; meaning, it has naturally attained the state of heat.

Chính hơi nóng đó đã thành hơi nóng, có nghĩa là đã đạt đến bản chất hơi nóng một cách tự nhiên.

Kaṭṭhaggīti kaṭṭhupādāno aggi.

Kaṭṭhaggī: Fire dependent on wood.

Lửa củi là lửa sinh ra từ củi.

Sakalikaggīādīsupi eseva nayo.

The same method applies to sakalikaggī (splinter fire), etc.

Trong lửa vụn gỗ, v.v. cũng theo cách này.

Saṅkāraggīti kacavaraṃ paṭicca uppannaaggi.

Saṅkāraggī: Fire arisen dependent on rubbish.

Lửa rác là lửa sinh ra từ rác.

Indaggīti asaniaggi.

Indaggī: Lightning fire.

Lửa sấm sét là lửa sét.

Santāpoti jālāya vā vītaccitaṅgārānaṃ vā santāpo.

Santāpo: The heat of a flame or of glowing embers without a flame.

Sự nóng bức là sự nóng bức của ngọn lửa hoặc của than hồng đã tắt.

Sūriyasantāpoti ātapo.

Sūriyasantāpo: Sunlight/heat.

Sự nóng bức của mặt trời là ánh nắng mặt trời.

Kaṭṭhasannicayasantāpoti kaṭṭharāsiṃ paṭicca uppannasantāpo.

Kaṭṭhasannicayasantāpo: Heat arisen dependent on a pile of wood.

Sự nóng bức của đống củi là sự nóng bức sinh ra từ đống củi.

Sesesupi eseva nayo.

The same method applies to the rest.

Trong các phần còn lại cũng theo cách này.

Evaṃ vuttā cāti.

And thus stated:

Và đã nói như vậy.

Ca-saddena petaggikappavināsakagginirayaggiādike avuttepi samuccinoti.

By the word "ca" (and), it includes even what was not stated, such as the fire of hungry ghosts, the fire that destroys the kalpa, and hell-fire.

Từ ca-sắc (và) cũng bao gồm những loại lửa chưa được nói đến như lửa của ngạ quỷ, lửa hủy diệt kiếp, lửa địa ngục, v.v.

243

Vāyaṃ vāyatoti ettha vāyanaṭṭhena vāyo.

Vāyaṃ vāyato: Here, vāyo (wind/air) is in the sense of blowing/moving.

Trong câu “gió, từ gió”, gió có nghĩa là theo cách chuyển động.

Kimidaṃ vāyanaṃ nāma?

What is this "blowing/moving"?

Chuyển động này là gì?

Vitthambhanaṃ, samudīraṇaṃ vā, vāyanaṃ gamananti eke.

It is expansion, or stirring; some say "vāyanaṃ" means going.

Một số người nói đó là sự căng phồng, hoặc sự kích thích, hoặc sự chuyển động, sự đi lại.

Uddhaṅgamā vātāti uggārahikkādipavattakā uddhaṃ ārohanavātā.

Upward-moving winds: Upward-moving winds that cause belching, hiccups, etc.

Gió đi lên là gió đi lên gây ra ợ hơi, nấc cụt, v.v.

Adhogamā vātāti uccārapassāvādinīharaṇatā adho orohanavātā.

Downward-moving winds: Downward-moving winds that expel feces, urine, etc.

Gió đi xuống là gió đi xuống gây ra sự bài tiết đại tiện, tiểu tiện, v.v.

Kucchisayā vātāti antānaṃ bahivātā.

Winds lying in the abdomen: The external winds of the intestines.

Gió nằm trong bụng là gió bên ngoài ruột.

Koṭṭhāsayā vātāti antānaṃ antovātā.

Winds lying in the belly: The internal winds of the intestines.

Gió nằm trong khoang bụng là gió bên trong ruột.

Aṅgamaṅgānusārino vātāti dhamanījālānusārena sakalasarīre aṅgamaṅgāni anusaṭā samiñjanapasāraṇādinibbattakā vātā.

Winds pervading the limbs: Winds that are spread throughout the entire body, pervading the limbs along the network of arteries, causing contraction, extension, etc.

Gió lan khắp các chi phần là gió lan truyền khắp toàn bộ cơ thể theo mạng lưới mạch máu, gây ra sự co duỗi, v.v. các chi phần.

Satthakavātāti sandhibandhanāni kattariyā chindantā viya pavattavātā.

"Knife-like winds" are winds that occur as if cutting the joints with scissors.

Gió dao (Satthakavātā) là những cơn gió thổi như cắt đứt các mối nối bằng kéo.

Khurakavātāti khurena viya hadayamaṃsachedanaphālanakavātā.

"Razor-like winds" are winds that cut and split the heart muscle as if with a razor.

Gió dao cạo (Khurakavātā) là những cơn gió cắt và xé thịt tim như bằng dao cạo.

Uppalakavātāti hadayamaṃsassa samuppāṭanakavātā.

"Uprooting winds" are winds that tear out the heart muscle.

Gió nhổ (Uppalakavātā) là những cơn gió nhổ thịt tim lên.

Assāsoti antopavisanakanāsikāvāto.

"In-breath" is the nasal wind entering inside.

Hơi thở vào (Assāso) là gió mũi đi vào bên trong.

Passāsoti bahinikkhamananāsikāvāto.

"Out-breath" is the nasal wind exiting outside.

Hơi thở ra (Passāso) là gió mũi đi ra bên ngoài.

Ettha ca purimā sabbe catusamuṭṭhānā, assāsapassāsā cittasamuṭṭhānāva.

Here, all the former winds arise from four sources, while in-breaths and out-breaths arise from mind only.

Ở đây, tất cả các loại gió trước đều do bốn nhân duyên sinh, còn hơi thở vào và hơi thở ra thì chỉ do tâm sinh.

244

Vāyogatanti vāyova vāyogataṃ, sabhāveneva vāyobhāvaṃ pattanti attho.

"Vāyogataṃ" means just vāyo, meaning it has attained the state of wind by its very nature.

Trạng thái gió (Vāyogataṃ) là chính gió, có nghĩa là đạt đến trạng thái gió bởi tự tính của nó.

Thambhitattaṃ rūpassāti avinibbhogarūpassa thambhitabhāvo.

"The rigidity of form" means the rigid state of inseparable form.

Sự cứng đờ của sắc (Thambhitattaṃ rūpassā) là trạng thái cứng đờ của sắc không thể tách rời.

Puratthimā vātāti puratthimadisato āgatā vātā.

"Easterly winds" are winds that come from the eastern direction.

Gió đông (Puratthimā vātā) là những cơn gió đến từ phía đông.

Pacchimādīsupi eseva nayo.

The same method applies to "Westerly" and so on.

Tương tự đối với gió tây và các loại khác.

Sarajādīsu saha rajena sarajā, rajavirahitā suddhā arajā.

Among "dusty" and so on, "sarajā" means with dust, and "arajā" means pure, free from dust.

Trong các loại có bụi (Sarajā) và các loại khác, có bụi (sarajā) là cùng với bụi, không bụi (arajā) là trong sạch, không có bụi.

Sītautusamuṭṭhānā, sītavalāhakantare vā jātā sītā.

"Cold" means arisen from the cold season, or arisen amidst cold clouds.

Lạnh (Sītā) là do mùa lạnh sinh ra, hoặc sinh ra giữa những đám mây lạnh.

Uṇhautusamuṭṭhānā, uṇhavalāhakantare vā jātā uṇhā.

"Hot" means arisen from the hot season, or arisen amidst hot clouds.

Nóng (Uṇhā) là do mùa nóng sinh ra, hoặc sinh ra giữa những đám mây nóng.

Parittāti mandā tanukavātā.

"Slight" means gentle, subtle winds.

Nhẹ (Parittā) là những cơn gió yếu, mỏng manh.

Adhimattāti balavavātā.

"Excessive" means strong winds.

Mạnh (Adhimattā) là những cơn gió mạnh.

Kāḷāti kāḷavalāhakantare samuṭṭhitā.

"Black" means arisen amidst black clouds.

Đen (Kāḷā) là những cơn gió sinh ra giữa những đám mây đen.

Yehi abbhāhato chavivaṇṇo kāḷako hoti, tesaṃ etaṃ adhivacanantipi eke.

Some say that this is a designation for those winds by which the complexion of the skin becomes dark.

Một số người nói rằng đây là tên gọi cho những cơn gió làm cho màu da trở nên đen sạm.

Verambhavātāti yojanato upari vāyanavātā.

"Verambha winds" are winds blowing upwards from a yojana above.

Gió Verambha (Verambhavātā) là những cơn gió thổi trên một Yojana.

Pakkhavātāti antamaso makkhikāyapi pakkhāyūhanavātā.

"Wing winds" are winds that cause even a fly to flap its wings.

Gió cánh (Pakkhavātā) là những cơn gió làm cho ngay cả ruồi cũng vỗ cánh.

Supaṇṇavātāti garuḷavātā.

"Supaṇṇa winds" are Garuḷa winds.

Gió Supaṇṇa (Supaṇṇavātā) là gió của chim Garuda.

Kāmaṃ cetepi pakkhavātāva, ussadavasena pana visuṃ gahitā.

Although these too are wing winds, they are taken separately due to their predominance.

Mặc dù những loại này cũng là gió cánh, nhưng chúng được đề cập riêng biệt do sự nổi bật của chúng.

Tālavaṇṭavātāti tālavaṇṇehi katena, aññehi vā katena kenaci maṇḍalasaṇṭhānena samuṭṭhāpitavātā.

"Tālavaṇṭa winds" are winds generated by a fan made from palm leaves or by some other fan-shaped object.

Gió quạt lá cọ (Tālavaṇṭavātā) là những cơn gió được tạo ra bởi quạt làm từ lá cọ, hoặc bởi bất kỳ vật thể hình tròn nào khác.

Vidhūpanavātāti bījanapattakena samuṭṭhāpitavātā.

"Vidhūpana winds" are winds generated by a winnowing fan.

Gió quạt (Vidhūpanavātā) là những cơn gió được tạo ra bởi quạt tay.

Imāni ca tālavaṇṭavidhūpanāni anuppannampi vātaṃ uppādenti, uppannampi parivattenti.

These Tālavaṇṭa and Vidhūpana tools generate winds that have not yet arisen, and they also change those that have arisen.

Những quạt lá cọ và quạt tay này tạo ra gió chưa có và làm thay đổi gió đã có.

Idhāpi ca-saddo udakasandhārakavātakappavināsakavātajālāpellanakavātādike avuttepi samuccinoti.

Here, the particle "ca" also includes unmentioned winds such as those that retain water, those that destroy Kappas, and those that shake nets.

Ở đây, từ “ca” (và) cũng bao gồm những loại gió không được đề cập như gió giữ nước, gió hủy diệt kiếp trái đất, gió làm rung lưới, v.v.

Ettha ca ‘‘āpaṃ maññatī’’tiādīsu yasmā tīhi maññanāhi – ‘‘ahaṃ āpoti maññati, mama āpoti maññatī’’tiādinā pathavīvāre vuttanayena sakkā maññanāvibhāgo vibhāvetunti vuttaṃ ‘‘sesaṃ vuttanayamevā’’ti.

And here, in phrases like "perceives as water," since the division of perceptions can be explained by three perceptions – "I perceive as water," "I perceive that water is mine," and so on, in the manner stated in the section on earth – it is said: "The rest is as explained."

Ở đây, trong các câu “người ấy tưởng là nước” và các câu khác, vì có thể phân biệt các cách tưởng tượng bằng ba cách tưởng tượng – “tôi tưởng tôi là nước, tôi tưởng nước là của tôi” – theo cách đã nói trong phần về đất, nên đã nói “phần còn lại theo cách đã nói”.

Tasmā tattha vuttanayānusārena imesu tīsu vāresu yathārahaṃ maññanāvibhāgo vibhāvetabbo.

Therefore, the division of perceptions should be explained appropriately in these three sections, according to the method stated therein.

Do đó, theo cách đã nói ở đó, trong ba phần này, sự phân biệt tưởng tượng phải được phân biệt một cách thích đáng.

245

Ettāvatāti ettakena iminā catuvāraparimāṇena desanāvisesena.

"Ettāvatā" means by this much, by this specific teaching comprising these four sections.

Đến đây (Ettāvatā) có nghĩa là bằng đặc điểm giáo pháp gồm bốn phần này.

Ca-saddo byatireko.

The particle "ca" indicates an exception.

Từ “ca” (và) biểu thị sự khác biệt.

Tena vakkhamānaṃyeva visesaṃ joteti.

Thereby it illuminates the specific point that is about to be stated.

Nó làm nổi bật sự đặc biệt sẽ được nói đến.

Yvāyanti yo ayaṃ lakkhaṇo nāma hāro vuttoti sambandho.

"Yvāyaṃ" refers to "which is this method called Lakkhaṇa (Characteristic)," this is the connection.

Cái nào (Yvāyaṃ), tức là sự liên kết là “cái nào là phương pháp Lakkhaṇa đã được nói đến”.

So pana lakkhaṇahāro yaṃlakkhaṇo tattha vutto, taṃ dassetuṃ ‘‘vuttamhī’’tiādi vuttaṃ.

And to show what characteristic is meant by that Lakkhaṇa method, it is said "vuttamhi" and so on.

Để chỉ ra phương pháp Lakkhaṇa đó là loại Lakkhaṇa nào đã được nói đến ở đó, nên đã nói “trong cái đã nói” và các câu khác.

Tattha vuttamhi ekadhammeti kusalādīsu khandhādīsu vā yasmiṃ kasmiñci ekadhamme sutte sarūpato niddhāraṇavasena vā kathite.

There, "when one quality is stated" means when any single quality, such as wholesome qualities or aggregates, is stated in a discourse, or determined in terms of its nature.

Ở đó, trong một pháp đã được nói đến (vuttamhi ekadhamme) có nghĩa là khi một pháp nào đó, dù là thiện pháp hay ác pháp, hay các uẩn, v.v., được nói đến trong kinh, hoặc được xác định theo bản chất của nó.

Ye dhammā ekalakkhaṇā tenāti ye keci dhammā kusalādibhāvena, rūpakkhandhādibhāvena vā tena vuttadhammena samānalakkhaṇā.

"All qualities that have that one characteristic" refers to whatever qualities, whether in terms of wholesome states or rūpa aggregates, share the same characteristic as that stated quality.

Những pháp nào có cùng đặc tính với pháp đó (Ye dhammā ekalakkhaṇā tenā) có nghĩa là bất kỳ pháp nào có cùng đặc tính với pháp đã nói đó, dù là về phương diện thiện pháp hay ác pháp, hay về phương diện sắc uẩn, v.v.

Vuttā bhavanti sabbeti sabbepi kusalādisabhāvā, khandhādisabhāvā vā dhammā sutte avuttāpi tāya samānalakkhaṇatāya vuttā bhavanti, ānetvā saṃvaṇṇanavasenāti adhippāyo.

"Are said to be stated" means that all qualities, whether wholesome or aggregates, even if not explicitly mentioned in the discourse, are considered stated due to that shared characteristic, with the intention of bringing them forth for explanation.

Tất cả đều được nói đến (Vuttā bhavanti sabbe) có nghĩa là tất cả các pháp có bản chất thiện pháp, hay bản chất uẩn, v.v., dù không được nói đến trong kinh, nhưng do có cùng đặc tính, chúng được xem là đã được nói đến, theo ý nghĩa của việc đưa chúng ra và giải thích.

246

Ettha ca ekalakkhaṇāti samānalakkhaṇā vuttā.

Here, "ekalakkhaṇā" means possessing the same characteristic.

Ở đây, có cùng đặc tính (ekalakkhaṇā) có nghĩa là có đặc tính tương đồng.

Tena sahacaritā samānakiccatā samānahetutā samānaphalatā samānārammaṇatāti evamādīhipi avuttānaṃ vuttānaṃ viya niddhāraṇaṃ veditabbaṃ.

Thus, the determination of unmentioned things as if they were mentioned should be understood through concomitant existence, sameness of function, sameness of cause, sameness of result, sameness of object, and so on.

Do đó, sự xác định của những điều không được nói đến như thể chúng đã được nói đến cũng phải được hiểu qua các yếu tố như sự đồng hành, sự đồng chức năng, sự đồng nhân, sự đồng quả, sự đồng đối tượng, v.v.

Itīti iminā pakārena.

"Iti" means in this manner.

Như vậy (Iti) là theo cách này.

Tenāha ‘‘evaṃ nettiyaṃ lakkhaṇo nāma hāro vutto’’ti, nettipāḷiyaṃ (netti. 23) pana ‘‘ye dhammā ekalakkhaṇā keci so hāro lakkhaṇo nāmā’’ti pāṭho āgato.

Therefore, it is said: "Thus, in the Netti, the method called Lakkhaṇa (Characteristic) is stated." However, in the Nettipāḷi, the reading is "whatever qualities have one characteristic, that method is called Lakkhaṇa."

Vì thế, Ngài nói “Như vậy, trong Netti, phương pháp Lakkhaṇa đã được nói đến”, nhưng trong Nettipāḷi (netti. 23) có đoạn văn “Bất kỳ pháp nào có cùng đặc tính, đó được gọi là phương pháp Lakkhaṇa”.

Tassa vasenāti tassa lakkhaṇahārassa vasena.

"By its power" means by the power of that Lakkhaṇa method.

Theo đó (Tassa vasenā) có nghĩa là theo phương pháp Lakkhaṇa đó.

Rūpalakkhaṇaṃ anatītattāti ruppanasabhāvena samānasabhāvattā.

"Because it does not transcend the characteristic of rūpa" means because it has the same nature of being afflicted.

Không vượt quá đặc tính của sắc (Rūpalakkhaṇaṃ anatītattā) có nghĩa là có cùng bản chất với bản chất bị hủy hoại.

Vadantena bhagavatā.

"By the Blessed One" who spoke.

Khi nói (Vadantena) là bởi Đức Thế Tôn.

Etāti ‘‘rūpaṃ attato samanupassatī’’ti evaṃ vuttadiṭṭhī.

"These" refers to the views stated as "one perceives rūpa as self" and so on.

Những điều này (Etā) là những tà kiến đã được nói đến như “người ấy xem sắc là tự ngã”.

Ettha ca sakkāyadiṭṭhimaññanādassaneneva sakalarūpavatthukā taṇhāmānamaññanāpi dassitā evāti daṭṭhabbaṃ.

Here, it should be understood that by merely showing "sakkāyadiṭṭhimaññanā" (the perception of self as a permanent entity), all forms of perception involving craving and conceit based on rūpa are also shown.

Ở đây, cần phải hiểu rằng chỉ bằng cách chỉ ra tà kiến thân kiến (sakkāyadiṭṭhimaññanā), tất cả các tưởng tượng tham ái và kiêu mạn có đối tượng là sắc cũng đã được chỉ ra.

Tathā hi vuttaṃ ‘‘tasmiṃyeva panassa diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi veditabbā’’ti.

Indeed, it is said: "When he perceives that very object with the perception of wrong view, craving and conceit also arise, and thus the perception involving craving and conceit should be understood."

Thật vậy, đã nói rằng “khi người ấy tưởng tượng bằng tà kiến và kiêu mạn trên đối tượng đó, và sinh ra sự ham muốn và kiêu mạn, thì cũng phải hiểu là có tưởng tượng tham ái và kiêu mạn”.

Atha vā pathaviṃ āpaṃ tejaṃ vāyaṃ meti maññati abhinandatīti ca vadantena vuttanayeneva sakalarūpavatthukā taṇhāmaññanā tadanusārena mānamaññanāpi vuttāva hotīti evampettha itaramaññanāpi niddhāretabbā.

Alternatively, by stating "one perceives earth, water, fire, wind as mine" and delights in them, craving-perception pertaining to all rūpa-objects is stated in the manner explained, and by implication, conceit-perception is also stated. In this way, other perceptions should also be determined here.

Hoặc, khi nói “người ấy tưởng đất, nước, lửa, gió là của tôi, người ấy hoan hỷ với chúng”, thì theo cách đã nói, tưởng tượng tham ái có đối tượng là tất cả sắc đã được nói đến, và theo đó, tưởng tượng kiêu mạn cũng đã được nói đến; như vậy, các tưởng tượng khác cũng phải được xác định ở đây.

247

Āpovārādivaṇṇanā niṭṭhitā.

The exposition of the section on water and so on is concluded.

Hoàn thành phần giải thích về phần nước và các phần khác.

248

Bhūtavārādivaṇṇanā

Exposition of the section on beings and so on

Giải thích về phần chúng sinh và các phần khác

249

3. ‘‘Pathaviṃ maññati, pathaviyā maññatī’’tiādīhi padehi ‘‘rūpaṃ attato samanupassati, rūpasmiṃ attānaṃ samanupassatī’’tiādīnaṃ sakkāyadiṭṭhīnaṃ niddhāritattā vuttaṃ ‘‘evaṃ rūpamukhena saṅkhāravatthukaṃ maññanaṃ vatvā’’ti.

Since the wrong views, such as "one perceives rūpa as self, one perceives self in rūpa," are determined by phrases like "one perceives earth, one perceives in earth," it is said: "Having thus spoken of perception rooted in formations through the aspect of rūpa."

Bởi vì các tà kiến thân kiến như “người ấy xem sắc là tự ngã, người ấy xem tự ngã trong sắc” đã được xác định bằng các từ “người ấy tưởng đất, người ấy tưởng trong đất” và các từ khác, nên đã nói “như vậy, sau khi nói về tưởng tượng có đối tượng là các hành thông qua sắc”.

Tesu saṅkhāresu sattesupīti tadupādānesupi sattesu.

"Among those formations, and also among beings" means among those beings that are based on them.

Trong những hành đó, trong các chúng sinh (Tesu saṅkhāresu sattesupi) có nghĩa là trong các chúng sinh là đối tượng của sự chấp thủ đó.

Dhātūsūti pathavīādīsu catūsu dhātūsu.

"Among elements" refers to the four elements: earth, and so on.

Trong các yếu tố (Dhātūsu) có nghĩa là trong bốn yếu tố như đất và các yếu tố khác.

‘‘Jātaṃ bhūtaṃ saṅkhata’’ntiādīsu (dī. ni. 2.207; saṃ. ni. 5.379) bhūta-saddo uppāde dissati, saupasaggo pana ‘‘pabhūtamariyo pakaroti puñña’’ntiādīsu vipule, ‘‘yebhuyyena bhikkhūnaṃ paribhūtarūpo’’tiādīsu hiṃsane, ‘‘sambhūto sāṇavāsī’’tiādīsu (cūḷava. 450) paññattiyaṃ, ‘‘abhibhūto māro vijito saṅgāmo’’tiādīsu vimathane, ‘‘parābhūtarūpo kho ayaṃ acelo pāthikaputto’’tiādīsu (dī. ni. 3.23, 25, 31, 32) parājaye, ‘‘anubhūtaṃ sukhadukkha’’ntiādīsu vediyane, ‘‘vibhūtaṃ vibhāvitaṃ paññāyā’’tiādīsu pākaṭīkaraṇe dissati.

In phrases like "what is born, what has become, what is conditioned," the word bhūta is seen to mean "arisen." With a prefix, it is seen in "the noble one abundantly performs merit" to mean "abundant," in "mostly scorned by monks" to mean "harmed," in "the venerable Sāṇavāsī" to mean "designation," in "Māra is overcome, the battle is won" to mean "crushed," in "suffered happiness and suffering" to mean "experienced," and in "made manifest, revealed by wisdom" to mean "making clear."

Trong các câu “đã sinh, đã thành, đã tạo tác” (Dī. Ni. 2.207; Saṃ. Ni. 5.379), từ “bhūta” (đã thành) được dùng để chỉ sự sinh khởi; nhưng khi có tiền tố, nó được dùng để chỉ sự phong phú trong các câu như “người cao quý tạo nhiều công đức”, để chỉ sự làm hại trong các câu như “phần lớn các tỳ-khưu bị khinh thường”, để chỉ sự đặt tên trong các câu như “Sāṇavāsī đã được sinh ra” (Cūḷava. 450), để chỉ sự đánh bại trong các câu như “Ma-ra bị đánh bại, chiến thắng đã giành được”, để chỉ sự thất bại trong các câu như “người khổ hạnh Pāthikaputta này đã bị đánh bại” (Dī. Ni. 3.23, 25, 31, 32), để chỉ sự cảm nhận trong các câu như “khổ lạc đã được cảm nhận”, để chỉ sự làm rõ trong các câu như “đã được làm rõ, đã được giải thích bằng trí tuệ”.

Te sabbe rukkhādīsūti.

All these are to be understood as included by the "etcetera" in "trees, etcetera."

Tất cả những điều đó được bao gồm bởi từ “và các loại khác” trong “cây cối và các loại khác”.

Ādi-saddena saṅgahitāti daṭṭhabbā.

It should be understood that they are included by the word ādi (etc.).

Cần phải hiểu như vậy.

‘‘Kālo ghasati bhūtānīti (jā. 1.2.190), bhūtā loke samussaya’’nti (dī. ni. 2.220; saṃ. ni. 1.186) ca ādīsu avisesena sattavācakopi bhūtasaddo, upari devādipadehi sattavisesānaṃ gahitattā idha tadavasiṭṭhā bhūtasaddena gayhantīti āha ‘‘no ca kho avisesenā’’ti.

Although the word bhūta also refers to beings in general in phrases like "Time devours beings" and "beings are the accumulation in the world," since specific types of beings are included above by terms like devā, the remaining ones are taken here by the word bhūta. Therefore, it is said: "But not in a general sense."

Trong các câu “Thời gian nuốt chửng các chúng sinh” (Jā. 1.2.190), “các chúng sinh là sự tích tụ trên thế gian” (Dī. Ni. 2.220; Saṃ. Ni. 1.186) và các câu khác, từ “bhūta” (chúng sinh) được dùng để chỉ chúng sinh nói chung; nhưng ở đây, vì các chúng sinh đặc biệt như chư thiên đã được đề cập bằng các từ “chư thiên” ở trên, nên từ “bhūta” ở đây được dùng để chỉ những chúng sinh còn lại, do đó nói “nhưng không phải nói chung”.

Tenevāha – ‘‘cātumahārājikānañhi heṭṭhā sattā idha bhūtāti adhippetā’’ti.

Hence, it is said: "Indeed, beings below the Cātumahārājika devas are intended as bhūtā here."

Vì thế, Ngài nói – “Thật vậy, các chúng sinh ở dưới chư thiên Tứ Đại Thiên Vương được hiểu là ‘bhūta’ ở đây”.

Yo hi sattanikāyo paripuṇṇayoniko catūhipi yonīhi nibbattanāraho, tatthāyaṃ bhūtasamaññā aṇḍajādivasena bhavanato.

That group of beings which is endowed with perfect wombs and is capable of being born from all four wombs, for them this designation bhūta applies due to their existence as egg-born and so on.

Bất kỳ nhóm chúng sinh nào có đầy đủ các loại sinh, có khả năng sinh ra từ cả bốn loại sinh, thì danh xưng “bhūta” này được áp dụng cho họ dựa trên sự hiện hữu theo cách sinh từ trứng, v.v.

250

Bhūteti vuttadesaādesite bhūte.

"Bhūte" means in the beings designated in the stated manner.

Trong chúng sinh (Bhūte) có nghĩa là trong chúng sinh được chỉ định ở nơi đã nói.

Bhūtato sañjānātīti iminā ‘‘bhūtā’’ti lokavohāraṃ gahetvā yathā tattha taṇhādimaññanā sambhavanti, evaṃ viparītasaññāya sañjānanaṃ pakāsīyati.

"One perceives as a being" indicates that, by taking the conventional usage "beings," the perception of perverse notions, such as craving and so on, is revealed to arise there.

Tưởng là chúng sinh (Bhūtato sañjānātī) có nghĩa là, lấy cách nói thông thường “chúng sinh”, nó làm rõ sự nhận thức bằng nhận thức sai lầm, tương tự như cách các tưởng tượng tham ái và các tưởng tượng khác có thể phát sinh ở đó.

Svāyamattho heṭṭhā ‘‘pathavito sañjānātī’’ti ettha vuttanayānusārena sakkā jānitunti āha ‘‘vuttanayamevā’’ti.

This meaning, below, "perceives from earth," can be understood according to the method stated here, so it says, "the stated method itself."

Ý nghĩa này có thể được hiểu theo phương pháp đã nêu ở phần dưới trong câu ‘‘nhận thức từ đất’’, do đó nói ‘‘chính là phương pháp đã nêu’’.

Yathā suddhāvāsā sabbadā abhāvato imaṃ desanaṃ nāruḷhā, evaṃ nerayikāpi sabbamaññanānadhiṭṭhānato.

Just as the Suddhāvāsa devas, being absent at all times, do not attain this teaching, so too the denizens of hell, being devoid of all perception.

Cũng như chư thiên Tịnh Cư thiên (Suddhāvāsā) luôn vắng mặt, không đạt được giáo pháp này; tương tự, các loài địa ngục (nerayikā) cũng không thiết lập tất cả các tưởng.

Eteneva ekaccapetānampettha asaṅgaho daṭṭhabbo.

For this very reason, it should be understood that some petas are not included here.

Chính vì lẽ này, cần phải hiểu rằng một số loài ngạ quỷ (peta) cũng không được bao gồm ở đây.

Apare pana ‘‘diṭṭhimaññanādhiṭṭhānato tesampettha saṅgaho icchitoyevā’’ti vadanti.

Others, however, say, "Their inclusion here is desired because they are based on the perception of views."

Tuy nhiên, những người khác nói rằng: ‘‘Do sự thiết lập các tưởng về kiến chấp, nên họ cũng được bao gồm ở đây’’.

‘‘Samaṅgibhūtaṃ paricārenta’’ntiādinā sutte vuttanayena.

"Being fully endowed and attended to," and so on, according to the method stated in the Sutta.

Theo phương pháp đã nêu trong kinh, bắt đầu với ‘‘phục vụ một cách đầy đủ’’.

Rajjatīti ‘‘subhā sukhitā’’ti vipallāsaggāhena tattha rāgaṃ janeti.

Rajjati (is defiled) means that by grasping the perversion "beautiful and happy," one generates lust there.

Rajjatī (bị dính mắc) có nghĩa là tạo ra sự tham ái ở đó bằng cách chấp thủ sự lầm lạc ‘‘đẹp đẽ, hạnh phúc’’.

Evamettha rajjanto ca na kevalaṃ dassanavaseneva, savanādivasenapi rajjatevāti dassento ‘‘disvāpi…pe… utvāpī’’ti āha.

Thus, showing that one who is defiled here is not merely defiled through seeing, but also through hearing and so on, it says, "having seen... and so on... having heard."

Và ở đây, người bị dính mắc không chỉ dính mắc qua việc nhìn thấy, mà còn dính mắc qua việc nghe v.v… Do đó, nói ‘‘nhìn thấy cũng…pe… nghe cũng’’.

Tattha ghāyanādivasena rajjanaṃ tehi anubhūtagandhamālādivasena ceva visabhāgavatthubhūtānaṃ tesaṃ paribhogavasena ca yathānubhavaṃ anussaraṇavasena ca veditabbaṃ.

Being defiled through smelling, etc., there should be understood as due to the experienced perfumes, garlands, etc., by them, and due to the use of those dissimilar objects, and due to remembering according to experience.

Ở đây, sự dính mắc qua việc ngửi v.v… cần phải được hiểu là qua các loại hương hoa v.v… mà họ đã trải nghiệm, và qua việc sử dụng các vật phẩm không tương ứng với họ, và qua việc nhớ lại những trải nghiệm đó.

Evaṃ bhūte taṇhāmaññanāya maññatīti vuttanayena bhūte paṭicca chandarāgaṃ janento tesaṃ paṭipattiṃ assādento abhinandanto abhivadanto ajjhosāya tiṭṭhanto ‘‘īdisī avatthā mama anāgatamaddhānaṃ siyā’’tiādinā vā pana nayena tattha nandiṃ samannānento bhūte taṇhāmaññanāya maññatīti attho.

The meaning of "perceives in beings by way of craving-perception" is that, generating desire and lust dependent on such beings in the stated manner, relishing their practices, delighting in them, praising them, dwelling immersed in them, or by way of "May such a state be mine in the future," etc., assigning delight there, one perceives in beings by way of craving-perception.

Maññatī (tưởng tri) các hữu thể bằng tưởng tham ái theo cách như vậy có nghĩa là: tạo ra dục ái đối với các hữu thể theo cách đã nêu, thưởng thức sự thực hành của chúng, hoan hỷ, tán thán, chấp thủ và an trú, hoặc bằng cách làm cho sự hoan hỷ đồng hành với chúng theo cách ‘‘tình trạng như vậy có thể sẽ là của ta trong tương lai’’ v.v…

Appaṭiladdhassa khattiyamahāsālādibhāvassa, sampattiṃ vipattinti jātivasena ukkaṭṭanihīnataṃ.

Of the unobtained state of a great Khattiya lord, etc., "attainment and failure" refers to superiority and inferiority in terms of birth.

Appaṭiladdhassa (của người chưa đạt được) là trạng thái của một đại gia tộc Sát-đế-lợi v.v… Sampattiṃ vipattiṃ (thành tựu và thất bại) là sự ưu việt và thấp kém về mặt chủng loại.

Dahatīti ṭhapeti.

Dahati means places.

Dahatī (đặt) có nghĩa là thiết lập.

Yo evarūpo mānoti yo eso ‘‘ayaṃ pubbe mayā sadiso, idāni ayaṃ seṭṭho ayaṃ hīnataro’’ti uppanno māno.

"Whatever such conceit" refers to this conceit that arises, "This one was formerly my equal, now this one is superior, this one is inferior."

Yo evarūpo māno (sự kiêu mạn như vậy) là sự kiêu mạn phát sinh rằng ‘‘người này trước đây ngang hàng với ta, bây giờ người này là ưu việt, người này là thấp kém hơn’’.

Ayaṃ vuccati mānātimānoti ayaṃ bhārātibhāro viya purimaṃ sadisamānaṃ upādāya mānātimāno nāmāti attho.

"This is called mānātimāna" means that this, like an excessive burden, is called mānātimāna, based on a former equal conceit.

Ayaṃ vuccati mānātimāno (đây được gọi là mạn quá mạn) có nghĩa là: đây được gọi là mạn quá mạn, giống như gánh nặng quá nặng, dựa trên sự kiêu mạn tương tự trước đó.

251

Niccātiādīsu uppādābhāvato niccā, maraṇābhāvato dhuvā, sabbadā bhāvato sassatā.

In "permanent," etc., "permanent" due to the absence of arising, "eternal" due to the absence of death, "everlasting" due to existence at all times.

Trong Niccā (thường còn) v.v… niccā do không có sự sinh khởi, dhuvā (bền vững) do không có sự chết, sassatā (vĩnh cửu) do luôn hiện hữu.

Aniccapaṭipakkhato vā niccā, thirabhāvato dhuvā, sassatisamatāya sassatā, jarādivasena vipariṇāmassa abhāvato avipariṇāmadhammāti maññati.

Or, one perceives "permanent" because it is the opposite of impermanent, "eternal" because it is steadfast, "everlasting" because it is perpetual, and "of an unchangeable nature" because there is no alteration by way of old age, etc.

Hoặc niccā do đối lập với vô thường, dhuvā do bền vững, sassatā do đồng nghĩa với vĩnh cửu, avipariṇāmadhammā (không có pháp biến hoại) do không có sự biến hoại bởi già nua v.v…

Sabbe sattāti oṭṭhagoṇagadrabhādayo anavasesā sañjanaṭṭhena sattā.

"All beings" refers to all, without exception, such as camels, cows, and donkeys, as beings in the sense of existing.

Sabbe sattā (tất cả chúng sinh) là tất cả các loài không còn sót lại như lạc đà, bò, lừa v.v… là sattā do chúng sinh sống.

Sabbe pāṇāti ‘‘ekindriyo pāṇo dvindriyo pāṇo’’tiādivasena vuttā anavasesā pāṇanaṭṭhena pāṇā.

"All living things" refers to all, without exception, described as "a one-faculty living thing, a two-faculty living thing," etc., as living things in the sense of breathing.

Sabbe pāṇā (tất cả sinh vật) là tất cả các loài không còn sót lại được nói đến như ‘‘sinh vật một căn, sinh vật hai căn’’ v.v… là pāṇā do chúng có hơi thở.

Sabbe bhūtā ti anavasesā aṇḍakosādīsu bhūtā sañjātāti bhūtā.

"All existing things" refers to all, without exception, existing in eggshells, etc., as existing things (bhūtā) in the sense of being born.

Sabbe bhūtā (tất cả hữu thể) là tất cả các loài không còn sót lại sinh ra trong trứng, bào thai v.v… là bhūtā do chúng đã sinh.

Sabbe jīvā ti sāliyavagodhūmādayo anavasesā jīvanaṭṭhena jīvā.

"All life" refers to all, without exception, such as rice, barley, and wheat, as life (jīvā) in the sense of living.

Sabbe jīvā (tất cả loài có sự sống) là tất cả các loài không còn sót lại như lúa, lúa mạch, lúa mì v.v… là jīvā do chúng có sự sống.

Tesu hi so virūhabhāvena jīvasaññī.

For regarding these, one has the perception of life in the sense of growth.

Trong số đó, người ấy có tưởng về sự sống do chúng có khả năng mọc lên.

Avasā abalā avīriyāti tesaṃ attano vaso vā balaṃ vā vīriyaṃ vā natthīti dasseti.

"Without mastery, without strength, without vigor" shows that they have no mastery, strength, or vigor of their own.

Avasā abalā avīriyā (không có quyền tự chủ, không có sức mạnh, không có tinh tấn) chỉ ra rằng chúng không có quyền tự chủ, sức mạnh hay tinh tấn của riêng mình.

Niyatisaṅgatibhāvapariṇatāti ettha niyatīti.

Here, in "determined by destiny, conjunction, and nature," "destiny" is meant.

Trong Niyatisaṅgatibhāvapariṇatāti (được định đoạt bởi số phận, sự kết hợp và bản chất), niyatī (số phận) là

Niyatatā, acchejjasuttāvutaabhejjamaṇi viya avijahitapakatitā.

"Determinedness" is unabandoned nature, like an unbreakable thread or an inseparable jewel.

Niyatatā (sự cố định), là bản chất không thay đổi, giống như viên ngọc không thể tách rời được xâu bằng sợi dây không thể đứt.

Saṅgatīti channaṃ abhijātīnaṃ tattha saṅgamo.

"Conjunction" is the meeting of the six classes of beings there.

Saṅgatī (sự kết hợp) là sự hòa hợp của sáu loại chủng tánh ở đó.

Bhāvoti sabhāvoyeva, kaṇḍakānaṃ tikhiṇatā, kapiṭṭhaphalādīnaṃ parimaṇḍalāditā, migapakkhīnaṃ vicittavaṇṇāditāti evamādiko.

"Nature" is inherent nature itself, such as the sharpness of thorns, the roundness of wood-apple fruits, etc., and the variegated colors of deer and birds, and so on.

Bhāvo (bản chất) là chính bản chất, như sự sắc bén của gai, sự tròn trịa của quả mộc qua v.v…, sự đa dạng về màu sắc của chim thú v.v…

Evaṃ niyatiyā ca saṅgatiyā ca bhāve ca pariṇatā nānappakārataṃ pattā.

Thus, determined by destiny, conjunction, and nature, they have attained various forms.

Như vậy, được định đoạt bởi số phận, sự kết hợp và bản chất, chúng đạt được nhiều loại khác nhau.

Yena hi yathā bhavitabbaṃ, so tatheva bhavati.

It shows that whatever is destined to be, it is so, and whatever is not destined to be, it is not.

Điều này cho thấy rằng cái gì phải xảy ra thì sẽ xảy ra như vậy.

Yena na bhavitabbaṃ, so na bhavatīti dasseti.

It shows that what should not exist, does not exist.

Cái gì không phải xảy ra thì sẽ không xảy ra.

Chasvevābhijātīsūti kaṇhābhijātiādīsu chasu eva abhijātīsu ṭhatvā sukhañca dukkhañca paṭisaṃvedenti, aññā sukhadukkhabhūmi natthīti dasseti.

"In the six classes of beings only" shows that they experience happiness and suffering only by remaining in the six classes of beings such as the dark class, and there is no other plane of happiness and suffering.

Chasvevābhijātīsū (chỉ trong sáu chủng tánh) chỉ ra rằng chúng trải nghiệm hạnh phúc và khổ đau khi an trú chỉ trong sáu chủng tánh như chủng tánh đen v.v…, không có cõi hạnh phúc và khổ đau nào khác.

Vā-saddena antādibhede diṭṭhābhinivese saṅgaṇhāti.

The word "or" includes the extreme and other distinctions of dogmatic adherence to views.

Từ vā (hoặc) bao gồm các chấp thủ về kiến chấp có sự khác biệt về giới hạn v.v…

252

Upapattinti iminā tasmiṃ tasmiṃ sattanikāye bhūtānaṃ sahabyataṃ ākaṅkhatīti dasseti.

By "birth," it shows that one desires companionship with existing beings in this or that class of beings.

Với Upapattiṃ (sự tái sinh), điều này chỉ ra rằng người ấy mong muốn sự đồng hành của các hữu thể trong từng loại chúng sinh đó.

Sukhuppattinti iminā pana tattha tattha uppannassa sukhuppattiṃ.

By "the arising of happiness," it shows the arising of happiness in one born here and there.

Với Sukhuppattiṃ (sự phát sinh hạnh phúc), điều này chỉ ra sự phát sinh hạnh phúc của người đã tái sinh ở đó.

Ekacce bhūte niccātiādinā ekaccasassatikadiṭṭhiṃ dasseti.

By "some beings are permanent," etc., it shows the partial eternalist view.

Với Ekacce bhūte niccā (một số hữu thể là thường còn) v.v… điều này chỉ ra kiến chấp thường còn một phần.

Ahampi bhūtesu aññatarosmīti iminā pana catutthaṃ ekaccasassatikavādaṃ dasseti.

By "I, too, am one of the beings," it shows the fourth partial eternalist doctrine.

Với Ahampi bhūtesu aññatarosmī (ta cũng là một trong các hữu thể), điều này chỉ ra thuyết thường còn một phần thứ tư.

253

Yato kutocīti issarapurisādibhedato yato kutoci.

"From any source whatsoever" means from any source whatsoever, such as Ishvara, Purisa, etc.

Yato kutocī (từ bất cứ đâu) là từ bất cứ đâu, có sự khác biệt như một vị thần, một người đàn ông v.v…

Ekā taṇhāmaññanāva labbhatīti idhāpi heṭṭhā vuttanayena itaramaññanānampi sambhavo niddhāretabbo.

"Only craving-perception is obtained" here also implies the possibility of other perceptions, in the manner stated below.

Ekā taṇhāmaññanāva labbhatī (chỉ có một tưởng tham ái được tìm thấy) Ở đây cũng vậy, sự hiện hữu của các tưởng khác cần phải được xác định theo phương pháp đã nêu ở phần dưới.

Vuttappakāreyeva bhūte taṇhādiṭṭhīhi abhinandatītiādinā vattabbattā āha ‘‘vuttanayamevā’’ti.

Since it is to be stated that one delights in beings of the stated kind with craving and views, etc., it says, "the stated method itself."

Do cần phải nói rằng người ấy hoan hỷ với các hữu thể như đã nêu bằng tham ái và kiến chấp v.v… nên nói ‘‘chính là phương pháp đã nêu’’.

Yojanā kātabbāti ‘‘yo bhūtapaññattiyā upādānabhūte khandhe parijānāti, so tīhi pariññāhi parijānātī’’tiādinā yojanā kātabbā.

"The connection should be made" means the connection should be made thus: "One who fully comprehends the aggregates that are the basis of the designation of being, fully comprehends by means of the three full comprehensions."

Yojanā kātabbā (cần phải kết nối) có nghĩa là cần phải kết nối theo cách ‘‘người nào hiểu rõ các uẩn là đối tượng chấp thủ của sự phân biệt hữu thể, người ấy hiểu rõ bằng ba loại liễu tri’’.

Apare panettha bhūtagāmopi bhūta-saddena saṅgahitoti rukkhādivasenapi maññanāvibhāgaṃ yojetvā dassenti, tathā mahābhūtavasenapi, taṃ aṭṭhakathāyaṃ natthi.

Others here, however, show the division of perception as connected with plants, etc., by including the plant kingdom within the word "being," and also by way of the great elements, but this is not found in the Commentary.

Những người khác ở đây lại cho rằng các loài thực vật (bhūtagāma) cũng được bao gồm trong từ bhūta (hữu thể), và họ kết nối sự phân biệt tưởng theo cách của cây cối v.v…, và cũng theo cách của các đại chủng, nhưng điều đó không có trong Aṭṭhakathā.

254

Bhūmivisesādinā bhedenāti bhūmivisesaupapattivisesādivibhāgena.

"By distinctions such as specific planes" means by distinctions such as specific planes of existence and specific types of rebirth.

Bhūmivisesādinā bhedenā (bằng sự khác biệt về loại cõi v.v…) là bằng sự phân biệt về loại cõi, loại tái sinh v.v…

Iddhiyāti puññavisesanibbattena ānubhāvena.

"By psychic power" means by the power produced by special merit.

Iddhiyā (bằng thần thông) là bằng oai lực được sinh ra bởi phước báu đặc biệt.

Kiñcāpi deva-saddo ‘‘viddhe vigatavalāhake deve’’tiādīsu (saṃ. ni. 1.110; 3.102; 5.146-148; ma. ni. 1.486; a. ni. 10.15; itivu. 27) ajaṭākāse āgato, ‘‘devo ca thokaṃ thokaṃ phusāyatī’’tiādīsu meghe, ‘‘ayañhi deva kumāro’’tiādīsu (dī. ni. 2.34, 35, 36) khattiye āgato, ‘‘pañcahi kāmaguṇehi samappito samaṅgibhūto paricāreti devo maññe’’tiādīsu (dī. ni. 1.183; ma. ni. 2.211) viya idha upapattidevesu āgato, deva-saddena pana vattabbasatte anavasesato uddharitvā tato idhādhippete dassetuṃ ‘‘te tividhā’’tiādi vuttaṃ.

Although the word deva occurs in "in a clear, cloudless sky" and so on (Saṃ. Ni. 1.110; 3.102; 5.146-148; Ma. Ni. 1.486; A. Ni. 10.15; Itivu. 27) for a clear sky, and in "the sky rains little by little" and so on for a cloud, and in "this prince is indeed a deva" and so on (Dī. Ni. 2.34, 35, 36) for a khattiya, and as here in "he, endowed with and fully possessed of the five sense pleasures, attends, I imagine, a deva" and so on (Dī. Ni. 1.183; Ma. Ni. 2.211) for devas of rebirth, yet to select from all beings referable by the word deva and show those intended here, "They are of three kinds," etc., is stated.

Mặc dù từ deva (chư thiên) được dùng để chỉ bầu trời không mây trong các câu ‘‘trên bầu trời trong xanh không mây’’ (Saṃ. Ni. 1.110; 3.102; 5.146-148; Ma. Ni. 1.486; A. Ni. 10.15; Itivu. 27), để chỉ mây trong các câu ‘‘mây mưa nhỏ giọt từng chút một’’, để chỉ vua trong các câu ‘‘vị hoàng tử này là một vị thần’’ (Dī. Ni. 2.34, 35, 36), nhưng ở đây nó được dùng để chỉ các chư thiên tái sinh, như trong câu ‘‘được trang bị và đầy đủ năm dục lạc, ta nghĩ đó là một vị thần phục vụ’’ (Dī. Ni. 1.183; Ma. Ni. 2.211). Tuy nhiên, để chỉ ra những gì được ngụ ý ở đây từ tất cả các chúng sinh được gọi là deva, đã nói ‘‘te tividhā’’ (chúng có ba loại) v.v…

Sesā cha kāmāvacarā idha devāti adhippetā itaresaṃ padantarehi nivattitattāti adhippāyo.

"The remaining six classes of Kāmāvacara devas are intended here as devas," is the intention, because the others are excluded by other terms.

Sesā cha kāmāvacarā idha devāti adhippetā (sáu cõi dục giới còn lại được ngụ ý là chư thiên ở đây), ý nghĩa là do những cõi khác đã bị loại trừ bởi các từ khác.

Bhūtā devāti gahitesu sattesu taṇhādimaññanānaṃ pavattākārenapi tividhalakkhaṇanti āha ‘‘bhūtavāre vuttanayena veditabbā’’ti.

Regarding beings understood as devas, the characteristic of three kinds also applies in the manner of the occurrence of craving and other perceptions, so it says, "should be understood in the manner stated in the 'beings' section."

Và để chỉ ra rằng các tưởng tham ái v.v… trong các chúng sinh được coi là chư thiên cũng có ba loại về cách thức diễn tiến, nói ‘‘bhūtavāre vuttanayena veditabbā’’ (cần phải hiểu theo phương pháp đã nêu trong phần hữu thể).

255

‘‘Aññatarassa upāsakassa pajāpati abhirūpā hotī’’tiādīsu (pārā. 168) pajāpati-saddo gharaṇiyaṃ āgato, ‘‘pajāpati kāmadāyī suvaṇṇavaṇṇā me pajā hotū’’tiādīsu diṭṭhigatikaparikappite, ‘‘pajāpatissa devarājassa dhajaggaṃ ullokeyyāthā’’tiādīsu (saṃ. ni. 1.249) devajeṭṭhake, idha pana adhipatīti vadanti, taṃ upari brahmuno gayhamānattā tesaṃ matimattaṃ.

In "the wife of a certain lay follower is beautiful," and so on (Pārā. 168), the word pajāpati occurs for a wife; in "May my wife be a giver of desires, golden-colored," and so on, for those imagined by adherents of views; in "gaze at the banner top of Pajāpati, the king of devas," and so on (Saṃ. Ni. 1.249), for the chief of devas; but here they say it means "lord," which is merely their opinion, as Brahma is taken up later.

Trong các câu ‘‘vợ của một cư sĩ nào đó xinh đẹp’’ (Pārā. 168) v.v…, từ pajāpati (vợ) được dùng để chỉ người vợ, trong các câu ‘‘hỡi Prajāpati, người ban phát dục lạc, nguyện cho con ta có màu vàng rực’’ v.v… được dùng để chỉ những gì được những người có kiến chấp tưởng tượng, trong các câu ‘‘hãy nhìn lên ngọn cờ của vua trời Prajāpati’’ (Saṃ. Ni. 1.249) v.v… được dùng để chỉ vị thần tối cao. Nhưng ở đây, họ nói rằng nó có nghĩa là người đứng đầu, nhưng đó chỉ là ý kiến của họ, vì Brahma được đề cập ở trên.

Devānanti cātumahārājikādidevānaṃ.

"Of the devas" refers to the Cātummahārājika and other devas.

Devānaṃ (của chư thiên) là của các chư thiên Tứ Đại Thiên Vương v.v…

Mahārājādīnanti ādi-saddena sakkasuyāmasantussitasunimmitavasavattino gahitā.

By "the great kings, etc.," the word ādi (etc.) includes Sakka, Suyāma, Santussita, Sunimmita, and Vasavatti.

Mahārājādīnaṃ (của các Đại Thiên Vương v.v…) từ ādi (v.v…) bao gồm Sakka, Suyāma, Santusita, Sunimmita, Vasavatti.

Tesanti mahārājādīnaṃ.

"Of those" refers to the great kings, etc.

Tesaṃ (của chúng) là của các Đại Thiên Vương v.v…

Sattasaṅkhātāyāti kāmabhūmiyaṃ sattasaṅkhātāya.

"Designated as beings" means designated as beings in the sense-sphere plane.

Sattasaṅkhātāyā (được gọi là chúng sinh) là được gọi là chúng sinh trong cõi dục giới.

Pajāpatinti pajāpatibhāvaṃ.

"Pajāpati-hood" means the state of being Pajāpati.

Pajāpatiṃ (trạng thái của Prajāpati) là trạng thái của Prajāpati.

Pajāpatibhāvena hi mānaṃ jappento pajāpatiṃ mānamaññanāya maññatīti vutto.

Indeed, one who utters conceit by way of the state of being Pajāpati, conceives Pajāpati with the conceiving of conceit, it is said.

Quả thật, khi niệm tưởng về sự kiêu mạn do bản chất của Pajāpati, người ấy được nói là nhận thức về Pajāpati với sự kiêu mạn.

256

Ekā diṭṭhimaññanāva yujjatīti vuttaṃ, pajāpatino pana samipataṃ salokataṃ vā ākaṅkhato, tathābhāvāya cittaṃ paṇidahato, tathāladdhabbāya sampattiyā attano seyyādibhāvaṃ dahato ca taṇhāmānamaññanāpi sambhavantīti sakkā viññātuṃ.

It is said that "only one conceiving, that of view, is applicable" (here), but it can be understood that the conceiving of craving and conceit are also possible for one who desires closeness or companionship with Pajāpati, who directs their mind to such a state, and who considers their own superiority, etc., through the attainment to be gained.

Đã nói rằng chỉ một sự nhận thức dựa trên tà kiến là phù hợp, nhưng có thể hiểu rằng đối với Pajāpati, khi mong muốn sự gần gũi hoặc cùng cõi với Ngài, khi đặt tâm hướng đến trạng thái đó, và khi nhận thấy bản thân có địa vị cao hơn do sự thành tựu của những gì đáng được như vậy, thì sự nhận thức dựa trên tham ái và kiêu mạn cũng có thể phát sinh.

Ye ca dhammāti āyuvaṇṇādike vadati.

"And what phenomena" refers to longevity, complexion, and so forth.

Ye ca dhammā (và những pháp nào) nói về tuổi thọ, sắc đẹp, v.v.

Pajāpatinti etthāpi heṭṭhā vuttanayena itaramaññanānampi sambhavo veditabbo.

Here too, concerning "Pajāpati", the possibility of other conceivings should be understood according to the method stated below.

Trong Pajāpati (Chúa Tể) ở đây cũng cần hiểu rằng các loại nhận thức khác cũng có thể phát sinh theo cách đã nói ở trên.

257

Brūhitoti parivuddho.

"Brūhito" means developed.

Brūhito là được nuôi dưỡng, được tăng trưởng.

Guṇavisesehīti jhānādīhi visiṭṭhehi guṇehi uttarimanussadhammatāya.

"By special qualities" means by distinguished qualities such as jhāna and so forth, due to the state of superhuman phenomena.

Guṇavisesehi là bởi những phẩm chất đặc biệt như thiền định, bởi pháp siêu nhân (uttarimanussadhamma).

Brahma-saddassa satipi avisesato visiṭṭhavācakatte yattha yattha panassa guṇavisesayuttādirūpā pavatti, taṃ dassetuṃ ‘‘apicā’’tiādi vuttaṃ.

Although the word 'brahma' generally denotes distinction, "and moreover," etc., is stated to show where its occurrence is in the form of being endowed with specific qualities.

Mặc dù từ Brahma không phân biệt có nghĩa là "tối thượng", nhưng để chỉ ra rằng sự hiện hữu của nó ở bất cứ đâu đều có hình thức gắn liền với những phẩm chất đặc biệt, nên đã nói "apicā" (hơn nữa) v.v.

Sahassoti sahassiyā lokadhātuyā adhipatibhūto.

"Sahasso" means the lord of a thousand world-systems.

Sahasso là vị chủ tể của một ngàn thế giới (sahassī lokadhātu).

Paṭhamābhinibbattoti paṇītena paṭhamajhānena nibbatto, paṭhamajjhānabhūmiyaṃ vā paṭhamaṃ abhinibbatto.

"Paṭhamābhinibbatto" means born by means of the refined first jhāna, or first born in the realm of the first jhāna.

Paṭhamābhinibbatto là được sinh ra bởi thiền định sơ thiền cao quý, hoặc được sinh ra đầu tiên trong cõi sơ thiền.

Gahitāti veditabbā padhānaggahaṇena appadhānānampi kenaci sambandhena gahitabhāvasiddhito.

"Are to be understood as included" because by including the principal, the inclusion of the non-principal is established through some connection.

Gahitāti veditabbā (cần hiểu là đã được nắm giữ) vì sự nắm giữ các yếu tố chính cũng dẫn đến sự nắm giữ các yếu tố phụ bằng một mối liên hệ nào đó.

Ettha ca brahmāti mahābrahmā adhippeto.

Here, "brahmā" refers to Mahābrahmā.

Ở đây, brahmā (Brahma) được hiểu là Mahābrahmā (Đại Phạm Thiên).

So hi vaṇṇavantatāya ceva dīghāyukatāya ca brahmapārisajjādīhi mahanto brahmāti mahābrahmā, tassa pana purohitaṭṭhāne ṭhitāti brahmapurohitā, parisāyaṃ bhavā paricārakāti brahmapārisajjāti veditabbā.

Indeed, he is Mahābrahmā, great among the Brahmā assembly, etc., due to his radiance and long life; and those standing in the position of his chaplain are "Brahmapurohitā"; those who are attendants in his assembly are "Brahmapārisajjā" - so it should be understood.

Vị ấy là Mahābrahmā vì vĩ đại hơn các Phạm Thiên tùy tùng (brahmapārisajja) v.v. cả về sắc đẹp và tuổi thọ dài lâu. Cần hiểu rằng brahmapurohitā là những vị đứng ở vị trí cố vấn của Ngài, và brahmapārisajjā là những người hầu cận trong hội chúng.

Ukkaṭṭhekapuggalabhāvato pajāpatismiṃ viya brahmani maññanā vattatīti vuttaṃ ‘‘pajāpativāre vuttanayeneva veditabbā’’ti.

It is said that conceit applies to Brahmā, similar to Pajāpati, due to his state as the supreme individual, as stated: "should be understood in the same way as in the Pajāpati section."

Đã nói rằng "pajāpativāre vuttanayeneva veditabbā" (cần hiểu theo cách đã nói trong phần Pajāpati) vì sự nhận thức diễn ra đối với Brahma cũng như đối với Pajāpati, do bản chất của một cá nhân tối thượng.

Tathā hi bahupuggalabhāvasāmaññato ābhassaravārādīnaṃ bhūtavārasadisatā vuttā.

Thus, the similarity of the Ābhassara sections, etc., to the Bhūta sections is stated due to the commonality of having many individuals.

Thật vậy, sự tương đồng của các phần Ābhassara (Quang Âm) v.v. với phần Bhūta (Chúng Sinh) đã được nói đến do sự tương đồng về bản chất của nhiều cá nhân.

258

Yathāvuttapabhāya ābhāsanasīlā vā ābhassarā.

"Ābhassarā" are those whose nature is to shine with radiance as described.

Hoặc những vị có thói quen tỏa sáng với ánh sáng đã nói trên là ābhassarā (Quang Âm).

Ekatalavāsinoti idaṃ jhānantarabhūmīnaṃ viya heṭṭhuparibhāvābhāvato vuttaṃ, ṭhānāni pana nesaṃ paricchinnāneva.

"Dwelling on one plane" is stated because there is no higher or lower state as there is for the jhāna-interval realms, but their abodes are indeed specific.

Ekatalavāsino (những vị sống trên cùng một tầng) được nói như vậy vì không có sự phân biệt trên dưới như các cõi thiền trung gian, nhưng các nơi ở của họ vẫn được phân định rõ ràng.

Ābhassarehi parittā ābhā etesanti parittābhā.

"Parittābhā" means those whose radiance is slight compared to the Ābhassaras.

Những vị có ánh sáng ít hơn Ābhassara là parittābhā (Thiểu Quang).

Appamāṇā ābhā etesanti appamāṇābhā.

"Appamāṇābhā" means those whose radiance is immeasurable.

Những vị có ánh sáng vô lượng là appamāṇābhā (Vô Lượng Quang).

259

Subhāti sobhanā pabhā.

"Subhā" means beautiful radiance.

Subhā là ánh sáng tốt đẹp.

Kañcanapiṇḍo viya sassirikā kañcanapiṇḍasassirikā.

"Kañcanapiṇḍasassirikā" means splendid like a lump of gold.

Kañcanapiṇḍasassirikā là rực rỡ như một khối vàng.

Tattha sobhanāya pabhāya kiṇṇā subhākiṇṇāti vattabbe bhā-saddassa rassattaṃ, antima-ṇa-kārassa ha-kārañca katvā ‘‘subhakiṇhā’’ti vuttā.

Here, when it should be "subhākiṇṇā" (pervaded by beautiful radiance), by shortening the 'bhā' syllable and changing the final 'ṇa' sound to 'ha', it is stated as "subhakiṇhā".

Ở đây, khi đáng lẽ phải nói subhākiṇṇā (được tô điểm bởi ánh sáng tốt đẹp), thì âm bhā bị rút ngắn và chữ ṇa cuối cùng được đổi thành ha, nên đã nói "subhakiṇhā" (Biến Tịnh).

Subhāti ca ekagghanā niccalā pabhā vuccati, parittā subhā etesanti parittasubhā.

And "subhā" refers to a unified, unwavering radiance; "parittasubhā" means those whose radiance is slight.

Và subhā (tịnh) được gọi là ánh sáng ổn định, không lay chuyển. Những vị có ánh sáng tịnh ít hơn là parittasubhā (Thiểu Tịnh).

Appamāṇā subhā etesanti appamāṇasubhā.

"Appamāṇasubhā" means those whose radiance is immeasurable.

Những vị có ánh sáng tịnh vô lượng là appamāṇasubhā (Vô Lượng Tịnh).

260

Vipulaphalāti vipulasantasukhāyuvaṇṇādiphalā.

"Vipulaphalā" means those whose fruit (result) is abundant happiness, long life, complexion, etc.

Vipulaphalā là có quả báo dồi dào về an lạc, hạnh phúc, tuổi thọ, sắc đẹp, v.v.

261

Satipi devabrahmādīnaṃ puññaphalena jhānaphalena ca paṭipakkhābhibhave yesaṃ pana puthujjanaasaññasattesu abhibhūvohāro pākaṭo niruḷho ca, tesaṃ vasenāyaṃ desanā pavattāti dassento āha ‘‘asaññabhavassetaṃ adhivacana’’nti.

Although devas and Brahmās overcome their adversaries through the fruit of merit and the fruit of jhāna, the teaching is set forth according to those in whom the term 'overcoming' is well-known and established among ordinary beings and non-percipient beings, thus he says, "this is a designation for the non-percipient existence."

Mặc dù các vị trời và Phạm Thiên v.v. cũng có sự chế ngự đối nghịch bởi quả báo phước đức và quả báo thiền định, nhưng để chỉ ra rằng lời dạy này diễn ra dựa trên những chúng sinh mà sự chế ngự là rõ ràng và phổ biến trong số các phàm phu và vô tưởng hữu tình, nên đã nói "asaññabhavassetaṃ adhivacana" (đây là tên gọi của cõi vô tưởng).

Yathā pajāpativāre ‘‘idhekacco pajāpatismiṃyevā’’tiādinā maññanāpavatti dassitā, tathā idhāpi taṃ dassetuṃ sakkāti āha ‘‘sesaṃ pajāpativāre vuttanayamevā’’ti.

Just as in the Pajāpati section, the arising of conceiving is shown by "here someone, even in Pajāpati...", so too can it be shown here, thus he says, "the rest should be understood in the same way as in the Pajāpati section."

Như trong phần Pajāpati, sự phát sinh của nhận thức đã được chỉ ra bằng "idhekacco pajāpatismiṃyevā" (ở đây, một số người chỉ đối với Pajāpati) v.v., thì ở đây cũng có thể chỉ ra điều đó, nên đã nói "sesaṃ pajāpativāre vuttanayamevā" (phần còn lại cũng theo cách đã nói trong phần Pajāpati).

262

Bhūtavārādivaṇṇanā niṭṭhitā.

The description of the Bhūta section, etc., is concluded.

Phần giải thích về Bhūtavāra (Chúng Sinh) v.v. đã hoàn tất.

263

Ākāsānañcāyatanavārādivaṇṇanā

Description of the Ākāsānañcāyatana section, etc.

Phần giải thích về Ākāsānañcāyatanavāra (Vô Biên Không Xứ) v.v.

264

4. Evaṃ sattavasena bhūmikkamadassane suddhāvāsānaṃ aggahaṇe kāraṇaṃ niddhārento ‘‘evaṃ bhagavā’’tiādimāha.

4. Thus, explaining the reason for not including the Suddhāvāsā in demonstrating the sequence of realms in terms of beings, the Bhagavā said, "Thus, the Bhagavā," etc.

4. Như vậy, khi xác định lý do không bao gồm các cõi Tịnh Cư (Suddhāvāsa) trong việc trình bày thứ tự các cõi dựa trên chúng sinh, Ngài đã nói "evaṃ bhagavā" (Bạch Thế Tôn) v.v.

Tattha anāgāmikhīṇāsavāti anāgāmino ca khīṇāsavā ca.

Here, "anāgāmikhīṇāsavā" means non-returners and Arahants.

Ở đây, anāgāmikhīṇāsavā là các vị Bất Lai (Anāgāmī) và các vị A-la-hán (Khīṇāsava).

Kiñcāpi suddhāvāsā attheva anekakappasahassāyukā, ukkaṃsaparicchedato pana soḷasakappasahassāyukāva, na tato paranti āha ‘‘katipayakappasahassāyukā’’ti.

Although Suddhāvāsā beings exist with a lifespan of many thousands of aeons, their maximum lifespan is sixteen thousand aeons, and not more than that, so it is said: "with a lifespan of a few thousand aeons."

Mặc dù các vị Tịnh Cư có tuổi thọ hàng ngàn đại kiếp, nhưng theo giới hạn tối đa, họ chỉ có tuổi thọ mười sáu ngàn đại kiếp, không hơn thế, nên đã nói "katipayakappasahassāyukā" (có tuổi thọ vài ngàn đại kiếp).

Kāmarūpabhavesu pavattamānāpi ākāsānañcāyatanādidhammā arūpāvacarabhāvato taṃbhūmikavohāraṃ na labhantīti ‘‘tatrūpapannāyevā’’ti avadhāretvā vuttaṃ.

Even though phenomena like Ākāsānañcāyatana, etc., occur in the kāma and rūpa realms, they do not receive the designation of being of that realm because they are formless, thus it is stated definitively as "only those who are reborn there."

Mặc dù các pháp như Ākāsānañcāyatana (Vô Biên Không Xứ) v.v. vẫn tồn tại trong các cõi Dục giới và Sắc giới, nhưng vì chúng thuộc về cõi Vô sắc, chúng không được gọi là các cõi đó, nên đã nói "tatrūpapannāyevā" (chỉ những vị được tái sinh ở đó) để khẳng định.

Abhibhūvāre vuttanayena veditabbā yathārahanti adhippāyo.

"Should be understood in the way stated in the Abhibhū section" is the intention, as appropriate.

Abhibhūvāre vuttanayena veditabbā (cần hiểu theo cách đã nói trong phần Chế Ngự) là ý muốn nói tùy theo sự phù hợp.

Na hettha vaṇṇavantatādi sambhavatīti.

For here, radiance, etc., are not possible.

Vì ở đây không thể có sắc đẹp v.v.

Pajāpativāre vuttanayenāti ettha ‘‘ahamasmi arūpo pahīnarūpapaṭighasañño’’tiādinā mānamaññanā veditabbā.

In "in the Pajāpati section, in the way stated," conceit should be understood by statements such as "I am formless, with perception of form and sensory impact abandoned."

Trong Pajāpativāre vuttanayenā (theo cách đã nói trong phần Pajāpati), cần hiểu sự nhận thức dựa trên kiêu mạn bằng "ahamasmi arūpo pahīnarūpapaṭighasañño" (ta là vô sắc, đã đoạn trừ tưởng về sắc và sự chống đối) v.v.

265

Ākāsānañcāyatanavārādivaṇṇanā niṭṭhitā.

The description of the Ākāsānañcāyatana section, etc., is concluded.

Phần giải thích về Ākāsānañcāyatanavāra (Vô Biên Không Xứ) v.v. đã hoàn tất.

266

Diṭṭhasutavārādivaṇṇanā

Description of the Diṭṭha, Suta sections, etc.

Phần giải thích về Diṭṭhasutavāra (Cái Thấy và Cái Nghe) v.v.

267

5. Rūpamukhena maññanāvatthudassanaṃ saṅkhepoti katvā vuttaṃ ‘‘vitthāratopī’’ti.

5. It is said "in detail" considering the showing of the object of conceiving through the medium of form as a summary.

5. Việc trình bày đối tượng của nhận thức qua sắc là tóm tắt, nên đã nói "vitthāratopī" (cũng là chi tiết).

Tampi hi ‘‘yattha neva pathavī, na āpo, na tejo, na vāyo, na ākāsānañcāyatana’’ntiādiggahaṇaṃ viya saṅkhepato pañcavokārabhavadassanaṃ hotīti.

For that too, like the apprehension of "where there is neither earth, nor water, nor fire, nor air, nor the dimension of infinite space," etc., is a brief presentation of the five-constituent existence.

Vì điều đó cũng là sự trình bày tóm tắt về cõi ngũ uẩn (pañcavokārabhava) như việc nắm giữ "yattha neva pathavī, na āpo, na tejo, na vāyo, na ākāsānañcāyatana" (ở đó không có đất, không có nước, không có lửa, không có gió, không có không vô biên xứ) v.v.

268

Diṭṭhanti yaṃ cakkhudvārena katadassanakiriyāsamāpanaṃ, yañca cakkhu dvayaṃ passati passissati sati sambhave passeyya, taṃ sabbakālanti visesavacanicchāya abhāvato diṭṭhanteva vuttaṃ yathā ‘‘duddha’’nti.

"Diṭṭha" means that seeing action accomplished through the eye-door, and whatever the eye sees, will see, or would see if possible, is called diṭṭha without special mention of "all time," just as "milk" is said.

Diṭṭhaṃ (cái thấy) là sự hoàn thành hành động thấy được thực hiện qua nhãn căn, và là tất cả những gì mắt thấy, sẽ thấy, và có thể thấy nếu có điều kiện, được gọi là diṭṭha vì không có ý định nói về tất cả các thời gian, giống như duddha (sữa).

Tenāha ‘‘rūpāyatanassetaṃ adhivacana’’nti.

Therefore, it is said: "This is a designation for the visible object (rūpāyatana)."

Vì vậy đã nói "rūpāyatanassetaṃ adhivacana" (đây là tên gọi của sắc xứ).

Ayañca nayo sutādīsupi yojetabbo.

This method should also be applied to "suta", etc.

Cách này cũng cần được áp dụng cho sutā (cái nghe) v.v.

Sattāti rūpādīsu sattā visattāti sattā.

"Sattā" means those who are attached and cling to forms, etc.

Sattā (chúng sinh) là những người bị dính mắc, bị trói buộc vào sắc v.v.

Sañjanaṭṭhena sāmaññasaddopi cesa satta-saddo ‘‘itthirūpe’’ti visayavisesitattā idha purisavācako daṭṭhabbo.

Though the word 'satta' is a general term in the sense of 'clinging', here, being specified by the object "in the form of a woman," it should be understood as referring to a man.

Mặc dù từ satta là một từ chung có nghĩa là "gắn bó", nhưng ở đây nó được hiểu là chỉ người đàn ông vì được xác định bởi đối tượng cụ thể là "itthirūpe" (trong sắc của người phụ nữ).

Rattāti vatthaṃ viya raṅgajātena cittassa vipariṇāmakārakena chandarāgena rattā sārattā.

"Rattā" means colored, deeply attached by the color-producing greed that changes the mind, like a cloth.

Rattā (tham đắm) là bị tham ái (chandarāga) làm biến đổi tâm như vải bị nhuộm bởi thuốc nhuộm, bị tham đắm sâu sắc.

Giddhāti abhikaṅkhanasabhāvena abhigijjhanena giddhā gedhaṃ āpannā.

"Giddhā" means greedy, fallen into greed through the nature of craving and intense longing.

Giddhā (tham lam) là bị tham lam, bị lòng tham chiếm hữu do bản chất mong muốn.

Gadhitāti ganthitā viya lobhena dummocanīyabhāvena ārammaṇe paṭibaddhā.

"Gadhitā" means bound, attached to the object, like something tied, difficult to release due to greed.

Gadhitā (bám víu) là bị trói buộc vào đối tượng như bị thắt chặt bởi lòng tham, khó gỡ bỏ.

Mucchitāti kilesavasena visaññībhūtā viya anaññakiccā mucchaṃ mohaṃ āpannā.

"Mucchitā" means bewildered, like those unconscious due to defilements, not knowing what else to do, fallen into infatuation and delusion.

Mucchitā (mê muội) là như bị mất ý thức do phiền não, không làm được việc gì khác, rơi vào trạng thái mê muội, si mê.

Ajjhosannāti visaye aññasādhāraṇe viya katvā gilitvā pariniṭṭhāpetvā viya ṭhitā.

"Ajjhosannā" means established as if having swallowed and completely appropriated the objects, treating them as if they were one's own.

Ajjhosannā (chìm đắm) là như đã nuốt chửng, đã hoàn tất, coi đối tượng như của riêng mình.

Imināti suvaṇṇavaṇṇādiākārena.

"Iminā" means by this appearance such as golden color, etc.

Iminā (bằng cách này) là bằng hình tướng có màu vàng v.v.

Maṅgalaṃ amaṅgalanti īdisaṃ diṭṭhaṃ maṅgalaṃ, īdisaṃ amaṅgalanti.

"Maṅgalaṃ amaṅgala" means "this kind of seen thing is auspicious, this is inauspicious."

Maṅgalaṃ amaṅgalaṃ (điềm lành, điềm dữ) là cái thấy như thế này là điềm lành, cái thấy như thế này là điềm dữ.

Rūpasmiṃ attānaṃ samanupassananayenāti idaṃ vedanādiarūpadhamme, rūpāyatanavinimuttasabbadhamme vā attato gahetvā tato ajjhattikaṃ, bāhiraṃ vā rūpāyatanaṃ tassokāsabhāvena parikappetvā ‘‘so kho pana me ayaṃ attā imasmiṃ rūpāyatane’’ti maññanto diṭṭhasmiṃ maññatīti imaṃ nayaṃ sandhāya vuttaṃ.

"Rūpasmiṃ attānaṃ samanupassananayenā" (by the way of perceiving oneself in form) is stated with reference to the method of conceiving in what is seen, by conceiving formless phenomena like feeling, etc., or all phenomena distinct from the visible object, as oneself, and then imagining an internal or external visible object as its space, and conceiving, "this self of mine is in this visible object."

Rūpasmiṃ attānaṃ samanupassananayenāti (theo cách quán xét bản thân trong sắc) được nói đến để chỉ cách mà một người nhận thức trong cái thấy, bằng cách lấy các pháp vô sắc như thọ v.v., hoặc tất cả các pháp không thuộc sắc xứ là bản ngã, rồi tưởng tượng sắc xứ bên trong hoặc bên ngoài là nơi ở của bản ngã đó, và nghĩ rằng "bản ngã của ta ở trong sắc xứ này".

‘‘Pathavito maññatī’’tiādīsu yathā ‘‘saupakaraṇassa attano vā parassa vā’’tiādimaññanāpavatti dassitā, evaṃ ‘‘diṭṭhato maññatī’’tiādīsu sakkā taṃ dassetunti āha ‘‘tesaṃ pathavīvāre vuttanayeneva veditabba’’nti.

Just as in "conceives from earth," etc., the occurrence of conceiving such as "of one's own or another's accessories" is shown, so too can it be shown in "conceives from what is seen," etc., thus he says, "these should be understood in the way stated in the earth section."

Như trong "Pathavito maññatī" (nhận thức từ đất) v.v. đã chỉ ra sự phát sinh của nhận thức như "saupakaraṇassa attano vā parassa vā" (của chính mình hoặc của người khác với các vật dụng), thì trong "Diṭṭhato maññatī" (nhận thức từ cái thấy) v.v. cũng có thể chỉ ra điều đó, nên đã nói "tesaṃ pathavīvāre vuttanayeneva veditabba" (cần hiểu theo cách đã nói trong phần đất).

269

Āhaccāti visayaṃ anvāya, patvāti attho.

"Āhaccā" means by approaching the object, having reached it.

Āhaccā là tiếp cận đối tượng, có nghĩa là đạt đến.

Tenāha ‘‘upagantvā’’ti.

Therefore, he says, "having approached."

Vì vậy đã nói "upagantvā" (đến gần).

Aññamaññasaṃsileseti cakkhurūpasotasaddā viya dure ahutvā aññamaññaṃ alliyane.

Mutual adherence means, like the eye and visual object, or ear and sound, not being far apart, but mutually adhering.

Aññamaññasaṃsilesa có nghĩa là như mắt và sắc, tai và tiếng, không ở xa mà dính chặt vào nhau.

270

Manasā viññātaṃ kevalanti attho.

Cognized by the mind means exclusively (by the mind).

Manasā viññātaṃ có nghĩa là chỉ riêng cái được ý nhận biết.

Itarānipi hi manasā viññāyantīti.

For even other things are cognized by the mind.

Vì những cái khác cũng được ý nhận biết.

Sesehi sattahi āyatanehi paññattiyā asaṅgahitattā tampi saṅgahetvā dassetuṃ ‘‘dhammārammaṇassa vā’’ti vuttaṃ.

Because it is not included in the designation by the remaining seven sense bases, and to include and show that, it was said: “or of a dhamma object.”

Do không được bao gồm trong sự phân loại của bảy xứ còn lại, nên để bao gồm và trình bày cả điều đó, đã nói “hoặc đối tượng pháp”.

Dvīsupi vikappesu lokuttarānampi saṅgaho āpannoti āha ‘‘idha pana sakkāyapariyāpannameva labbhatī’’ti.

Since the supra-mundane (lokuttara) is also included in both alternatives, he said: “but here only what is included in sakkāya is found.”

Trong cả hai trường hợp, sự bao gồm cả các pháp siêu thế cũng được hàm ý, nên nói “tuy nhiên ở đây chỉ có cái thuộc về hữu thân mới được chấp nhận”.

Vitthāroti maññanānaṃ pavattanākāravitthāro.

Detailed exposition means the detailed manner in which conceivings occur.

Vitthāra là sự triển khai về cách thức phát sinh của các tưởng tri.

Etthāti etesu sutavārādīsu.

Here means in these chapters on seeing, hearing, and so forth.

Ettha là trong các phương diện về cái đã thấy, v.v.

271

Diṭṭhasutavārādivaṇṇanā niṭṭhitā.

The commentary on the chapters on seeing and hearing is concluded.

Hoàn tất phần giải thích các phương diện về cái đã thấy, đã nghe, v.v.

272

Ekattavārādivaṇṇanā

Commentary on the chapters on oneness, etc.

Giải thích các phương diện về nhất thể, v.v.

273

6. Samāpannakavārenāti samāpannakappavattiyā, rūpāvacarārūpāvacarajhānappavattiyāti attho.

6. By the chapter on attainment means by the occurrence of attainment, that is, by the occurrence of rūpāvacara and arūpāvacara jhāna.

6. Samāpannakavārena có nghĩa là bằng sự phát sinh của trạng thái nhập định, tức là sự phát sinh của các thiền sắc giới và vô sắc giới.

Sā hi ekasmiṃyeva ārammaṇe ekākārena pavattatīti katvā ‘‘ekatta’’nti vuccati, evañca katvā vipākajjhānappavattipi idha samāpannakavāraggahaṇeneva gahitāti daṭṭhabbā.

Since it occurs in one object in a singular manner, it is called "oneness," and thus, the occurrence of vipāka-jhāna is also to be understood as included here by the designation of the chapter on attainment.

Vì nó phát sinh trong một đối tượng duy nhất với một trạng thái duy nhất, nên được gọi là “nhất thể” (ekatta), và như vậy, sự phát sinh của thiền dị thục cũng được bao gồm ở đây bằng cách nắm giữ phương diện nhập định.

Asamāpannakavārenāti kāmāvacaradhammappavattiyā.

By the chapter on non-attainment means by the occurrence of kāma-realm phenomena.

Asamāpannakavārena có nghĩa là bằng sự phát sinh của các pháp dục giới.

Upacārajjhānenapi hi cittaṃ na sammā ekattaṃ gatanti vuccatīti.

For even with access jhāna, the mind is said not to have reached oneness completely.

Vì tâm ngay cả trong cận định cũng không được gọi là đã đạt đến nhất thể một cách đúng đắn.

274

Yojanāti maññanāyojanā.

Application means the application of conceiving.

Yojanā là sự kết nối của tưởng tri.

Bhinditvāti vibhajitvā.

Dividing means separating.

Bhinditvā là phân chia.

Sāsananayenāti pāḷinayena.

By the method of the teaching means by the method of the Pāḷi text.

Sāsananayena là theo phương pháp của giáo điển.

Tattha ‘‘ekattaṃ maññatī’’tiādīsu ‘‘vedanaṃ attato samanupassatī’’tiādinā nayena, ‘‘nānattaṃ maññatī’’tiādīsu pana ‘‘rūpaṃ attato samanupassatī’’tiādinā nayena vuttavidhiṃ anugantvā maññanā veditabbā.

Here, in phrases like "conceives oneness," conceiving is to be understood by the method beginning "perceives feeling as self," and in phrases like "conceives diversity," by the method beginning "perceives form as self."

Trong các câu như “tưởng tri là nhất thể”, v.v., tưởng tri cần được hiểu theo phương pháp như “quan sát thọ là tự ngã”, v.v.; còn trong các câu như “tưởng tri là dị thể”, v.v., thì theo phương pháp như “quan sát sắc là tự ngã”, v.v.

275

Pathavīvārādīsu vuttena ca aṭṭhakathānayenāti ‘‘ahaṃ vedanāti maññati, mama vedanāti maññatī’’tiādinā, ‘‘ahaṃ rūpanti maññati, mama rūpanti maññatī’’tiādinā cāti attho.

And by the method of the Aṭṭhakathā stated in the chapters on earth, etc. means "I conceive it as feeling, I conceive feeling as mine," and "I conceive it as form, I conceive form as mine," is the meaning.

Pathavīvārādīsu vuttena ca aṭṭhakathānayenāti có nghĩa là theo phương pháp của Chú Giải đã nói trong các phương diện về đất, v.v., như “tưởng tri rằng ta là thọ, tưởng tri rằng thọ là của ta”, v.v., và “tưởng tri rằng ta là sắc, tưởng tri rằng sắc là của ta”, v.v.

Tenāha ‘‘yathānurūpaṃ vīmaṃsitvā’’ti, ekattanānattabhāvesu yo yojanānayo sambhavati, tadanurūpaṃ vicāretvāti attho.

Therefore, he said: “having investigated appropriately,” meaning having deliberated according to the method of application that is possible in the states of oneness and diversity.

Vì vậy, nói “yathānurūpaṃ vīmaṃsitvā”, có nghĩa là sau khi xem xét phù hợp với phương pháp kết nối có thể có trong các trạng thái nhất thể và dị thể.

Kecīti abhayagirivāsino.

Some refers to the residents of Abhayagiri.

Kecī là những người trú Abhayagiri.

Apareti sārasamāsācariyā.

Others refers to the teachers of Sārasamāsa.

Apare là các vị sư Sārasamāsa.

Diṭṭhābhinivesaṃ vadantīti sambandho.

The connection is that they speak of adherence to views.

Có mối liên hệ là họ nói về chấp thủ tà kiến.

Puthujjanassa maññanā nāma sakkāyaṃ bhinditvāva yathāupaṭṭhitavisayavaseneva pavattatīti na tattha ayamekattanayo ayaṃ nānattanayoti vibhāgavaseneva, ekattasaññī attā hotītiādīsu ca attano ekattanānattasaññitā vuttā, na pana ekattaṃ nānattanti evaṃ pavattassa diṭṭhābhinivesassa ekattanānattabhāvoti evamettha tadubhayassa idha anadhippetabhāvo daṭṭhabbo.

The conceiving of an ordinary person (puthujjana) always occurs by breaking down sakkāya, simply according to the presented object, and not by distinguishing "this is the method of oneness, this is the method of diversity." Furthermore, in phrases like "one who has the perception of oneness is the self," the self's perception of oneness and diversity is stated, but here, the state of oneness and diversity of the adherence to views that occurs as "oneness" and "diversity" is not intended; this is to be understood here for both.

Tưởng tri của phàm phu, sau khi chia chẻ hữu thân, chỉ phát sinh tùy theo đối tượng hiện hữu; không phải theo cách phân biệt đây là phương pháp nhất thể, đây là phương pháp dị thể; và trong các câu như “người có tưởng tri nhất thể là tự ngã”, v.v., đã nói về tưởng tri nhất thể và dị thể của tự ngã, nhưng không phải là trạng thái nhất thể và dị thể của chấp thủ tà kiến phát sinh như vậy là nhất thể hay dị thể; do đó, cần phải hiểu rằng cả hai điều đó không được đề cập ở đây.

276

Yaṃ yathāvuttaputhujjano anavasesato gaṇhanto gahetuṃ sakkoti, taṃ tassa anavasesato gahetabbataṃ upādāya ‘‘sabba’’nti vuccatīti dassento ‘‘tamevā’’ti āha, sakkāyasabbanti attho.

That which the aforementioned ordinary person is able to grasp completely, referring to the fact that it is to be grasped by him completely, is called “all,” thus he says: “that very thing,” meaning sakkāya.

Để chỉ ra rằng cái mà phàm phu đã nói ở trên có thể nắm giữ một cách không sót, điều đó được gọi là “sabbaṃ” (tất cả) dựa trên việc cần phải nắm giữ một cách không sót, nên nói “tamevā” (chính điều đó), có nghĩa là sự ràng buộc của hữu thân.

Sabbasmimpi tebhūmakadhamme ādīnavadassane asati nibbidābhāvato assādānupassanāya taṇhā vaḍḍhatevāti āha ‘‘sabbaṃ assādento sabbaṃ taṇhāmaññanāya maññatī’’ti.

He said: “delighting in all, he conceives all with conceiving born of craving,” because without seeing the danger in all three-realm phenomena, there is no disenchantment, and craving increases through the contemplation of delight.

Khi không có sự thấy rõ hiểm họa trong tất cả các pháp ba cõi, do không có sự nhàm chán, nên tham ái tăng trưởng do sự quán chiếu vị ngọt, vì vậy nói “sabbaṃ assādento sabbaṃ taṇhāmaññanāya maññatī” (khi nếm trải tất cả, tưởng tri tất cả bằng tưởng tri tham ái).

Vuttañhetaṃ bhagavatā – ‘‘saṃyojaniyesu, bhikkhave, dhammesu assādānupassino viharato taṇhā pavaḍḍhatī’’ti (saṃ. ni. 2.53, 57).

For this was said by the Blessed One: “Monks, for one who dwells contemplating delight in phenomena conducive to fetters, craving increases.”

Điều này đã được Đức Thế Tôn nói: “Này các tỳ khưu, khi một người sống quán chiếu vị ngọt trong các pháp thuộc về kiết sử, tham ái sẽ tăng trưởng” (Saṃ. ni. 2.53, 57).

‘‘Sabbamidaṃ mayā nimmita’’nti tena nimmitamaññanāya attānaṃ seyyādito dahanto tena mānena nimmitaṃ maññatiyeva nāma nimmitamaññanāya vinā tathāmānuppattiyā abhāvatoti āha ‘‘attanā nimmitaṃ maññanto sabbaṃ mānamaññanāya maññatī’’ti.

As for the statement “conceiving oneself as created, he conceives all with conceiving born of conceit,” it means: “All this was created by me.” By conceiving of himself as superior due to this conceiving of creation, he conceives it as created with that conceit, because without conceiving of creation, such conceit cannot arise.

“Tất cả điều này do ta tạo ra” – khi tưởng tri tự ngã mình là cao quý hơn, v.v., bằng tưởng tri tạo tác đó, thì tưởng tri bằng kiêu mạn tạo tác, vì không có sự phát sinh của kiêu mạn như vậy nếu không có tưởng tri tạo tác, nên nói “attanā nimmitaṃ maññanto sabbaṃ mānamaññanāya maññatī” (khi tưởng tri do mình tạo ra, tưởng tri tất cả bằng tưởng tri kiêu mạn).

Sabbaṃ natthītiādinā nayenāti ādi-saddena niyativādādike saṅgaṇhāti.

By the method of “all does not exist,” etc., the word “etc.” includes determinism (niyati-vāda) and so forth.

Sabbaṃ natthītiādinā nayenāti (theo phương pháp “tất cả không có”, v.v.) bằng từ “ādi” (v.v.) bao gồm thuyết định mệnh, v.v.

Mahā me attāti iminā sabbato attano vibhūtipavattivādaṃ dasseti.

By “my self is great,” he shows the doctrine of the self's manifestation everywhere.

Mahā me attā (tự ngã của ta là vĩ đại) – bằng điều này, chỉ ra thuyết về sự phát sinh vĩ đại của tự ngã trong tất cả.

‘‘Sabbaṃ sabbatthaka’’nti diṭṭhivasena – ‘‘ahaṃ sabbasmiṃ mayhaṃ kiñcanaṃ palibodho sabbasmiṃ, paro sabbasmiṃ parassa kiñcanaṃ palibodho sabbasmi’’ntiādinā nayenapettha maññanā sambhavatīti dassento āha ‘‘sesaṃ pathavīvāre vuttanayena veditabba’’nti.

He said: “the rest is to be understood by the method stated in the chapter on earth,” showing that conceiving can occur here by way of the view “all is everywhere,” such as “I am in all, nothing of mine is a hindrance in all; the other is in all, nothing of the other is a hindrance in all,” etc.

Để chỉ ra rằng ở đây có thể có tưởng tri theo phương pháp của tà kiến “tất cả là tất cả” – “ta ở trong tất cả, không có gì là chướng ngại của ta trong tất cả; người khác ở trong tất cả, không có gì là chướng ngại của người khác trong tất cả”, v.v., nên nói “sesaṃ pathavīvāre vuttanayena veditabba” (phần còn lại cần được hiểu theo phương pháp đã nói trong phương diện về đất).

Apica ‘‘sabboyaṃ loko purisamayo’’ti evaṃdiṭṭhiko purisasaṅkhātato sabbato, attano uppattiṃ vā niggamanaṃ vā maññanto diṭṭhimaññanāya sabbato maññati, tasmiṃyeva pana diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmaññanā mānamaññanā ca veditabbā.

Furthermore, one who holds the view “this entire world is made of persons” (purisamayo) conceives from every aspect of the person — from the person as the constituent of all — his own origination or emanation, and thus conceives all with conceiving born of views. And in that very object, which is conceived with conceiving born of views, for one who generates affection and conceit, conceiving born of craving and conceiving born of conceit are to be understood.

Hơn nữa, một người có tà kiến “tất cả thế gian này là do người tạo ra”, khi tưởng tri sự xuất hiện hoặc sự phát sinh của tự ngã từ tất cả những gì được gọi là người, thì tưởng tri tất cả bằng tưởng tri tà kiến; nhưng trong chính đối tượng được tưởng tri bằng tưởng tri tà kiến đó, khi phát sinh sự yêu thích và kiêu mạn, thì cần hiểu là tưởng tri tham ái và tưởng tri kiêu mạn.

Taṃyeva pana sabbaṃ mayhaṃ attā kattā sāmīti vā maññanto ‘‘sabbaṃ me’’ti maññati, tathāyaṃ diṭṭhitaṇhābhinandanāhi abhinandanto sabbaṃ abhinandatīti evampettha maññanānaṃ pavatti veditabbā.

And that very all, if he conceives it as “my self is the doer, the master,” then he conceives “all is mine.” Similarly, by delighting in it with the delight of views and craving, he delights in all. In this way, the occurrence of conceivings here is to be understood.

Khi tưởng tri rằng tất cả điều đó là tự ngã của ta, là người tạo tác, là chủ nhân, thì tưởng tri “tất cả là của ta”; và như vậy, khi hoan hỷ với tà kiến và tham ái, thì hoan hỷ tất cả; như vậy, cần hiểu sự phát sinh của các tưởng tri ở đây.

277

Tanti sakkāyaṃ.

That refers to sakkāya.

Taṃ là hữu thân.

Ukkaṃsagatasukhasahitañhi khandhapañcakaṃ diṭṭhadhammanibbānavādī nibbānanti maññati, taṃ panatthato sakkāyoyevāti.

For the five aggregates accompanied by supreme happiness are conceived as Nibbāna by those who hold the view of Nibbāna in this very life (diṭṭhadhammanibbāna-vādī), but in reality, that is only sakkāya.

Vì người chủ trương Niết Bàn hiện tại (diṭṭhadhammanibbānavādī) tưởng tri năm uẩn kèm theo hạnh phúc tột cùng là Niết Bàn, nhưng điều đó về bản chất chỉ là hữu thân.

Ekadhāti pañcavidhampi nibbānabhāvena ekajjhaṃ katvā vuttaṃ.

In one way means that the five kinds are spoken of as unified into the state of Nibbāna.

Ekadhā là đã nói gộp năm loại thành một trạng thái Niết Bàn.

Yatoti yasmā.

Since means because.

Yato là vì.

Pañcahi kāmaguṇehīti manāpiyarūpādīhi pañcahi kāmakoṭṭhāsehi, bandhanehi vā.

With the five strands of sensual pleasure means with the five pleasing components of sensual pleasure, such as pleasing forms, etc., or with ties.

Pañcahi kāmaguṇehīti (bằng năm dục lạc) là bằng năm phần dục lạc như sắc khả ái, v.v., hoặc bằng các trói buộc.

Samappito suṭṭhu appito allīno hutvā ṭhito.

Immersed means firmly attached, adhering, and established.

Samappito là đã được gắn chặt, đã được dính liền và an trú vững chắc.

Samaṅgibhūtoti samannāgato.

Endowed means possessed of.

Samaṅgibhūto là được đầy đủ.

Paricāretīti tesu kāmaguṇesu kāmakoṭṭhāsesu yathāsukhaṃ indriyāni cāreti sañcāreti ito cito ca upaneti.

He indulges means he directs, moves, and applies his faculties from here and there at will in those sensual pleasures, the components of sensual pleasure.

Paricāretī là điều khiển các căn một cách tự do trong các dục lạc, các phần dục lạc đó, di chuyển từ đây đến đó, đưa đến.

Atha vā laḷati ramati kīḷati.

Alternatively, he plays, delights, and amuses himself.

Hoặc là vui đùa, hưởng thụ, giải trí.

Ettha dvidhā kāmaguṇā mānusakā ceva dibbā ca.

Here, there are two kinds of sensual pleasures: human and divine.

Ở đây, dục lạc có hai loại: của loài người và của chư thiên.

Mānusakā ca mandhātukāmaguṇasadisā, dibbā paranimmitavasavattidevarājassa kāmaguṇasadisā.

Human ones are like the sensual pleasures of Mandhātā, and divine ones are like the sensual pleasures of the chief deva in the world of devas who create for others (Paranimmitavasavatti).

Dục lạc của loài người giống như dục lạc của vua Mandhātu; dục lạc của chư thiên giống như dục lạc của chư thiên vương Paranimmitavasavattī.

Evarūpe kāme upagatānañhi te diṭṭhadhammanibbānasampattiṃ paññapenti.

For those who have attained such sensual pleasures, these are designated as the attainment of Nibbāna in this very life.

Đối với những người đã đạt đến các dục lạc như vậy, họ tuyên bố đó là sự thành tựu Niết Bàn hiện tại.

Tenāha ‘‘ettāvatā kho…pe… hotī’’ti.

Therefore, he said: “to that extent…he becomes…”

Vì vậy, nói “ettāvatā kho…pe… hotī” (chừng đó…pe… là).

Diṭṭhadhammoti paccakkhadhammo vuccati, tattha tattha paṭiladdhattabhāvassetaṃ adhivacanaṃ, diṭṭhadhamme nibbānaṃ imasmiṃyeva attabhāve dukkhavūpasamanaṃ diṭṭhadhammanibbānaṃ.

Diṭṭhadhamma means directly experienced phenomenon; it is a designation for the state of having attained it in various places. Nibbāna in this very life (diṭṭhadhammanibbāna) is the cessation of suffering in this very existence.

Diṭṭhadhammo được gọi là pháp hiện tại, đó là tên gọi của trạng thái đã đạt được ở nơi đó; Niết Bàn trong pháp hiện tại, sự chấm dứt khổ đau trong chính đời sống này, là Niết Bàn hiện tại.

Paramaṃ uttamaṃ diṭṭhadhammanibbānanti paramadiṭṭhadhammanibbānaṃ, taṃ patto hotīti attho.

The supreme, excellent Nibbāna in this very life is supreme diṭṭhadhammanibbāna; the meaning is that he has attained it.

Niết Bàn hiện tại tối thượng, cao tột là paramadiṭṭhadhammanibbānaṃ, có nghĩa là đã đạt được điều đó.

Pañcadhā āgatanti yathāvuttakāmaguṇasukhassa ceva catubbidharūpāvacarajjhānasukhassa ca vasena pāḷiyaṃ pañcappakārena āgataṃ.

Occurring in five ways means occurring in the Pāḷi text in five manners, based on the aforementioned happiness of sensual pleasures and the happiness of the four kinds of rūpāvacara jhānas.

Pañcadhā āgataṃ là được đề cập trong kinh điển theo năm loại, tùy theo hạnh phúc của dục lạc đã nói ở trên và hạnh phúc của bốn loại thiền sắc giới.

Nibbānaṃ assādentoti paramaṃ sukhaṃ nissaraṇanti maññanāya assādento.

Delighting in Nibbāna means delighting in it with the notion that it is supreme happiness, liberation.

Nibbānaṃ assādento là nếm trải Niết Bàn với tưởng tri rằng đó là hạnh phúc tối thượng, là sự giải thoát.

278

‘‘Imasmiṃ nibbāne patte na jāyati, na jīrati, na mīyatī’’ti evampi nibbānasmiṃ maññati.

He conceives in Nibbāna also in this way: “Having attained this Nibbāna, one is not born, does not age, does not die.”

“Khi đạt được Niết Bàn này, không sinh, không già, không chết” – như vậy, tưởng tri vào Niết Bàn.

‘‘Ito paraṃ paramassāsabhūtaṃ natthī’’ti gaṇhanto nibbānato maññati.

He conceives from Nibbāna by holding: “Beyond this, there is no greater solace.”

Khi chấp nhận “không có gì an ủi hơn điều này”, thì tưởng tri từ Niết Bàn.

Tayidaṃ nibbānaṃ mayā adhigataṃ, tasmā ‘‘nibbānaṃ me’’ti maññati.

This Nibbāna has been attained by me, therefore he conceives “Nibbāna is mine.”

Niết Bàn này do ta chứng đắc, do đó tưởng tri “Niết Bàn là của ta”.

Tatoyeva taṃ nibbānaṃ diṭṭhābhinandanāya abhinandati.

From that very Nibbāna, he delights in it with the delight of views.

Chính từ đó, hoan hỷ Niết Bàn đó bằng sự hoan hỷ tà kiến.

Ayaṃ tāvettha diṭṭhimaññanā.

This, for now, is the false conception of views.

Đây trước hết là sự tưởng tri theo tà kiến.

Tasmiṃyeva pana diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi niddhāretabbā.

However, generating craving and conceit in that very object conceived by the false conception of views, the false conception of craving and conceit should also be understood.

Tuy nhiên, chính trong đối tượng được tưởng tri bởi sự tưởng tri theo tà kiến mà phát sinh sự quyến luyến và kiêu mạn, thì sự tưởng tri theo ái và mạn cũng cần phải được xác định.

279

Yādisoti yathārūpo, yehi jegucchādisabhāvehi passitabboti attho.

What kind means of what form, by what loathsome and other characteristics it should be seen, this is the meaning.

Yādiso có nghĩa là “có hình tướng như thế nào”, nghĩa là “cần phải thấy với các đặc tính đáng ghê tởm, v.v.”.

Esāti ayaṃ.

This means this.

Esā có nghĩa là “đây”.

Tenassa attano suṇantānañca paccakkhasiddhatamāha.

By this, he states its direct perceptibility for oneself and for those listening.

Do đó, Ngài nói rằng điều đó là hiển nhiên đối với chính Ngài và những người đang lắng nghe.

Asubhādisabhāvena saha vijjamānānaṃ rūpādidhammānaṃ kāyo samūhoti sakkāyo, upādānakkhandhā.

The aggregate of form and other phenomena existing with characteristics such as impurity is the existent body (sakkāya), the aggregates of clinging.

Thân thể là một tập hợp các pháp sắc, v.v., tồn tại cùng với các đặc tính bất tịnh, v.v., nên được gọi là sakkāya (thân kiến), tức là các uẩn chấp thủ.

Tathāti tassa bhāvabhūtena paṭikūlatādippakārena.

Likewise means in that manner of being, in the way of being repulsive and so on.

Tathā có nghĩa là “theo cách như vậy”, tức là theo cách đáng ghê tởm, v.v., vốn là bản chất của nó.

Sabbamaññanāti pathavīādike sarūpāvadhāraṇādivibhāgabhinne visaye pavattiyā anekavihitā sabbā taṇhāmaññanā.

All false conceptions means all manifold false conceptions of craving, occurring with respect to objects divided by distinctions such as the ascertainment of the true nature of earth and so on.

Sabbamaññanā có nghĩa là “tất cả mọi tưởng tri theo ái”, là tất cả các loại tưởng tri theo ái khác nhau, phát sinh trong các đối tượng như đất, v.v., được phân chia theo sự xác định bản chất, v.v.

280

Jegucchoti jigucchanīyo.

Loathsome means detestable.

Jeguccho có nghĩa là “đáng ghê tởm”.

Tenassa asubhājaññaduggandhapaṭikūlabhāvaṃ dasseti.

By this, he shows its nature as impure, disagreeable, foul-smelling, and repulsive.

Do đó, Ngài chỉ ra rằng nó có bản chất bất tịnh, dơ bẩn, hôi hám và đáng ghê tởm.

Siduroti khaṇe khaṇe bhijjanasabhāvo.

Perishable means having the nature of breaking up at every moment.

Siduro có nghĩa là “có bản chất tan rã từng khoảnh khắc”.

Tenassa aniccaaddhuvakhayavayapabhaṅgurasabhāvaṃ dasseti.

By this, he shows its nature as impermanent, unenduring, subject to decay, dissolution, and breaking up.

Do đó, Ngài chỉ ra rằng nó có bản chất vô thường, không bền vững, hoại diệt, suy tàn và tan rã.

Ayanti sakkāyo.

This means the existent body.

Ayaṃ có nghĩa là “thân thể này”.

Dukkhoti na sukho.

Suffering means not pleasant.

Dukkho có nghĩa là “không phải là lạc”, tức là “khổ”.

Tenassa kicchakasirābādhadukkhavuttitaṃ dasseti.

By this, he shows its characteristic of being troublesome, wearisome, afflicted, and productive of suffering.

Do đó, Ngài chỉ ra rằng nó có bản chất là khổ, khó khăn, bệnh tật và đau đớn.

Apariṇāyakoti pariṇāyakarahito.

Without a leader means devoid of a leader.

Apariṇāyako có nghĩa là “không có người dẫn dắt”.

Tenassa attasuññaasāravuttitaṃ dasseti.

By this, he shows its characteristic of being empty of self and without essence.

Do đó, Ngài chỉ ra rằng nó có bản chất trống rỗng, vô ngã và không có cốt lõi.

Tanti sakkāyaṃ.

That means the existent body.

Taṃ có nghĩa là “thân thể đó”.

Paccanīkatoti sabhāvapaṭipakkhato, subhaniccasukhaattāditoti attho.

As an adversary means as opposite to its true nature, that is, as beautiful, permanent, pleasant, and self.

Paccanīkato có nghĩa là “từ bản chất đối nghịch”, tức là “từ bản chất đẹp đẽ, thường hằng, an lạc, tự ngã, v.v.”.

Gaṇhanti gaṇhanto, tattha subhādigāhavasena abhinivisantoti attho.

Grasps means grasping, that is, becoming attached there by perceiving it as beautiful and so on.

Gaṇhaṃ có nghĩa là “nắm giữ”, tức là “bám víu vào đó với sự nắm giữ cái đẹp đẽ, v.v.”.

281

Idāni tissopi maññanā upamāhi vibhāvetuṃ ‘‘subhato’’tiādi vuttaṃ.

Now, to illustrate all three false conceptions with similes, the phrase "as beautiful" and so on was stated.

Bây giờ, để giải thích cả ba loại tưởng tri theo ví dụ, Ngài đã nói ‘‘subhato’’ (là đẹp đẽ), v.v.

Tattha yathā mahāpariḷāhe vipulānatthāvahe ca aggimhi salabhassa patanaṃ subhasukhasaññāya, evaṃ tādise sakkāye salabhassa taṇhāmaññanāti imamatthaṃ dasseti ‘‘subhato…pe… taṇhāya maññanā’’ti iminā.

There, just as a moth falls into a fire, which causes great burning and much harm, with the perception of beauty and pleasure, so too with the existent body of that nature, the false conception of craving of the moth; this meaning is shown by "as beautiful…pe… the false conception of craving".

Ở đây, giống như việc con thiêu thân lao vào lửa, vốn mang lại tai họa lớn trong cơn nóng bức dữ dội, với sự tưởng tri là đẹp đẽ và an lạc, thì cũng vậy, sự tưởng tri theo ái của con thiêu thân trong thân thể đó. Điều này được chỉ ra bởi câu ‘‘subhato…pe… taṇhāya maññanā’’ (tưởng tri theo ái là đẹp đẽ, v.v.).

282

Gūthādī kīṭako gūtharāsiṃ laddhā asampannepi tasmiṃ sampannākāraṃ pavattayamāno attānaṃ ukkaṃseti, evamanekādīnave ekantabhedini sakkāye niccasaññaṃ upaṭṭhapetvā sampattimadena tattha bālo mānaṃ jappetīti imamatthamāha ‘‘niccasaññaṃ…pe… mānena maññanā’’ti.

Just as a worm in excrement and so on, having found a heap of excrement, exalts itself by creating an image of perfection in it even though it is imperfect, so too, an ignorant person, having established the perception of permanence in the existent body which has many drawbacks and is entirely subject to dissolution, fosters conceit there through the intoxication of success; this meaning is stated by "the perception of permanence…pe… the false conception of conceit".

Giống như một con côn trùng trong phân, v.v., khi tìm thấy một đống phân, nó tự cao tự đại, hành động như thể nó đã đạt được thành tựu mặc dù không có gì, thì cũng vậy, một kẻ ngu si, sau khi thiết lập tưởng tri về sự thường hằng trong thân thể đầy khuyết điểm và hoàn toàn tan rã, lại tạo ra sự kiêu mạn ở đó với sự say mê thành tựu. Điều này được chỉ ra bởi câu ‘‘niccasaññaṃ…pe… mānena maññanā’’ (tưởng tri theo mạn là thường hằng, v.v.).

283

Yathā bālo muddhadhātuko sammūḷho koci ādāse attano paṭibimbaṃ disvā ‘‘ayaṃ maññe ādāsasāmiko, yadi ahamimaṃ gahetvā tiṭṭheyyaṃ, anatthampi me kareyyā’’ti chaḍḍetvā palāyanto tattha avijjamānameva kiñci vijjamānaṃ katvā gaṇhi, tathūpamo ayaṃ bālo sakkāye attattaniyagāhaṃ gaṇhantoti imamatthaṃ dīpeti ‘‘attā…pe… diṭṭhiyā hoti maññanā’’ti iminā.

Just as an ignorant, dull-witted, deluded person, seeing his own reflection in a mirror, thinks "this must be the owner of the mirror, if I were to take this and stand here, it might do me harm," and then runs away, thereby taking something non-existent there to be existent; similarly, this ignorant person grasps at self and what belongs to self in the existent body; this meaning is illuminated by "self…pe… the false conception is by view".

Giống như một kẻ ngu si, tâm trí mê muội, thấy hình ảnh của mình trong gương và nghĩ: “Có lẽ đây là chủ nhân của chiếc gương, nếu ta nắm giữ nó, nó có thể gây hại cho ta”, rồi vứt bỏ và chạy trốn, coi một cái gì đó không tồn tại ở đó là tồn tại; cũng vậy, kẻ ngu si này nắm giữ sự chấp thủ về tự ngã và cái thuộc về tự ngã trong thân thể. Điều này được chỉ ra bởi câu ‘‘attā…pe… diṭṭhiyā hoti maññanā’’ (tưởng tri theo tà kiến là tự ngã, v.v.).

284

Sukhumaṃ mārabandhanaṃ vepacittibandhanatopi sukhumatarattā.

The subtle bond of Māra is subtler than the bond of Vepacitti.

Sukhumaṃ mārabandhanaṃ (sự trói buộc vi tế của Ma-la) là vì nó vi tế hơn cả sự trói buộc của Vepacitti.

Tenāha bhagavā ‘‘aho sukhumataraṃ kho, bhikkhave, mārabandhana’’nti.

Therefore, the Blessed One said, "Oh, monks, how much subtler is the bond of Māra!"

Do đó, Đức Thế Tôn đã nói: “Này các tỳ-kheo, sự trói buộc của Ma-la thật là vi tế hơn biết bao!”.

285

Bahunti ativiya, anekakkhattuṃ vā.

Much means excessively, or many times.

Bahuṃ có nghĩa là “rất nhiều”, hoặc “nhiều lần”.

Vipphandamānopi sakkāyaṃ nātivattati saṃsāraṃ nātivattanato.

Even though he struggles much, he does not transcend the existent body because he does not transcend saṃsāra.

Vipphandamānopi sakkāyaṃ nātivattati (dù vùng vẫy cũng không vượt khỏi thân kiến) là vì không vượt khỏi luân hồi.

Yathāha ‘‘ye te, bhikkhave, samaṇā sato sattassa ucchedaṃ vināsaṃ vibhavaṃ paññapenti, te, sakkāyaṃyeva anuparidhāvanti seyyathāpi sā gaddulabandhano’’tiādi.

As it is said, "Those ascetics and brahmins, monks, who proclaim the cutting off, destruction, and annihilation of an existing being, they merely revolve around the existent body, just like that dog tied to a leash," and so on.

Như đã nói: “Này các tỳ-kheo, những sa-môn nào tuyên bố sự đoạn diệt, hủy hoại, tiêu vong của hữu tình đang tồn tại, thì họ chỉ loanh quanh trong thân kiến, giống như con chó bị buộc dây”.

Yathā hi sattasupi ucchedavikappesu saṃsāranāyikānaṃ taṇhādiṭṭhīnaṃ pahānaṃ sambhavati, evaṃ sassatavikappesupīti kathañci pana diṭṭhigatikassa bhavavippamokkho.

Just as the abandonment of craving and views, which lead to saṃsāra, is possible in the seven views of annihilation, so too is it possible in the eternalist views; how then can one who adheres to a view be freed from existence?

Vì sự đoạn trừ ái và kiến, vốn là nguyên nhân của luân hồi, có thể xảy ra trong cả bảy loại đoạn kiến, thì cũng vậy, trong các loại thường kiến. Vậy thì làm sao một người theo tà kiến có thể giải thoát khỏi hữu?

Tena vuttaṃ ‘‘sakkāyaṃ nātivattatī’’ti.

Therefore it is said, "does not transcend the existent body."

Do đó đã nói: “không vượt khỏi thân kiến”.

286

Sasoti so eso puthujjano.

That person means that ordinary person.

Saso có nghĩa là “người phàm phu đó”.

Niccanti sabbakālaṃ.

Always means all the time.

Niccaṃ có nghĩa là “mọi lúc”.

287

Tanti tasmā sakkāyamalīnassa jātiyādīnamanativattanato.

Therefore means because one who is defiled by the existent body does not transcend birth and so on.

Taṃ có nghĩa là “do đó”, vì người không thanh tịnh trong thân kiến không vượt khỏi sinh, v.v.

Asātatoti dukkhato.

As unpleasant means as suffering.

Asātato có nghĩa là “từ khổ”.

288

Passaṃ evamimanti asubhāniccadukkhānattasabhāvaṃ taṃ sakkāyaṃ vuttappakārena yathābhūtavipassanāpaññāsahitāya maggapaññāya passanto.

Seeing it thus means seeing that existent body, which has the nature of impurity, impermanence, suffering, and non-self, in the manner described, with the insight wisdom accompanied by true vipassanā (special insight) and path wisdom.

Passaṃ evaṃ imaṃ có nghĩa là “thấy thân thể đó với các đặc tính bất tịnh, vô thường, khổ và vô ngã, với tuệ quán như thật và tuệ đạo như đã nói”.

Pahāyāti samucchedavasena sabbā maññanāyo pajahitvā.

Having abandoned means having utterly abandoned all false conceptions by way of extirpation.

Pahāya có nghĩa là “đoạn trừ tất cả các tưởng tri theo cách đoạn diệt tận gốc”.

Sabbadukkhā pamuccatīti sakalasmāpi vaṭṭadukkhato pamuccatīti.

Is liberated from all suffering means is liberated from all suffering of the cycle of existence.

Sabbadukkhā pamuccati có nghĩa là “giải thoát khỏi tất cả khổ luân hồi”.

289

Ekattavārādivaṇṇanā niṭṭhitā.

The commentary on the section 'Ekattavāra' is finished.

Chú giải về Ekattavāra, v.v., đã hoàn tất.

290

Paṭhamanayavaṇṇanā niṭṭhitā.

The commentary on the First Exposition is finished.

Chú giải về Paṭhamanaya đã hoàn tất.

291

Sekkhavāradutiyanayavaṇṇanā

Commentary on the Second Exposition of the Learner's Section

Chú giải về Sekkhavāra, phương pháp thứ hai

292

7. Adhippetassa atthassa aniyametvā vacanaṃ uddeso, niyametvā vacanaṃ niddesoti āha ‘‘yoti uddesavacanaṃ, soti niddesavacana’’nti.

Speaking of a meaning without specifying it is uddesa (general statement); speaking of it by specifying it is niddesa (specific statement), as it is said, "'yo' is a general statement, 'so' is a specific statement".

7. Việc nói lên ý nghĩa được đề cập mà không xác định là uddesa (tóm tắt), việc nói lên ý nghĩa được xác định là niddesa (giải thích). Do đó, Ngài nói: ‘‘yoti uddesavacanaṃ, soti niddesavacana’’ (chữ “yo” là lời tóm tắt, chữ “so” là lời giải thích).

Sampiṇḍanatthoti samuccayattho.

Meaning of compilation means the meaning of aggregation.

Sampiṇḍanattho có nghĩa là “ý nghĩa tổng hợp”.

Sampiṇḍanañca sabhāgatāvasena hotīti āha – ‘‘ārammaṇasabhāgenā’’ti, ārammaṇassa sabhāgatāya sadisatāyāti attho.

And compilation occurs by way of similarity of object, thus it is said – "by similarity of object," meaning by the sameness or similarity of the object.

Và sự tổng hợp xảy ra theo nghĩa tương đồng, do đó Ngài nói: ‘‘ārammaṇasabhāgenā’’ (bằng sự tương đồng của đối tượng), nghĩa là “bằng sự tương đồng của đối tượng”.

Sekkhaṃ dasseti sāmaññajotanāya visese avaṭṭhānato, sekkhavisayattā ca tassa vacanassa.

Shows the learner because of its stability in a particular (special) sense through its general illumination, and because that statement pertains to the learner's domain.

Sekkhaṃ dasseti (chỉ ra bậc Hữu học) là vì sự tồn tại trong sự đặc biệt của nó thông qua sự hiển bày chung, và vì lời nói đó thuộc về đối tượng của bậc Hữu học.

293

Kenaṭṭhenāti yasmā ñāṇena araṇīyato attho sabhāvo, tasmā kenaṭṭhena kena sabhāvena kena lakkhaṇena sekkho nāma hotīti attho.

In what sense means that since the meaning or nature is to be known by knowledge, therefore in what sense, in what nature, in what characteristic is one called a learner?

Kenaṭṭhenā có nghĩa là “bằng ý nghĩa nào”, tức là “bằng bản chất nào, bằng đặc tính nào thì gọi là Hữu học”, vì ý nghĩa (artha) là bản chất (sabhāva) cần được hiểu bằng trí tuệ (ñāṇa).

Yasmā pana sekkhadhammādhigamena puggale sekkhavohārappavatti, tasmā ‘‘sekkhadhammapaṭilābhato sekkho’’ti vuttaṃ.

However, since the designation of 'learner' to an individual comes about through the attainment of learner's qualities, it is said, "a learner by the attainment of learner's qualities."

Vì danh xưng Hữu học (sekkhavohāra) được áp dụng cho người do sự thành tựu các pháp Hữu học (sekkhadhamma), do đó đã nói ‘‘sekkhadhammapaṭilābhato sekkho’’ (Hữu học do thành tựu các pháp Hữu học).

Sekkhadhammā nāma catūsu maggesu, heṭṭhimesu ca tīsu phalesu sammādiṭṭhiādayo.

Learner's qualities are Right View and so on, in the four paths and the three lower fruits.

Các sekkhadhammā (pháp Hữu học) là chánh kiến, v.v., trong bốn đạo và ba quả thấp hơn.

Tenāha ‘‘sekkhāya sammādiṭṭhiyā…pe… ettāvatā kho bhikkhu sekkho hotī’’ti.

Therefore, it is said, "By the learner's Right View…pe… to this extent, monks, a bhikkhu is a learner."

Do đó, Ngài nói: ‘‘sekkhāya sammādiṭṭhiyā…pe… ettāvatā kho bhikkhu sekkho hotī’’ (bằng chánh kiến của bậc Hữu học…pe… chừng đó, này các tỳ-kheo, một tỳ-kheo là bậc Hữu học).

Evaṃ abhidhammapariyāyena sekkhalakkhaṇaṃ dassetvā idāni suttantikapariyāyenapi taṃ dassetuṃ ‘‘apicā’’tiādi vuttaṃ.

Having thus shown the characteristic of a learner according to the Abhidhamma method, now to show it also according to the Suttanta method, the phrase "furthermore" and so on was stated.

Sau khi chỉ ra đặc tính của bậc Hữu học theo phương pháp Abhidhamma, bây giờ để chỉ ra điều đó theo phương pháp Suttanta, Ngài đã nói ‘‘apicā’’ (hơn nữa), v.v.

Tattha sikkhatīti iminā sikkhāttayasamaṅgī apariniṭṭhitasikkho sekkhoti dasseti.

There, by "he trains," it is shown that a learner is one who is endowed with the three trainings, one whose training is not yet completed.

Ở đây, với chữ sikkhatī (đang học), Ngài chỉ ra rằng một người Hữu học là người đầy đủ ba học pháp và chưa hoàn thành việc học.

Tenāha ‘‘sikkhatī’’tiādi.

Therefore, it is said, "he trains" and so on.

Do đó, Ngài nói ‘‘sikkhatī’’ (đang học), v.v.

Sikkhāhi niccasamāyogadīpanatthañcettha ‘‘sikkhati sikkhatī’’ti āmeḍitavacanaṃ.

And here, the repeated phrase "sikkhati sikkhati" is for the purpose of indicating constant engagement with the trainings.

Và ở đây, từ lặp lại “sikkhati sikkhati” (đang học, đang học) là để chỉ ra sự liên tục không ngừng với các học pháp.

Atha vā sikkhanaṃ sikkhā, sā etassa sīlanti sekkho.

Or, the act of training is sikkhā (training), and one for whom this (training) is his habit is a sekkhā (learner).

Hoặc, sự học là sikkhā, người có điều đó là giới hạnh thì là sekkho (Hữu học).

So hi apariyositasikkhattā tadadhimuttattā ca ekantena sikkhanasīlo, na asekkho viya pariniṭṭhitasikkho tattha paṭippassaddhussukko, nāpi vissaṭṭhasikkho pacurajano viya tattha anadhimutto.

For he is absolutely prone to training due to his uncompleted training and his devotion to it, unlike an Arahant (asekkha) who has completed his training and is fully at ease in it, nor like the general populace whose training is abandoned and who are not devoted to it.

Vì chưa hoàn thành việc học và có khuynh hướng hướng đến điều đó, người ấy hoàn toàn có giới hạnh học, không giống như bậc Vô học đã hoàn thành việc học và không còn nhiệt tâm với điều đó, cũng không giống như người phàm phu đã từ bỏ việc học và không có khuynh hướng hướng đến điều đó.

Atha vā ariyāya jātiyā tīsu sikkhāsu jāto, tattha vā bhavoti sekkho.

Or, one born into the noble lineage, in the three trainings, or whose existence is therein, is a learner.

Hoặc, người sinh ra trong ba học pháp của bậc Thánh, hoặc người tồn tại trong đó thì là sekkho (Hữu học).

Atha vā ikkhati etāyāti ikkhā, maggaphalasammādiṭṭhi.

Or, that by which one sees is ikkhā, which is the Right View of the path and fruit.

Hoặc, ikkhā là cái mà người ta nhìn thấy bằng nó, tức là chánh kiến của đạo và quả.

Saha ikkhāyāti sekkho.

One who possesses ikkhā is a learner.

Cùng với ikkhā thì là sekkho (Hữu học).

294

Anulomapaṭipadāya paripūrakārīti yā sā sīlādikā vipassanantā dukkhanirodhagāminiyā lokuttarāya paṭipadāya anulomanato anulomapaṭipadā, tassā sampādanena paripūrakārīti.

One who perfectly fulfills the progressive practice means one who perfectly fulfills that practice which is called the progressive practice because it is in harmony with the transcendent practice leading to the cessation of suffering, beginning with morality and ending with insight.

Anulomapaṭipadāya paripūrakārī có nghĩa là “người hoàn thành con đường thuận ứng”, tức là con đường từ giới, v.v., đến tuệ quán, là con đường thuận ứng với con đường siêu thế dẫn đến sự diệt khổ, bằng cách hoàn thành con đường đó.

Idāni taṃ paṭipadaṃ puggalādhiṭṭhānena dassetuṃ ‘‘sīlasampanno’’tiādi vuttaṃ.

Now, to show that practice with reference to an individual, the phrase "endowed with morality" and so on was stated.

Bây giờ, để chỉ ra con đường đó dựa trên cá nhân, Ngài đã nói ‘‘sīlasampanno’’ (đầy đủ giới hạnh), v.v.

Tattha sīlasampannoti pātimokkhasaṃvarasīlena samannāgato, paripuṇṇapātimokkhasīlo vā.

There, endowed with morality means endowed with the morality of restraint by the Pātimokkha, or one who has fully accomplished the Pātimokkha morality.

Ở đây, sīlasampanno có nghĩa là “người đầy đủ giới luật phòng hộ theo Pātimokkha”, hoặc “người có giới Pātimokkha hoàn hảo”.

Pātimokkhasīlañhi idha ‘‘sīla’’nti adhippetaṃ padhānabhāvato.

For the Pātimokkha morality is intended here as "morality" due to its preeminence.

Vì giới Pātimokkha được đề cập ở đây là “giới” theo nghĩa chính yếu.

Rūpādiārammaṇesu abhijjhādīnaṃ pavattinivāraṇasaṅkhātena manacchaṭṭhānaṃ indriyānaṃ pidhānena indriyesu guttadvāro.

guarded in the sense faculties by closing the doors of the six sense faculties (the mind being the sixth), which means preventing the arising of covetousness and the like in regard to sense objects such as forms.

Bằng cách đóng kín các căn (indriya) – tức sáu căn bao gồm ý căn – ngăn chặn sự phát sinh của tham ái (abhijjhā) và các phiền não khác đối với các đối tượng như sắc (rūpa) v.v., nên được gọi là người giữ gìn các căn (indriyesu guttadvāro).

Pariyesanādivasena bhojane pamāṇajānanena bhojane mattaññū.

moderate in eating by knowing the proper measure in food regarding its acquisition and so on.

Bằng cách biết lượng vừa phải trong việc thọ dụng thức ăn (bhojana) qua sự tìm cầu (pariyesanā) v.v., nên được gọi là người biết đủ trong ăn uống (bhojane mattaññū).

Vigatathinamiddho hutvā rattindivaṃ kammaṭṭhānamanasikāre yuttatāya jāgariyānuyogamanuyutto.

devoted to wakefulness by being free from sloth and torpor and being engaged in applying the mind to the meditation object day and night.

Bằng cách không có hôn trầm, thụy miên (thina-middha) và chuyên cần chú tâm vào đề mục thiền (kammaṭṭhāna) suốt ngày đêm, nên được gọi là người chuyên cần thực hành sự tỉnh thức (jāgariyānuyogamanuyutto).

Kathaṃ pana jāgariyānuyogo hotīti taṃ dassetuṃ ‘‘pubbarattā…pe… viharatī’’ti vuttaṃ.

To show how one is devoted to wakefulness, it is said: “in the first watch of the night…pe… he dwells.”

Để chỉ rõ sự chuyên cần thực hành sự tỉnh thức là như thế nào, đã nói: ‘‘vào canh đầu…v.v… an trú’’.

Yathāha ‘‘kathañca pubbarattāpararattaṃ jāgariyānuyogamanuyutto hoti?

As it is said: “And how is one devoted to wakefulness during the first and last watches of the night?

Như đã nói: ‘‘Và này các Tỳ-khưu, thế nào là vị ấy chuyên cần thực hành sự tỉnh thức vào canh đầu và canh cuối?

Idha bhikkhu divasaṃ caṅkamena nisajjāya āvaraṇīyehi cittaṃ parisodheti, rattiyā paṭhamaṃ yāmaṃ caṅkamena…pe… sodheti, evaṃ kho bhikkhu pubbarattāpararattaṃ jāgariyānuyogamanuyutto hotī’’ti (vibha. 519).

Here, a bhikkhu purifies his mind of obstructive states by walking and sitting during the day; during the first watch of the night, by walking…pe… he purifies. In this way, a bhikkhu is devoted to wakefulness during the first and last watches of the night.”

Ở đây, Tỳ-khưu vào ban ngày, bằng cách đi kinh hành và ngồi, thanh lọc tâm khỏi các triền cái; vào canh đầu của đêm, bằng cách đi kinh hành…v.v… thanh lọc tâm. Này các Tỳ-khưu, như vậy vị ấy chuyên cần thực hành sự tỉnh thức vào canh đầu và canh cuối’’ (Vibh. 519).

Imasmiṃ panattheti ‘‘maññati, na maññatī’’ti ca vattabbabhāvasaṅkhāte atthe.

In this sense, it is the sense in which it should be said “he perceives, he does not perceive.”

Trong ý nghĩa này là trong ý nghĩa được gọi là không thể nói ‘‘cho là, không cho là’’.

No puthujjano adhippeto ‘‘appattamānaso, anuttaraṃ yogakkhemaṃ patthayamāno’’ti ca vuttattā.

The ordinary person is not intended because it is said: “one whose mind is not yet attained, longing for the unsurpassed security from bondage.”

Không phải là phàm phu được đề cập vì đã nói ‘‘người chưa đạt được tâm, người khao khát sự an ổn tối thượng (anuttaraṃ yogakkhemaṃ)’’.

295

Sampayuttattā manasi bhavoti rāgo mānaso, mano eva mānasanti katvā cittaṃ mānasaṃ, anavasesato mānaṃ sīyati samucchindatīti aggamaggo mānasaṃ, tannibbattattā pana arahattassa mānasatā daṭṭhabbā.

Since it is conjoined with it, greed is mental; by taking “mind itself is mental,” the mind is mental; the foremost path, the Arahat-path, entirely severs and uproots conceit, hence it is mental; and the state of Arahatship should be seen as mental because it is produced by it.

Vì tương ưng với tâm, nên tham ái (rāga) là tâm sở (mānasa). Tâm (mano) chính là tâm sở (mānasa) – khi cho rằng tâm là tâm sở. Con đường tối thượng (aggamagga) là mānasaṃ vì nó diệt trừ, đoạn tận ngã mạn (māna) một cách không còn sót lại; nhưng sự đạt được quả A-la-hán (arahatta) được xem là mānasa vì nó được sinh ra từ đó.

Janesutāti jane sakalasattaloke vissutā, patthaṭayasāti attho.

renowned among people means renowned throughout the entire world of beings, meaning widely spread in fame.

Janesutā có nghĩa là nổi tiếng (vissutā) trong chúng sinh, tức là tiếng tăm lan rộng.

296

Natthi ito uttaranti anuttaraṃ.

There is nothing higher than this, hence unsurpassed.

Không có gì cao hơn điều này, nên là vô thượng (anuttaraṃ).

Taṃ pana sabbaseṭṭhaṃ hontaṃ ekantato sadisarahitameva hoti, tasmā vuttaṃ ‘‘anuttaranti seṭṭhaṃ, asadisanti attho’’ti.

And being the most excellent of all, it is necessarily without equal. Therefore, it is said: “unsurpassed means excellent, without equal is the meaning.”

Điều đó, khi là tối thượng (sabbaseṭṭha), chắc chắn là không có gì tương tự. Do đó đã nói: ‘‘Vô thượng có nghĩa là tối thượng, không có gì tương tự’’.

Patthayamānassāti taṇhāyantassa.

Of one longing means of one craving.

Người khao khát (patthayamānassā) có nghĩa là người có tham ái (taṇhāyanassa).

Pajappitānīti mānajappanāni.

The thoughts are the conceited thoughts.

Những suy nghĩ (pajappitānī) có nghĩa là những suy nghĩ về ngã mạn (mānajappanāni).

Yasmiñhi vatthusmiṃ taṇhāyanā patthayamānamaññanā sambhavati, tasmiṃyeva ‘‘seyyohamasmī’’tiādīni pajappitāni sambhavantīti adhippāyo.

For the meaning is that in whatever object craving and longing perception may arise, in that same object such thoughts as “I am superior” and so on arise.

Ý nghĩa là: trong đối tượng nào mà sự khao khát (taṇhāyanā) và sự cho là khao khát (patthayamānamaññanā) có thể phát sinh, thì trong đối tượng đó cũng có thể phát sinh những suy nghĩ như ‘‘tôi hơn người’’ v.v.

Pavedhītanti parivāsitaṃ.

Shaken means completely pervaded.

Bị rung động (pavedhītaṃ) có nghĩa là bị làm cho dao động.

Pakappitesūti taṇhādiṭṭhikappehi parikappitesu ārammaṇesu.

Regarding what is conceptualized means regarding objects conceptualized by craving and wrong view.

Trong những đối tượng đã được định hình (pakappitesu) có nghĩa là trong những đối tượng đã được định hình bởi các khái niệm (kappehi) về tham ái (taṇhā) và tà kiến (diṭṭhi) v.v.

Sotanti kilesasotaṃ.

Stream refers to the stream of defilements.

Dòng chảy (sotaṃ) có nghĩa là dòng chảy phiền não (kilesasotaṃ).

Tasmiñhi chinne itarasotaṃ chinnamevāti.

For when that is cut, the other stream is also cut.

Vì khi dòng này bị cắt đứt, dòng kia cũng bị cắt đứt.

Viddhastanti vināsitaṃ.

Destroyed means eliminated.

Bị hủy diệt (viddhastaṃ) có nghĩa là bị tiêu diệt.

Tañca kho lomahaṃsamattampi asesetvāti dassento āha ‘‘vinaḷīkata’’nti, vigatāvasesaṃ katanti attho.

And to show that not even a hair's breadth is left, it says: “made completely empty,” which means made without any remainder.

Và để chỉ rõ rằng không còn sót lại dù chỉ một chút lông tơ, đã nói ‘‘không còn dấu vết (vinaḷīkata)’’, có nghĩa là đã làm cho không còn sót lại.

Adhimuttiyā idhādhippetapatthanā pākaṭā hotīti ‘‘tanninno’’tiādi vuttaṃ, na pana kusalacchandassa adhimuttibhāvato.

That the longing intended here is by way of inclination is revealed by the words “inclined to that,” and not by the fact that wholesome desire is an inclination.

Sự khao khát được đề cập ở đây qua sự quyết tâm (adhimuttiyā) được làm cho rõ ràng, do đó đã nói ‘‘hướng về điều đó (tanninno)’’ v.v., chứ không phải do sự quyết tâm là một loại thiện dục (kusalacchanda).

Adhimuccantoti okappento.

Inclining means deciding.

Quyết tâm (adhimuccanto) có nghĩa là tin tưởng.

297

Sabbākāraviparītāyāti ‘‘subhaṃ sukhaṃ nicca’’ntiādīnaṃ sabbesaṃ attanā gahetabbākārānaṃ vasena tabbiparītatāya, anavasesato dhammasabhāvaviparītākāragāhiniyāti attho.

Completely contrary in all aspects means by way of all aspects to be grasped by oneself such as “beautiful, pleasant, permanent” being contrary to them; meaning it grasps aspects completely contrary to the nature of phenomena.

Hoàn toàn trái ngược (sabbākāraviparītāyā) có nghĩa là hoàn toàn trái ngược với tất cả các khía cạnh cần được nắm giữ như ‘‘thanh tịnh, an lạc, thường hằng’’ v.v., tức là nắm giữ các khía cạnh trái ngược với bản chất của các pháp một cách không còn sót lại.

Abhivisiṭṭhena ñāṇenāti asampajānanamicchājānanāni viya na dhammasabhāvaṃ appatvā nāpi atikkamitvā, atha kho avirajjhitvā dhammasabhāvassa abhimukhabhāvappattiyā abhivisiṭṭhena ñāṇena, ñātapariññādhiṭṭhānāya tīraṇapariññāya pahānapariññekadesena cāti attho.

By exceedingly special knowledge means not by reaching the nature of phenomena (as in not fully comprehending or wrongly comprehending), nor by transgressing it, but rather by knowledge that is exceedingly special by attaining the state of being directly facing the nature of phenomena, and by the decisive comprehension based on the comprehension of the known, and by a part of the comprehension of abandonment.

Bằng trí tuệ ưu việt (abhivisiṭṭhena ñāṇena) có nghĩa là không phải bằng cách không đạt được bản chất của các pháp hoặc vượt quá nó, như sự không hiểu biết (asampajānana) và sự hiểu biết sai lầm (micchājānana), mà là bằng trí tuệ ưu việt do đạt được sự đối diện với bản chất của các pháp mà không bị sai lệch, tức là bằng sự quán triệt (tīraṇapariññā) dựa trên sự hiểu biết (ñātapariññā) và một phần của sự đoạn trừ (pahānapariññā).

Tenāha ‘‘pathavīti…pe… vuttaṃ hotī’’ti.

Therefore it is said: “earth…pe… is said.”

Do đó đã nói: ‘‘đất là…v.v… đã được nói’’.

Pathavībhāvanti pathaviyaṃ abhiññeyyabhāvaṃ.

The nature of earth means the state of being comprehensible in earth.

Bản chất của đất (pathavībhāvaṃ) có nghĩa là bản chất cần được quán triệt (abhiññeyyabhāvaṃ) trong đất.

Lakkhaṇapathavī hi idhādhippetā, pariññeyyabhāvo panassā ‘‘aniccātipī’’tiādinā gahitoti.

For the characteristic earth is intended here, and its state of being comprehensible is grasped by “impermanent as well” and so on.

Ở đây, đất đặc trưng (lakkhaṇapathavī) được đề cập, và bản chất cần được quán triệt của nó đã được nắm giữ qua ‘‘vô thường (aniccātipī)’’ v.v.

Abhiññatvāti ñātatīraṇapahānapariññāhi heṭṭhimamaggañāṇehi ca abhijānitvā.

Having fully known means having fully known by the comprehension of knowing, deciding, and abandoning, and by the knowledge of the lower paths.

Sau khi quán triệt (abhiññatvā) có nghĩa là sau khi biết rõ bằng sự quán triệt (ñātatīraṇa), sự đoạn trừ (pahāna) và bằng các trí tuệ của các đạo thấp hơn.

Māmaññīti appahīnānaṃ maññanānaṃ vasena māti maññatīti mā, pahīnānaṃ pana vasena na maññatīti amaññī, mā ca so amaññī ca māmaññīti evamettha padavibhāgato attho veditabbo.

Should not conceive (māmaññī): “mā” means 'he conceives' by way of perceptions not yet abandoned; “amaññī” means 'he does not conceive' by way of perceptions that have been abandoned. The meaning here should be understood by dividing the words as “mā ca so amaññī ca” (may he not conceive, and he did not conceive) meaning māmaññī.

Māmaññī – bằng cách phân chia từ ngữ, ý nghĩa ở đây cần được hiểu là: ‘‘mā’’ có nghĩa là ‘‘cho là’’ (maññati) theo khía cạnh của những sự cho là chưa được đoạn trừ; còn ‘‘amaññī’’ có nghĩa là ‘‘không cho là’’ theo khía cạnh của những sự cho là đã được đoạn trừ. Và ‘‘mā’’ và ‘‘amaññī’’ là ‘‘māmaññī’’.

Tattha yena bhāgena amaññī, tena maññīti na vattabbo.

There, by the part by which he did not conceive, he should not be said to have conceived.

Ở đó, theo khía cạnh mà vị ấy ‘‘không cho là’’, thì không thể nói là ‘‘cho là’’.

Yena pana bhāgena maññī, tena amaññīti na vattabboti.

But by the part by which he conceived, he should not be said to have not conceived.

Còn theo khía cạnh mà vị ấy ‘‘cho là’’, thì không thể nói là ‘‘không cho là’’.

Evaṃ paṭikkhepappadhānaṃ atthaṃ dassetuṃ aṭṭhakathāyaṃ ‘‘maññī ca na maññī ca na vattabbo’’ti vuttaṃ.

Thus, to show the meaning that is predominantly a rejection, the commentary states: “neither should it be said ‘he conceived’ nor ‘he did not conceive’.”

Để chỉ rõ ý nghĩa chủ yếu là sự phủ định như vậy, trong chú giải đã nói: ‘‘Không thể nói là cho là và không cho là’’.

Paṭikkhepappadhānatā cettha labbhamānānampi maññanānaṃ dubbalabhāvato veditabbā.

And here, the predominance of rejection should be understood from the weakness of the perceptions that are still present.

Và sự chủ yếu của sự phủ định ở đây cần được hiểu từ sự yếu ớt của những sự cho là vẫn còn tồn tại.

Tenevāha – ‘‘itarā pana tanubhāvaṃ gatā’’ti.

Therefore it is said: “but the others have become subtle.”

Do đó đã nói – ‘‘những cái khác đã trở nên mỏng manh’’.

Māti ca nipātapadametaṃ, anekatthā ca nipātāti adhippāyena ‘‘etasmiñhi atthe imaṃ padaṃ nipātetvā vutta’’nti vuttaṃ.

Mā is an indeclinable particle. And because particles have many meanings, it is said: “in this sense, this word is stated by placing it as an indeclinable.”

Và Mā là một giới từ (nipātapada). Với ý nghĩa rằng các giới từ có nhiều nghĩa, đã nói: ‘‘Từ này được dùng như một giới từ trong ý nghĩa này’’.

Nipātetvāti ca pakatiādivibhāganiddhāraṇe anumānanayaṃ muñcitvā yathāvutte atthe paccakkhatova dassetvāti attho.

By placing as an indeclinable means, by abandoning the method of inference in determining the natural division etc., and directly demonstrating the meaning as stated.

Và Nipātetvā có nghĩa là, từ bỏ phương pháp suy luận để xác định sự phân chia tự nhiên v.v., mà chỉ trực tiếp chỉ ra ý nghĩa đã nói.

Puthujjano viyāti etenassa uparimaggavajjhataṇhāmānavasena maññanā na paṭikkhittāti dīpeti.

Like an ordinary person indicates that his conceiving is not rejected with respect to craving and conceit that are to be abandoned by the higher paths.

Như một phàm phu – điều này cho thấy rằng sự cho là của vị ấy không bị phủ nhận theo khía cạnh của tham ái và ngã mạn cần được đoạn trừ bởi các đạo cao hơn.

298

Atha vā mā maññīti parikappakiriyāpaṭikkhepavacanametaṃ ‘‘mā randhayuṃ, mā jīrī’’tiādīsu viya, na maññeyyāti vuttañhoti.

Alternatively, mā maññī is a prohibitive verb phrase for conceptualization, as in “may they not cook, may they not decay,” meaning it is said: “one should not conceive.”

Hoặc mā maññī là một từ phủ định hành động giả định, như trong ‘‘mā randhayuṃ, mā jīrī’’ v.v., có nghĩa là ‘‘không nên cho là’’.

Yathā hi puthujjano sabbaso appahīnamaññanattā ‘‘maññati’’cceva vattabbo, yathā ca khīṇāsavo sabbaso pahīnamaññanattā na maññati eva, na evaṃ sekkho.

Just as an ordinary person, having completely unabandoned perceptions, should only be said to "conceive," and just as an Arahant, having completely abandoned perceptions, simply "does not conceive," a Sekkha is not like that.

Như phàm phu, vì có những sự cho là chưa được đoạn trừ hoàn toàn, nên chỉ có thể nói là ‘‘cho là’’; và như một vị A-la-hán (khīṇāsava), vì tất cả những sự cho là đã được đoạn trừ hoàn toàn, nên không cho là. Một vị Hữu học (sekha) thì không như vậy.

Tassa hi ekaccā maññanā pahīnā, ekaccā appahīnā, tasmā ubhayabhāvato ubhayathāpi na vattabbo.

For some of his perceptions are abandoned, and some are not abandoned. Therefore, due to his dual state, he should not be described in either way.

Vì một số sự cho là của vị ấy đã được đoạn trừ, một số thì chưa. Do đó, vì có cả hai khía cạnh, nên không thể nói theo cả hai cách.

Nanu ca ubhayabhāvato ubhayathāpi vattabboti?

But should he not be described in both ways due to his dual state?

Há không phải vì có cả hai khía cạnh, nên có thể nói theo cả hai cách sao?

Na.

No.

Không.

Yā hi appahīnā, tāpissa tanubhāvaṃ gatāti tāhipi so na maññeyya vibhūtatarāya maññanāya abhāvato, pageva itarāhi.

For even those perceptions that are unabandoned have become subtle for him, so he should not conceive by them either, because there is no more intensified perception, let alone by the others.

Vì những sự cho là chưa được đoạn trừ của vị ấy cũng đã trở nên mỏng manh, nên vị ấy không nên cho là bằng những cái đó, vì không có sự cho là mạnh mẽ hơn, huống chi là những cái khác.

Tenāha bhagavā ‘‘mā maññī’’ti.

Therefore the Blessed One said: “should not conceive.”

Do đó Thế Tôn đã nói ‘‘mā maññī’’.

Tena vuttaṃ ‘‘mā maññīti parikappakiriyāpaṭikkhepavacanametaṃ ‘mā randhayuṃ, mā jīrī’tiādīsu viya, na maññeyyāti vuttaṃ hotī’’ti.

Hence it is said: “ mā maññī is a prohibitive verb phrase for conceptualization, as in ‘may they not cook, may they not decay,’ meaning it is said: ‘one should not conceive’.”

Do đó đã nói: ‘‘mā maññī là một từ phủ định hành động giả định, như trong ‘mā randhayuṃ, mā jīrī’ v.v., có nghĩa là ‘không nên cho là’.’’

Ayañcassa amaññanā vatthuno pariññeyyattā, na asekkhassa viya pariññātattā.

And this not-conceiving of his is because the object is to be fully known, not, as in the case of the Asekha, because it has been fully known.

Và sự không cho là này của vị ấy là do đối tượng cần được quán triệt (pariññeyyaṃ), chứ không phải do đã được quán triệt (pariññātaṃ) như của một vị Vô học (asekha).

Yañhi ekantato parijānitabbaṃ parijānituṃ sakkā, na tattha tabbidhure viya puthujjanassa maññanā sambhavanti.

For where something can be fully understood, perceptions like those of an ordinary person do not arise there, as they would in something that is difficult to grasp.

Vì những gì có thể được quán triệt hoàn toàn, thì ở đó không thể có sự cho là của phàm phu như trong trường hợp không thể quán triệt.

Tenāha ‘‘pariññeyyaṃ tassāti vadāmī’’ti.

Therefore it is said: “I declare it is to be fully known by him.”

Do đó đã nói: ‘‘Ta nói rằng đó là điều cần được quán triệt đối với vị ấy’’.

299

Okkantaniyāmattāti anupaviṭṭhasammattaniyāmattā, otiṇṇamaggasotattāti attho.

Because he has entered the fixed course means because he has entered the fixed course of rightness, meaning he has entered the stream of the path.

Do đã đi vào chánh định (okkantaniyāmattā) có nghĩa là do đã đi vào chánh định (sammattaniyāma), tức là đã đi vào dòng của đạo (maggasota).

Sambodhiparāyaṇattāti uparimaggasambodhipaṭisaraṇattā, tadadhigamāya ninnapoṇapabbhārabhāvatoti attho.

Having enlightenment as his refuge means having the enlightenment of the higher paths as his refuge; meaning he is inclined, tending, and leaning towards its attainment.

Do có giác ngộ là nơi nương tựa (sambodhiparāyaṇattā) có nghĩa là do có sự giác ngộ của các đạo cao hơn là nơi nương tựa, tức là có xu hướng, nghiêng về, hướng đến sự đạt được điều đó.

Ubhayenapi tassa avassaṃbhāvinī sesapariññāti dasseti.

By both, it is shown that his remaining comprehension is inevitable.

Bằng cả hai điều này, đã chỉ ra rằng sự quán triệt còn lại của vị ấy là điều chắc chắn.

Pariññeyyanti parijānitabbabhāvena ṭhitaṃ, pariññātuṃ vā sakkuṇeyyaṃ.

To be fully known means standing in the state of being knowable, or being capable of being fully known.

Điều cần được quán triệt (pariññeyyaṃ) có nghĩa là điều tồn tại dưới dạng cần được quán triệt, hoặc điều có thể được quán triệt.

Tappaṭipakkhato apariññeyyaṃ.

The opposite of that is not to be fully known.

Ngược lại với điều đó là điều không thể quán triệt (apariññeyyaṃ).

Puthujjanassa viyāti etena idhādhippetaputhujjanassa pariññeyyabhāvāsaṅkā eva natthi anadhikāratoti dasseti.

Like an ordinary person indicates that for the ordinary person intended here, there is no suspicion of the state of being knowable, as he is not qualified.

Như một phàm phu – điều này cho thấy rằng không có bất kỳ nghi ngờ nào về việc phàm phu được đề cập ở đây có thể quán triệt, vì họ không có quyền hạn.

‘‘Mābhinandī’’ti etthāpi imināva nayena attho veditabbo.

“Should not delight”—here too, the meaning should be understood in the same way.

‘‘Mābhinandī’’ – ở đây cũng vậy, ý nghĩa cần được hiểu theo cách tương tự.

300

Sekkhavāradutiyanayavaṇṇanā niṭṭhitā.

The elucidation of the second section of the Sekkha chapter is concluded.

Hoàn thành phần giải thích phương pháp thứ hai của phần Hữu học.

301

Khīṇāsavavāratatiyādinayavaṇṇanā

Elucidation of the third and subsequent sections of the Arahant chapter

Giải thích phương pháp thứ ba v.v. của phần A-la-hán

302

8. Sabhāgo diṭṭhasaccatādisāmaññena.

8. Similar in the commonality of having seen the truth and so on.

8. Sabhāgo có nghĩa là tương đồng về sự thấy được chân lý v.v.

Ārakā kilesehi arahanti padassa niruttinayena atthaṃ vatvā taṃ pāḷiyā samānento ‘‘vuttañceta’’ntiādimāha.

Having stated the meaning by way of the etymology of the word, “they are worthy because they are far from defilements,” and comparing it with that Pāḷi, he said “vuttañcetaṃ” (this has been said) and so on.

Sau khi nói ý nghĩa của từ “A-la-hán” theo phương pháp ngữ nguyên học (xa lìa các phiền não) và đối chiếu điều đó với kinh điển, Ngài nói câu “vuttañceta” (và điều này đã được nói đến) và những câu tiếp theo.

Tattha pāpakāti lāmakaṭṭhena duggatisampāpanaṭṭhena ca pāpakā.

Therein, pāpakā (evil) means evil in the sense of being base, and in the sense of leading to bad destinations.

Ở đây, từ “pāpakā” (ác) là ác theo nghĩa thấp kém và theo nghĩa dẫn đến khổ cảnh.

Sāvajjaṭṭhena akosallasambhūtaṭṭhena ca akusalā.

Akusalā (unwholesome) in the sense of being blameworthy and arising from unskillfulness.

Theo nghĩa đáng bị khiển trách và theo nghĩa phát sinh từ sự bất thiện, chúng là bất thiện (akusalā).

Saṃkilesaṃ arahanti, tattha vā niyuttāti saṃkilesikā.

Saṃkilesikā (defiling) means they deserve defilement, or they are associated with it.

Chúng xứng đáng bị ô nhiễm, hoặc chúng được gắn liền với sự ô nhiễm, nên chúng là “saṃkilesikā” (gây ô nhiễm).

Punabbhavassa karaṇasīlā, punabbhavaphalaṃ arahantīti vā ponobhavikā.

Ponobhavikā (conducing to renewed existence) means they are by nature causes of renewed existence, or they are worthy of the fruit of renewed existence.

Chúng có thói quen tạo ra sự tái sinh, hoặc chúng xứng đáng với quả của sự tái sinh, nên chúng là “ponobhavikā” (dẫn đến tái sinh).

Saha darathena pariḷāhena pavattantīti sadarā.

Sadarā (accompanied by distress) means they proceed together with distress and torment.

Chúng vận hành cùng với sự đau khổ và sự thiêu đốt, nên chúng là “sadarā” (có đau khổ).

Dukkho kaṭuko, dukkhamo vā vipāko etesanti dukkhavipākā.

Dukkhavipākā (with painful results) means their results are painful and bitter, or difficult.

Quả báo của chúng là khổ đau và cay đắng, hoặc là khổ đau, nên chúng là “dukkhavipākā” (có quả báo khổ đau).

Anāgate jātiyā ceva jarāmaraṇānañca vaḍḍhanena jātijarāmaraṇiyāti.

Jātijarāmaraṇiyā (leading to birth, old age, and death) through the increase of birth, old age, and death in the future.

Do sự gia tăng của sinh, già và chết trong tương lai, nên chúng là “jātijarāmaraṇiyā” (liên quan đến sinh, già và chết).

Evametesaṃ padānaṃ attho veditabbo.

Thus, the meaning of these terms should be understood.

Ý nghĩa của những từ này phải được hiểu như vậy.

Kāmañcāyaṃ suttantavaṇṇanā, abhidhammanayo pana nippariyāyoti tena dassento ‘‘cattāro āsavā’’tiādimāha.

Although this is a Suttanta explanation, the Abhidhamma method is direct (nippariyāya); thus, showing this, he said “cattāro āsavā” (the four āsavas) and so on.

Mặc dù đây là lời giải thích theo kinh tạng, nhưng phương pháp A-tì-đàm là phương pháp trực tiếp, nên để chỉ ra điều đó, Ngài nói câu “cattāro āsavā” (bốn lậu hoặc) và những câu tiếp theo.

Samucchinnā paṭippassaddhāti na kevalaṃ samucchinnā eva, atha kho paṭippassaddhāpīti maggakiccena sadisaṃ phalakiccampi niddhāreti.

Samucchinnā paṭippassaddhā (uprooted and subsided) means not merely uprooted, but also subsided; thus, it specifies the fruit’s function as being similar to the path’s function.

“Samucchinnā paṭippassaddhā” (đã đoạn trừ và đã lắng dịu) không chỉ đơn thuần là đã đoạn trừ, mà còn là đã lắng dịu, do đó nó xác định cả việc làm của quả vị, tương tự như việc làm của đạo lộ.

303

Sīlavisodhanādinā garūnaṃ paṭipattiyā anukaraṇaṃ garusaṃvāso.

Garusaṃvāso (association with teachers) is the imitation of the practice of venerable ones through the purification of sīla and so on.

Sự noi gương theo hạnh của các bậc trưởng thượng thông qua việc thanh lọc giới hạnh, v.v., là “garusaṃvāso” (sống chung với bậc trưởng thượng).

Ariyamaggapaṭipatti eva ariyamaggasaṃvāso.

ariyamaggasaṃvāso (association with the Noble Path) is simply the practice of the Noble Path.

Hạnh của Thánh đạo chính là “ariyamaggasaṃvāso” (sống chung với Thánh đạo).

Dasa ariyāvāsā nāma pañcaṅgavippahīnatādayo.

The dasa ariyāvāsā (ten Noble Dwellings) are the abandonment of five factors and so on.

“Mười Thánh trú” (dasa ariyāvāsā) là sự đoạn trừ năm chi, v.v.

Ye sandhāya vuttaṃ –

Concerning which it was said:

Liên quan đến điều này, đã được nói:

304

‘‘Dasayime, bhikkhave, ariyāvāsā, ye ariyā āvasiṃsu vā āvasanti vā āvasissanti vā.

“Monks, there are these ten Noble Dwellings, which the Noble Ones have dwelt in, dwell in, or will dwell in.

“Này các Tỳ-khưu, có mười Thánh trú này, mà các bậc Thánh đã từng trú, đang trú, hoặc sẽ trú.

Katame dasa?

Which ten?

Mười điều nào?

Idha, bhikkhave, bhikkhu pañcaṅgavippahīno hoti chaḷaṅgasamannāgato, ekārakkho, caturāpasseno, panuṇṇapaccekasacco, samavayasaṭṭhesano, anāvilasaṅkappo, passaddhakāyasaṅkhāro, suvimuttacitto, suvimuttapañño.

Here, monks, a bhikkhu is one who has abandoned five factors, is endowed with six factors, has one protection, has four supports, has renounced individual truths, has entirely given up searching, has unclouded intentions, has a tranquil bodily formation, has a well-liberated mind, has well-liberated wisdom.

Ở đây, này các Tỳ-khưu, một Tỳ-khưu đã đoạn trừ năm chi, đầy đủ sáu chi, có một sự bảo vệ, có bốn sự nương tựa, đã loại bỏ các quan kiến riêng lẻ, đã từ bỏ mọi sự tìm cầu đồng đẳng, có tư duy không bị ô nhiễm, có hành động thân thể đã lắng dịu, có tâm giải thoát hoàn toàn, có tuệ giải thoát hoàn toàn.

Ime kho, bhikkhave, dasa ariyāvāsā’’ti (a. ni. 10.19).

These, monks, are the ten Noble Dwellings.”

Này các Tỳ-khưu, đây là mười Thánh trú.” (A.N. 10.19).

305

Vussatīti vā vusitaṃ, ariyamaggo, ariyaphalañca, taṃ etassa atthīti atisayavacanicchāvasena arahā ‘‘vusitavā’’ti vutto.

It is lived, or that which has been lived, is the Noble Path and the Noble Fruit. The Arahant is called “vusitavā” (one who has lived) in the sense of an emphatic statement, meaning that he possesses this.

Đã sống phạm hạnh, hoặc đã sống phạm hạnh (vusitaṃ), đó là Thánh đạo và Thánh quả. Vị A-la-hán có điều đó, nên Ngài được gọi là “vusitavā” (người đã sống phạm hạnh) theo ý muốn nhấn mạnh.

Karaṇīyanti pariññāpahānabhāvanāsacchikiriyamāha.

Karaṇīyaṃ (what should be done) refers to full understanding (pariññā), abandonment (pahāna), development (bhāvanā), and realization (sacchikiriya).

“Karaṇīyaṃ” (việc cần làm) đề cập đến sự hiểu biết đầy đủ (pariññā), sự đoạn trừ (pahāna), sự tu tập (bhāvanā) và sự chứng đắc (sacchikiriyā).

Taṃ pana yasmā catūhi maggehi catūsu saccesu kattabbattā soḷasavidhanti veditabbaṃ.

However, this should be understood as sixteenfold because it is to be done in the four truths by means of the four paths.

Tuy nhiên, điều đó phải được hiểu là mười sáu loại, vì nó phải được thực hiện trong bốn Thánh đế bởi bốn Thánh đạo.

Tenāha ‘‘catūhi maggehi karaṇīya’’nti.

Therefore, he said “catūhi maggehi karaṇīyaṃ” (what should be done by means of the four paths).

Do đó, Ngài nói “karaṇīyaṃ catūhi maggehi” (việc cần làm bởi bốn Thánh đạo).

Sammāvimuttassāti aggamaggaphalapaññāhi samucchedapaṭippassaddhīnaṃ vasena suṭṭhu vimuttassa.

Sammāvimuttassā (for one rightly liberated) means for one who is perfectly liberated by means of the wisdom of the supreme path and fruit, in the sense of eradication and subsidence.

“Sammāvimuttassa” (người đã giải thoát hoàn toàn) là người đã giải thoát hoàn toàn theo nghĩa đoạn trừ và lắng dịu bởi tuệ của đạo quả tối thượng.

Santacittassāti tato eva sabbakilesadarathapariḷāhānaṃ vūpasantacittassa.

Santacittassā (for one whose mind is tranquil) means for one whose mind is tranquil from all defilements, distress, and torment for that very reason.

“Santacittassa” (người có tâm an tịnh) là người có tâm đã lắng dịu mọi phiền não, đau khổ và sự thiêu đốt, chính vì điều đó.

Bhinnakilesassa khīṇāsavassa bhikkhuno.

For the bhikkhu whose defilements are broken, whose āsavas are exhausted, i.e., the bhikkhuno.

“Bhikkhuno” (của Tỳ-khưu) là của vị Tỳ-khưu đã đoạn trừ phiền não, đã diệt trừ các lậu hoặc.

Katassa pariññādikiccassa paṭicayo puna karaṇaṃ natthi, tato eva karaṇīyaṃ na vijjati na upalabbhati.

There is natthi (no) paṭicayo (recurrence) of the katassa (done) work of full understanding and so on; for that very reason, karaṇīyaṃ na vijjati (what should be done is not found), it does not exist.

“Paṭicayo natthi” (không có sự tích lũy) của việc đã làm (katassa) như sự hiểu biết đầy đủ, v.v., tức là không có sự làm lại; chính vì điều đó, “karaṇīyaṃ na vijjati” (không còn việc cần làm) nữa.

306

Bhārāti osīdāpanaṭṭhena bhārā viyāti bhārā.

Bhārā (burdens) means burdens in the sense that they are like burdens that cause one to sink.

“Bhārā” (gánh nặng) là những gánh nặng theo nghĩa chúng làm cho người ta chìm xuống.

Vuttañhi ‘‘bhārā have pañcakkhandhā’’tiādi (saṃ. ni. 3.22).

Indeed, it has been said: “The five aggregates are indeed burdens,” and so on.

Quả thật, đã được nói: “Năm uẩn quả thật là gánh nặng” và những câu tiếp theo (Tương Ưng Bộ 3.22).

Attano yonisomanasikārāyattanti attupanibandhaṃ, sasantānapariyāpannattā attānaṃ avijahanaṃ.

Attupanibandhaṃ (bound to oneself) means dependent on one’s own wise attention; avijahanaṃ (not abandoning) oneself, in the sense of being included in one’s own continuum.

“Attupanibandhaṃ” (gắn liền với tự ngã) là điều phụ thuộc vào sự tác ý đúng đắn của chính mình; “avijahanaṃ” (không từ bỏ) chính mình vì nó thuộc về dòng tâm thức của mình.

Tayidaṃ yadipi sabbasmiṃ anavajjadhamme sambhavati, akuppasabhāvāparihānadhammesu pana aggabhūte arahatte sātisayaṃ, netaresūti dassento āha ‘‘attano paramatthaṭṭhena vā’’ti, uttamaṭṭhabhāvenāti attho.

Although this is possible in all blameless phenomena, it is pre-eminent in Arahantship, which is of an unshakeable nature and does not decline; showing that it is not so in others, he said “attano paramatthaṭṭhena vā” (or in the sense of its ultimate meaning), meaning in the sense of being supreme.

Mặc dù điều này có thể xảy ra trong tất cả các pháp vô tội, nhưng nó đặc biệt nổi bật trong A-la-hán quả, nơi có bản chất bất động và không suy yếu, chứ không phải trong các trường hợp khác; để chỉ ra điều đó, Ngài nói “attano paramatthaṭṭhena vā” (hoặc theo nghĩa tối thượng của tự ngã), tức là theo nghĩa là trạng thái tối thượng.

307

Suttantanayo nāma pariyāyanayoti nippariyāyanayena saṃyojanāni dassento ‘‘bhavarāgaissāmacchariyasaṃyojana’’nti āha, na pana ‘‘rūparāgo’’tiādinā.

The Suttanta method is an indirect method (pariyāyanaya); thus, showing the saṃyojanas in a direct way (nippariyāyanaya), he said “bhavarāgaissāmacchariyasaṃyojana” (the fetters of lust for existence, envy, and avarice), and not “rūparāgo” (lust for form) and so on.

Phương pháp kinh tạng là phương pháp gián tiếp, nên để chỉ ra các kiết sử theo phương pháp trực tiếp, Ngài nói “bhavarāgaissāmacchariyasaṃyojana” (kiết sử tham ái hữu, tật đố và xan tham), chứ không nói “rūparāgo” (sắc ái) và những câu tiếp theo.

Bhavesu saṃyojantīti kilesakammavipākavaṭṭānaṃ paccayo hutvā nissarituṃ appadānavasena bandhanti.

Bhavesu saṃyojantīti (they fetter in existences) means they bind in the sense of not allowing escape, by becoming causes for the rounds of defilements, kamma, and results.

“Bhavesu saṃyojantī” (chúng trói buộc vào các cõi hữu) là chúng trói buộc theo nghĩa là nhân duyên của vòng luân hồi phiền não, nghiệp và quả báo, không cho phép thoát ra.

Satipi hi aññesaṃ tappaccayabhāve na vinā saṃyojanāni tesaṃ tappaccayabhāvo atthi, orambhāgiyauddhambhāgiyasaṅgahitehi ca tehi taṃtaṃbhavanibbattakakammaniyamo bhavaniyamo ca hoti, na ca upacchinnasaṃyojanassa katānipi kammāni bhavaṃ nibbattentīti tesaṃyeva saṃyojanaṭṭho daṭṭhabbo.

Even if others are causes for that, their being causes for that does not exist without the fetters. And by these fetters, which include the lower and higher fetters, there is the determination of kamma that produces various existences, and the determination of existences. And kamma, even if performed by one whose fetters are cut off, does not produce existence. Thus, their meaning as fetters should be seen.

Mặc dù các pháp khác cũng là nhân duyên, nhưng không có các kiết sử thì chúng không thể là nhân duyên. Và bởi các kiết sử được bao gồm trong hạ phần kiết sử và thượng phần kiết sử, chúng quy định nghiệp tạo ra các cõi hữu và quy định các cõi hữu. Và ngay cả những nghiệp đã làm của người đã đoạn trừ kiết sử cũng không tạo ra cõi hữu, nên ý nghĩa “kiết sử” của chúng phải được hiểu như vậy.

308

Sammā aññāyāti ājānanabhūtāya aggamaggapaññāya sammā yathābhūtaṃ dukkhādīsu yo yathā jānitabbo, taṃ tathā jānitvā.

Sammā aññāyāti (having rightly understood) means having rightly understood, just as it is, by means of the wisdom of the supreme path which is knowledge, understanding suffering and so on, each in the way it should be understood.

“Sammā aññāya” (đã hiểu biết đúng đắn) là đã hiểu biết đúng đắn, như thật về Khổ, v.v., cái gì phải được biết như thế nào, thì đã biết như thế đó, bằng tuệ của đạo tối thượng, tức là sự hiểu biết.

Cittavimutti sabbassa cittasaṃkilesassa vissaggo.

Cittavimutti (mental liberation) is the release from all mental defilements.

“Cittavimutti” (tâm giải thoát) là sự giải thoát khỏi mọi ô nhiễm của tâm.

Nibbānādhimutti nibbāne adhimuccanaṃ tattha ninnapoṇapabbhāratā.

Nibbānādhimutti (inclination towards Nibbāna) is the inclination towards Nibbāna, the leaning, sloping, and tending towards it.

“Nibbānādhimutti” (xu hướng Niết-bàn) là sự hướng về Niết-bàn, sự nghiêng về, thiên về Niết-bàn.

Tanti pathavīādikaṃ.

Taṃ (that) refers to earth and so on.

“Taṃ” (điều đó) là đất, v.v.

Pariññātaṃ, na puthujjanassa viya apariññātaṃ, sekkhassa viya pariññeyyaṃ vā.

Pariññātaṃ (fully understood), not misunderstood like a worldling, nor something yet to be fully understood like a trainee (sekkhā).

“Pariññātaṃ” (đã được hiểu biết đầy đủ), không phải là chưa được hiểu biết đầy đủ như phàm phu, hoặc là điều cần được hiểu biết đầy đủ như bậc hữu học.

Tasmāti pariññātattā.

Tasmā (therefore) means because it is fully understood.

“Tasmā” (do đó) là do đã được hiểu biết đầy đủ.

309

Catutthapañcamachaṭṭhavārā tattha tattha kilesanibbānakittanavasena pavattattā nibbānavārā nāma.

The fourth, fifth, and sixth sections are called nibbānavārā (Nibbāna sections) because they speak of defilements and Nibbāna in those places.

Các phần thứ tư, thứ năm và thứ sáu được gọi là “nibbānavārā” (các phần về Niết-bàn) vì chúng đề cập đến phiền não và Niết-bàn ở từng chỗ.

Tattha pathavīādīnaṃ pariññātattā amaññanā, sā pana pariññā rāgādīnaṃ khayena siddhāti imassa atthassa dīpanavasena pāḷi pavattāti dassento ‘‘pariññātaṃ tassāti sabbapadehi yojetvā puna khayā rāgassa vītarāgattāti yojetabbaṃ.

Therein, the non-conceit (amaññanā) arises because earth and so on are fully understood. This full understanding is achieved by the cessation of lust and so on. Showing this meaning, he said: “pariññātaṃ tassāti sabbapadehi yojetvā puna khayā rāgassa vītarāgattāti yojetabbaṃ” (Having connected “pariññātaṃ tassa” (that is fully understood) with all the terms, one should then connect it with “khayā rāgassa vītarāgattā” (because of the destruction of lust, he is free from lust)).

Ở đây, để làm sáng tỏ ý nghĩa rằng sự không chấp trước là do đã hiểu biết đầy đủ đất, v.v., và sự hiểu biết đầy đủ đó được thành tựu nhờ sự diệt trừ tham ái, v.v., Ngài nói rằng kinh văn được trình bày theo cách “pariññātaṃ tassāti sabbapadehi yojetvā puna khayā rāgassa vītarāgattāti yojetabbaṃ” (sau khi ghép “đã được hiểu biết đầy đủ” với tất cả các từ, lại phải ghép “do sự diệt trừ tham ái, do đã ly tham”).

Esa nayo itaresū’’ti āha.

“Esa nayo itaresū”ti (this is the method in the others) he said.

Ngài nói “Esa nayo itaresū” (Phương pháp này cũng tương tự ở các phần khác).

Tattha itaresūti pañcamachaṭṭhavāresu.

Therein, itaresu (in the others) means in the fifth and sixth sections.

Ở đây, “itaresū” (ở các phần khác) là ở phần thứ năm và thứ sáu.

Yadi evaṃ kasmā pāḷi evaṃ na dissatīti āha ‘‘desanā pana ekattha vuttaṃ sabbattha vuttameva hotīti saṃkhittā’’ti.

If so, why is the Pāḷi not seen this way? He said “desanā pana ekattha vuttaṃ sabbattha vuttameva hotīti saṃkhittā” (But the teaching, what is said in one place, is considered as said everywhere, therefore it is abbreviated).

Nếu vậy, tại sao kinh văn không xuất hiện như vậy? Ngài nói: “desanā pana ekattha vuttaṃ sabbattha vuttameva hotīti saṃkhittā” (Nhưng lời dạy đã được nói ở một chỗ thì được coi là đã được nói ở khắp mọi chỗ, nên nó được tóm tắt).

310

Na khayā rāgassa vītarāgo sabbaso appahīnarāgattā.

Na khayā rāgassa vītarāgo (not free from lust due to the destruction of lust) means because lust is not entirely abandoned.

“Na khayā rāgassa vītarāgo” (không phải là người ly tham do sự diệt trừ tham ái) là do tham ái chưa được đoạn trừ hoàn toàn.

Vikkhambhitarāgo hi soti.

For he is one whose lust is suppressed.

Vì người đó là bậc Dự lưu, người đã trấn áp tham ái.

Bāhirakaggahaṇañcettha tathābhāvasseva tesu labbhanato, na tesu eva tathābhāvassa labbhanato.

And the use of bāhiraka (external) here is because that state is found in them, not that that state is found only in them.

Và ở đây, việc nắm giữ “bāhiraka” (bên ngoài) là do trạng thái đó được tìm thấy ở những điều đó, chứ không phải trạng thái đó chỉ được tìm thấy ở những điều đó mà thôi.

Idāni yā sā ‘‘pariññātaṃ tassā’’ti sabbapadehi yojanā vuttā, taṃ vināpi nibbānavāraatthayojanaṃ dassetuṃ ‘‘yathā cā’’tiādi vuttaṃ.

Now, to show the meaning of the Nibbāna section even without the aforementioned connection of “pariññātaṃ tassa” with all terms, “yathā cā” (and just as) and so on was said.

Bây giờ, để chỉ ra cách giải thích ý nghĩa của phần Niết-bàn mà không cần câu ghép “pariññātaṃ tassā” (điều đó đã được hiểu biết đầy đủ) với tất cả các từ như đã nói, Ngài nói “yathā cā” (và như thế) và những câu tiếp theo.

Tattha maññanaṃ na maññatīti maññanā nappavattatīti attho.

Therein, maññanaṃ na maññatīti (he does not conceive a conception) means conception does not arise.

Ở đây, “maññanaṃ na maññatī” (không chấp thủ sự chấp thủ) có nghĩa là sự chấp thủ không vận hành.

Maññanāya maññitabbattepi tassā vatthuantogadhattāti evamettha attho daṭṭhabbo.

Even though conception is to be conceived, it is included within that object. This is how the meaning should be understood here.

Mặc dù sự chấp thủ là điều cần được chấp thủ, nhưng điều đó là do nó đã được bao gồm trong đối tượng; ý nghĩa ở đây phải được hiểu như vậy.

311

Yadipi pariññātapadaṃ aggahetvā nibbānavāradesanā pavattā, evampi ‘‘khayā’’tiādipadehi pariññāsiddhi eva pakāsīyatīti ko tesaṃ visesoti codanaṃ sandhāyāha ‘‘ettha cā’’tiādi.

Although the teaching of the Nibbāna section proceeds without taking the term “pariññāta,” even so, by terms like “khayā” (destruction) and so on, the achievement of full understanding is revealed. Addressing the question of what special distinction these terms have, he said “ettha cā” (and here) and so on.

Mặc dù lời dạy về phần Niết-bàn được trình bày mà không dùng từ “pariññāta” (đã được hiểu biết đầy đủ), nhưng ngay cả với các từ “khayā” (do sự diệt trừ) và những từ tiếp theo, sự thành tựu của sự hiểu biết đầy đủ cũng được công bố. Vậy sự khác biệt giữa chúng là gì? Để giải đáp câu hỏi đó, Ngài nói “ettha cā” (và ở đây) và những câu tiếp theo.

Maggabhāvanāpāripūridassanatthaṃ vutto, maggakiccantā hi pariññāyoti adhippāyo.

Maggabhāvanāpāripūridassanatthaṃ vutto, (stated for the purpose of showing the fulfillment of the development of the path) for full understanding culminates in the function of the path, this is the intention.

“Maggabhāvanāpāripūridassanatthaṃ vutto” (được nói ra để chỉ sự hoàn thành của sự tu tập đạo lộ), ý nghĩa là sự hiểu biết đầy đủ là kết thúc của việc làm của đạo lộ.

Itare…pe… veditabbā vītarāgādikittanatoti.

Itare…pe… veditabbā (the others… and so on… should be understood) as speaking of being free from lust and so on.

“Itare…pe… veditabbā” (các điều khác… v.v… phải được hiểu) là do việc đề cập đến sự ly tham, v.v.

Dvīhi vā kāraṇehīti yathāvuttakāraṇadvayena.

Dvīhi vā kāraṇehīti (or by two reasons) means by the two aforementioned reasons.

“Dvīhi vā kāraṇehī” (hoặc bởi hai lý do) là bởi hai lý do đã nói.

Assāti khīṇāsavassa.

Assāti (for him) refers to the Arahant whose āsavas are exhausted.

“Assā” (của người đó) là của vị đã diệt trừ các lậu hoặc.

Ayaṃ visesoti idāni vuccamāno viseso.

Ayaṃ visesoti (this is the distinction) refers to the distinction that is now being stated.

“Ayaṃ viseso” (sự khác biệt này) là sự khác biệt sắp được nói ra.

Yadipi khīṇāsavo ekantena vītarāgo vītadoso vītamoho eva ca hoti, yāya pana pubbabhāgapaṭipadāya vītarāgatādayo savisesāti vattabbataṃ labhanti, taṃ dassento ‘‘tīsu hī’’tiādimāha.

Although the Arahant whose āsavas are exhausted is certainly free from lust, hatred, and delusion, showing the preliminary practice by which freedom from lust and so on become worthy of being called special, he said “tīsu hī” (for in the three) and so on.

Mặc dù vị đã diệt trừ các lậu hoặc chắc chắn là người đã ly tham, ly sân, ly si, nhưng để chỉ ra rằng nhờ vào con đường thực hành ban đầu mà sự ly tham, v.v., đạt được sự đặc biệt, Ngài nói “tīsu hī” (vì trong ba) và những câu tiếp theo.

‘‘Ratto atthaṃ na jānātī’’tiādinā (netti. 11) rāge ādīnavaṃ passato ‘‘rāgo ca nāma sukhābhisaṅgena uppajjati, sukhañca vipariṇāmato dukkhaṃ.

"Starting with 'One who is attached does not know what is beneficial,' seeing the danger in lust, thinking, 'Lust arises by clinging to pleasure, and pleasure, by its change, is suffering.

“Kẻ tham dục không biết lợi ích,” v.v. (Netti. 11), khi thấy sự nguy hiểm trong tham ái,^* “tham ái khởi lên do sự chấp trước vào lạc thú, và lạc thú thì là khổ do sự biến đổi.”

Pageva itara’’nti sahetuke rāge ādīnavadassanaṃ dukkhānupassanāya nimittaṃ, dukkhānupassanā ca paṇidhiyā paṭipakkhabhāvato appaṇihitavimokkhaṃ paripuretīti āha ‘‘rāge…pe… vītarāgo hotī’’ti.

And so also is the other'—seeing the danger in lust with its cause is a sign for the contemplation of suffering. And the contemplation of suffering, being the opposite of aspiration, completes the deliverance without aspiration (appaṇihita vimokkha), so it is said: " In lust... he becomes dispassionate."

“Cũng vậy đối với những điều khác,” sự thấy sự nguy hiểm trong tham ái có nguyên nhân là dấu hiệu của quán khổ (dukkhanupassanā), và quán khổ là đối lập với sự mong cầu (paṇidhi), do đó hoàn thành giải thoát vô nguyện (appaṇihitavimokkha). Vì vậy,^* nói “trong tham ái… v.v… trở nên ly tham”.

Tathā ‘‘duṭṭho atthaṃ na jānātī’’tiādinā (itivu. 88) dose ādīnavaṃ passato ‘‘doso ca nāma dukkhaṃ paṭicca uppajjati, tañca ubhayaṃ anavaṭṭhitaṃ ittaraṃ pabhaṅgū’’ti sahetuke dose ādīnavadassanaṃ aniccānupassanāya nimittaṃ, aniccānupassanā ca niccanimittādīnaṃ paṭipakkhabhāvato animittavimokkhaṃ paripūretīti āha ‘‘dose…pe… hotī’’ti.

Similarly, starting with 'One who is malicious does not know what is beneficial,' seeing the danger in hatred, thinking, 'Hatred arises conditioned by suffering, and both are unstable, temporary, and perishable'—seeing the danger in hatred with its cause is a sign for the contemplation of impermanence. And the contemplation of impermanence, being the opposite of the sign of permanence and so forth, completes the deliverance without signs (animitta vimokkha), so it is said: " In hatred... he becomes."

Tương tự, “Kẻ sân hận không biết lợi ích,” v.v. (Itivu. 88), khi thấy sự nguy hiểm trong sân hận,^* “sân hận khởi lên do khổ, và cả hai điều đó đều không ổn định, tạm thời, dễ tan vỡ.” Sự thấy sự nguy hiểm trong sân hận có nguyên nhân là dấu hiệu của quán vô thường (aniccanupassanā), và quán vô thường là đối lập với dấu hiệu thường hằng (niccanimitta), v.v., do đó hoàn thành giải thoát vô tướng (animittavimokkha). Vì vậy,^* nói “trong sân hận… v.v… trở nên^*”.

Tathā ‘‘mūḷho atthaṃ na jānātī’’tiādinā (itivu. 88) mohe ādīnavaṃ passato ‘‘moho nāma yathāsabhāvaggahaṇassa paribbhamanto’’ti mohassa vikkhambhanaṃ anattānupassanāya nimittaṃ, anattānupassanāya ca attābhinivesassa paṭipakkhabhāvato suññataṃ vimokkhaṃ paripūretīti āha ‘‘mohe…pe… vītamoho hotī’’ti.

Similarly, starting with 'One who is deluded does not know what is beneficial,' seeing the danger in delusion, thinking, 'Delusion, indeed, wanders from grasping things as they truly are'—the suppression of delusion is a sign for the contemplation of not-self. And the contemplation of not-self, being the opposite of the obsession with self, completes the deliverance of emptiness (suññatā vimokkha), so it is said: " In delusion... he becomes undeluded."

Tương tự, “Kẻ si mê không biết lợi ích,” v.v. (Itivu. 88), khi thấy sự nguy hiểm trong si mê,^* “si mê là sự lang thang không nắm bắt được bản chất như thật.” Sự trấn áp si mê là dấu hiệu của quán vô ngã (anattānupassanā), và quán vô ngã là đối lập với sự chấp thủ vào ngã (attābhinivesa), do đó hoàn thành giải thoát tánh không (suññatā vimokkha). Vì vậy,^* nói “trong si mê… v.v… trở nên ly si”.

312

Evaṃ santeti yadi vītarāgatādayo vimokkhavibhāgena vuttā, evaṃ sante.

Thus, if it is so: If dispassion and the like are stated as divisions of deliverance, then this is the case.

Khi điều này xảy ra là nếu sự ly tham, v.v., được nói đến theo sự phân chia giải thoát, thì khi điều này xảy ra.

Tasmāti yasmā vimokkhamukhavimokkhānaṃ vasena niyametvā na vuttaṃ, tasmā.

Therefore: Since it is not specified in terms of the doors to liberation and deliverances, therefore.

Do đó là vì nó không được nói đến bằng cách quy định theo các cửa giải thoát và các giải thoát, do đó.

Yaṃ kiñci arahato sambhavantaṃ vibhajitvā vuccatīti vārattayadesanā katāti imamatthaṃ dasseti ‘‘yaṃ arahato’’tiādinā.

Whatever arises in an Arahant is explained by dividing it, thus the teaching in three rounds is made—this meaning is shown by "Whatever of an Arahant" and so forth.

Để chỉ ra ý nghĩa này rằng bất cứ điều gì có thể xảy ra với một vị A-la-hán đều được phân tích và nói ra, nên đã có ba lần thuyết giảng,^* nói “điều gì của một vị A-la-hán” v.v.

313

Evaṃ vimuttivibhāgena khīṇāsavassa vibhāgaṃ vārattayadesanānibandhanaṃ dassetvā idāni avibhāgenapi tattha pariññāvisayassa anusayavisayassa ca vibhāgaṃ tassa nibandhanaṃ dassento ‘‘avisesenā’’tiādimāha.

Having thus shown the division of a Arahant and the reason for the teaching in three rounds based on the division of liberation, now, without division, showing the division of the object of full comprehension and the object of latent tendencies therein, and its reason, he says "without distinction" and so forth.

Sau khi chỉ ra sự phân chia của vị lậu tận theo sự phân chia giải thoát, là cơ sở của ba lần thuyết giảng, bây giờ, để chỉ ra sự phân chia của đối tượng tuệ tri và đối tượng tùy miên trong đó, ngay cả khi không có sự phân chia, và cơ sở của sự phân chia đó,^* nói “không phân biệt” v.v.

Tattha upekkhāvedanā visesato saṅkhāradukkhaṃ sammohādhiṭṭhānanti vuttaṃ ‘‘saṅkhāra…pe… moho’’ti.

Therein, the feeling of equanimity is specifically described as the suffering of formations and the basis of delusion: "formations... delusion".

Trong đó, cảm thọ xả (upekkhāvedanā) đặc biệt là hành khổ (saṅkhāradukkha) và là chỗ nương tựa của sự si mê (sammohādhiṭṭhāna), được nói đến là “hành… v.v… si mê”.

Sesaṃ vuttanayattā suviññeyyameva.

The rest is easily understood, being in accordance with what has been stated.

Phần còn lại là dễ hiểu vì đã được giải thích theo cách thức đã nói.

314

Khīṇāsavavāratatiyādinayavaṇṇanā niṭṭhitā.

The explanation of the third way of the Arahant’s round is concluded.

Hoàn thành phần giải thích về cách thức của ba lần thuyết giảng về vị lậu tận.

315

Tathāgatavārasattamanayavaṇṇanā

Explanation of the Seventh Way of the Tathāgata’s Round

Giải thích về cách thức thứ bảy của phẩm Như Lai

316

12. Yehi (dī. ni. abhi. ṭī. 1.7.cūḷasīlavaṇṇanā; a. ni. ṭī. 1.1.170) guṇavisesehi nimittabhūtehi bhagavati ‘‘tathāgato’’ti ayaṃ samaññā pavattā, taṃ dassanatthaṃ ‘‘aṭṭhahi kāraṇehi bhagavā tathāgato’’tiādi vuttaṃ.

To show by which specific qualities, serving as signs, the appellation " Tathāgata" was established for the Blessed One, it is stated: " The Blessed One is a Tathāgata for eight reasons" and so forth.

Để chỉ ra những đặc tính ưu việt (guṇavisesa) nào là dấu hiệu mà danh xưng “Như Lai” được dùng cho Đức Thế Tôn,^* nói “Đức Thế Tôn là Như Lai vì tám lý do” v.v.

Guṇanemittakāneva hi bhagavato sabbāni nāmāni.

Indeed, all the names of the Blessed One are derived from his qualities.

Tất cả các danh hiệu của Đức Thế Tôn đều là do các đặc tính.

Yathāha –

As it is said:

Như đã nói:

317

‘‘Asaṅkhyeyyāni nāmāni, saguṇena mahesino;

"Innumerable are the names of the Great Sage, endowed with qualities;

“Vô số danh hiệu,

318

Guṇena nāmamuddheyyaṃ, api nāmasahassato’’ti.(dha. sa. aṭṭha. 1313; udā. aṭṭha. 53; paṭi. ma. aṭṭha. 1.76; dī. ni. abhi. ṭī. 1.7.cūḷasīlavaṇṇanā; a. ni. ṭī. 1.1.170) –

A name should be mentioned by a quality, even from a thousand names."

Của bậc Đại Hiền có các đức tính; Dù có hàng ngàn danh hiệu, danh hiệu nên được nêu lên theo đức tính.”

319

Tathā āgatoti ettha ākāraniyamanavasena opammasampaṭipādanattho tathā-saddo.

In " Tathā āgato," the word tathā is for establishing a simile by way of regularity of manner.

Trong Tathā āgato (Như Lai), từ tathā (như) có ý nghĩa so sánh, theo cách quy định về hình thái.

Sāmaññajotanā hi visese avatiṭṭhatīti paṭipādagamanattho āgata-saddo, na ñāṇagamanattho ‘‘tathalakkhaṇaṃ āgato’’tiādīsu (dī. ni. aṭṭha. 1.7; ma. ni. aṭṭha. 1.12; saṃ. ni. aṭṭha. 2.3.78; a. ni. aṭṭha. 1.1.170; udā. aṭṭha. 18; itivu. aṭṭha. 38; theragā. aṭṭha. 1.1.3; bu. vaṃ. aṭṭha. 2.bāhiranidāna; mahāni. aṭṭha. 14) viya, nāpi kāyagamanādiattho ‘‘āgato kho mahāsamaṇo, māgadhānaṃ giribbaja’’ntiādīsu (mahāva. 63) viya.

For the general indication rests in specific qualities, thus the word āgata is for the meaning of "having come by the path," not for the meaning of "having come to the characteristic" as in "having come to the true characteristic" and so forth, nor for the meaning of "having come by foot" as in "the Great Ascetic has come, to Giribbaja of the Magadhans" and so forth.

Vì sự chỉ rõ chung chung đứng vững trong sự đặc biệt, từ āgata (đến) có nghĩa là sự đến theo con đường, chứ không phải là sự đến của trí tuệ như trong “đến với đặc tính như vậy” v.v., cũng không phải là sự đến của thân thể, v.v., như trong “Đại Sa-môn đã đến, tại Giribbaja của dân Ma-kiệt-đà” v.v.

Tattha yadākāraniyamanavasena opammasampaṭipādanattho tathā-saddo, taṃ karuṇāppadhānattā mahākaruṇāmukhena purimabuddhānaṃ āgamanapaṭipadaṃ udāharaṇavasena sāmaññato dassento yaṃtaṃsaddānaṃ ekantasambandhabhāvato ‘‘yathā sabbaloka…pe… āgatā’’ti sādhāraṇato vatvā puna taṃ paṭipadaṃ mahāpadānasuttādīsu (dī. ni. 2.4) sambahulaniddesena supākaṭānaṃ āsannānañca vipassīādīnaṃ channaṃ sammāsambuddhānaṃ vasena dassento ‘‘yathā vipassī bhagavā’’tiādimāha.

Therein, when the word tathā is for establishing a simile by way of regularity of manner, then, being primarily compassion, by means of great compassion, showing generally the path of coming of previous Buddhas by way of example, because of the exclusive connection between "yantaṃ" words, having said "just as all the world... came" in a general sense, he again shows that path by referring to the six Sammasambuddhas such as Vipassī and others, who are well-known from many explanations in the Mahāpadānasutta and so forth, and who are near, saying "just as the Blessed One Vipassī" and so forth.

Trong đó, khi từ tathā có ý nghĩa so sánh theo cách quy định về hình thái, để chỉ ra con đường đến của các vị Phật quá khứ một cách chung chung theo ví dụ, thông qua đại bi do sự ưu việt của lòng bi, và do sự liên hệ tuyệt đối của các từ yaṃ và taṃ,^* nói “như tất cả thế gian… v.v… đã đến” một cách phổ biến, và sau đó, để chỉ ra con đường đó theo sáu vị Chánh Đẳng Giác như Vipassī v.v., những vị đã được giải thích rõ ràng và gần gũi trong Mahāpadānasutta v.v.,^* nói “như Đức Thế Tôn Vipassī” v.v.

Tattha yena abhinīhārenāti manussatta-liṅgasampatti-hetu-satthāradassana-pabbajjā-abhiññādiguṇasampatti-adhikāra-chandānaṃ vasena aṭṭhaṅgasamannāgatena kāyapaṇidhānamahāpaṇidhānena.

Therein, by which aspiration: this refers to the great aspiration and bodily aspiration endowed with eight factors, namely, being a human, having the proper gender, the cause, seeing the Teacher, renunciation, the perfection of qualities such as supernormal powers, special exertion, and will.

Trong đó, yena abhinīhārena (bằng sự phát nguyện nào) là bằng đại nguyện thân hành (kāyapaṇidhāna) và đại nguyện lớn (mahāpaṇidhāna) gồm tám yếu tố: sự thành tựu thân người, sự thành tựu giới tính, nguyên nhân, sự thấy một vị Đạo Sư, sự xuất gia, sự thành tựu các đức tính như thắng trí, sự cống hiến, và ý chí.

Sabbesañhi sammāsambuddhānaṃ kāyapaṇidhānaṃ imināva nīhārena samijjhatīti.

Indeed, the bodily aspiration of all Sammasambuddhas is accomplished by this very method.

Vì tất cả các vị Chánh Đẳng Giác đều hoàn thành đại nguyện thân hành của mình bằng cách phát nguyện này.

320

Evaṃ mahābhinīhāravasena ‘‘tathāgato’’ti padassa atthaṃ vatvā idāni pāramīpūraṇavasena dassetuṃ ‘‘atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā dānapāramiṃ pūretvā’’tiādi vuttaṃ.

Having thus explained the meaning of the word "Tathāgata" by way of the great aspiration, now, to show it by way of the fulfillment of perfections, it is stated: " Or, just as the Blessed One Vipassī... just as the Blessed One Kassapa, having fulfilled the perfection of giving" and so forth.

Sau khi giải thích ý nghĩa của từ “Tathāgato” theo đại nguyện lớn như vậy, bây giờ để chỉ ra theo sự viên mãn các ba-la-mật,^* nói “Hoặc là, như Đức Thế Tôn Vipassī… v.v… như Đức Thế Tôn Kassapa đã viên mãn ba-la-mật bố thí” v.v.

Imasmiṃ pana ṭhāne suttantikānaṃ mahābodhiyānapaṭipadāya kosallajananatthaṃ pāramīkathā vattabbā, sā pana sabbākārasampannā cariyāpiṭakavaṇṇanāya (cariyā. pakiṇṇakakathā) vitthārato niddiṭṭhā, tasmā atthikehi tattha vuttanayeneva veditabbā.

In this context, the discourse on perfections should be given to generate skill in the path of the Great Bodhi vehicle for those who follow the Suttas. However, that, complete in all aspects, is explained in detail in the Cariyāpiṭaka Commentary; therefore, those who are interested should understand it by the method stated therein.

Tuy nhiên, tại chỗ này, câu chuyện về các ba-la-mật cần được nói đến để tạo sự khéo léo cho những người theo kinh điển về con đường Đại Bồ-đề thừa. Nhưng câu chuyện đó đã được giải thích chi tiết đầy đủ trong Cariyāpiṭakavaṇṇanā, do đó, những người có nhu cầu nên tìm hiểu theo cách đã nói ở đó.

Yathā pana pubbe vipassīādayo sammāsambuddhā abhinīhārasampattiyaṃ patiṭṭhāya suvisuddhāya paṭipadāya anavasesato sammadeva sabbā pāramiyo paripūresuṃ, evaṃ amhākampi bhagavā paripūresīti imamatthaṃ sandhāyāha ‘‘samattiṃ sapāramiyo pūretvā’’ti.

Just as the Sammasambuddhas Vipassī and others in the past, having established themselves in the perfection of aspiration, completely fulfilled all perfections by a very pure path without remainder, so too our Blessed One fulfilled them—referring to this meaning, he says: " having fulfilled the thirty perfections."

Như các vị Chánh Đẳng Giác Vipassī v.v. trước đây đã an trụ trong sự thành tựu phát nguyện và hoàn thành tất cả các ba-la-mật một cách hoàn hảo và không sót lại bằng con đường thanh tịnh, thì Đức Thế Tôn của chúng ta cũng đã hoàn thành như vậy. Để chỉ ra ý nghĩa này,^* nói “đã viên mãn ba mươi ba-la-mật”.

Satipi aṅgapariccāgādīnaṃ dānapāramibhāve pariccāgavisesabhāvadassanatthañceva sudukkarabhāvadassanatthañca ‘‘pañca mahāpariccāge’’ti visuṃ gahaṇaṃ, tatoyeva ca aṅgapariccāgato visuṃ nayanapariccāgaggahaṇampi kataṃ, pariggahapariccāgabhāvasāmaññepi dhanarajjapariccāgato puttadārapariccāgaggahaṇañca kataṃ.

Even though the sacrifice of limbs and so forth are aspects of the perfection of giving, "the five great sacrifices" are specifically mentioned to show the specific nature of these sacrifices and their extreme difficulty. For the same reason, the sacrifice of eyes is mentioned separately from the sacrifice of limbs, and the sacrifice of children and spouse is mentioned separately from the sacrifice of wealth and kingdom, even though both are sacrifices of possessions.

Mặc dù sự hy sinh các chi phần, v.v., là một phần của ba-la-mật bố thí, nhưng để chỉ ra sự hy sinh đặc biệt và sự khó khăn của nó, “năm đại hy sinh” được nói riêng. Từ đó, sự hy sinh đôi mắt cũng được nói riêng khỏi sự hy sinh các chi phần, và mặc dù sự hy sinh tài sản và vương quốc có cùng bản chất là sự hy sinh sở hữu, nhưng sự hy sinh vợ con cũng được nói riêng.

321

Gatapaccāgatikavattapūraṇādikāya pubbabhāgapaṭipadāya saddhiṃ abhiññāsamāpattinipphādanaṃ pubbayogo, dānādīsuyeva sātisayapaṭipattinipphādanaṃ pubbacariyā, sā cariyāpiṭakasaṅgahitā.

The production of supernormal attainments together with the preliminary path of fulfilling the reciprocal observances and so forth is former practice (pubbayoga); the production of exceedingly excellent practice in giving and so forth is former conduct (pubbacariyā), and that conduct is compiled in the Cariyāpiṭaka.

Sự thành tựu các thắng trí và các định (samāpatti) cùng với con đường sơ khởi như sự hoàn thành các hạnh nguyện đi rồi lại đến, v.v., là pubbayoga (tiền duyên); sự thực hành đặc biệt trong bố thí, v.v., là pubbacariyā (tiền hạnh), và đó được tập hợp trong Cariyāpiṭaka.

Abhinīhāro pubbayogo, dānādipaṭipatti, kāyavivekavasena ekacariyā vā pubbacariyāti keci.

Some say that aspiration is former practice (pubbayoga), and the practice of giving and so forth, or a single conduct by way of physical seclusion, is former conduct (pubbacariyā).

Một số người cho rằng sự phát nguyện là pubbayoga, còn sự thực hành bố thí, v.v., hoặc sự thực hành đơn độc theo cách ly thân là pubbacariyā.

Dānādīnañceva appicchatādīnañca saṃsāranibbānesu ādīnavānisaṃsānañca vibhāvanavasena sattānaṃ bodhittaye patiṭṭhāpanaparipācanavasena ca pavattā kathā dhammakkhānaṃ, ñātīnaṃ atthacariyā ñātatthacariyā, sāpi karuṇāya vaseneva.

The discourse that arises by way of explaining the dangers and benefits of giving and so forth, and of contentedness and so forth, in saṃsāra and Nibbāna, and by way of establishing and maturing beings in the three kinds of enlightenment, is the teaching of Dhamma (dhammakkhāna); the welfare practice for relatives is the practice of welfare for relatives (ñātatthacariyā), which is also solely by way of compassion.

Bài giảng được thực hiện để thiết lập và làm chín muồi chúng sinh trong ba cấp độ giác ngộ (bodhittaya) bằng cách phân tích bố thí, v.v., cũng như sự ít dục, v.v., và những nguy hiểm và lợi ích trong luân hồi và Niết Bàn, là dhammakkhānaṃ (thuyết pháp); sự lợi ích cho bà con là ñātatthacariyā (hạnh lợi ích bà con), điều này cũng do lòng bi.

Ādi-saddena lokatthacariyādayo saṅgaṇhāti.

By the word ādi (and so forth), he includes the practice of welfare for the world and so forth.

Từ ādi (v.v.) bao gồm hạnh lợi ích thế gian (lokatthacariyā), v.v.

Kammassakatañāṇavasena, anavajjakammāyatanasippāyatanavijjāṭṭhānaparicayavasena khandhāyatanādiparicayavasena, lakkhaṇattayatīraṇavasena ca ñāṇacāro buddhicariyā, sā pana atthato paññāpāramīyeva, ñāṇasambhāradassanatthaṃ visuṃ gahaṇaṃ.

The range of knowledge by means of the knowledge of the ownership of kamma, by means of familiarity with blameless actions, crafts, and fields of knowledge, by means of familiarity with aggregates, sense bases, etc., and by means of discerning the three characteristics, is the practice of wisdom (buddhicariyā). But that, in meaning, is indeed the perfection of wisdom (paññāpāramī); it is mentioned separately to show the accumulation of knowledge.

Do sự hiểu biết về nghiệp là của mình, do sự quen thuộc với các nghiệp xứ, kỹ nghệ xứ, minh xứ không có lỗi, do sự quen thuộc với các uẩn, xứ, v.v., và do sự phán xét ba đặc tính, sự vận hành của trí tuệ chính là phật hạnh (buddhicariyā). Nhưng về ý nghĩa, đó chính là Trí tuệ Ba-la-mật (paññāpāramī), được đề cập riêng để chỉ rõ sự tích lũy trí tuệ.

Koṭīti pariyanto, ukkaṃsoti attho.

Koṭi means limit, the meaning is supremacy.

Koṭī (cực điểm) là giới hạn, có nghĩa là sự tối thượng.

322

Cattāro satipaṭṭhāne bhāvetvā brūhetvāti sambandho.

The connection is: having developed and cultivated the four foundations of mindfulness.

Liên hệ là đã tu tập và phát triển bốn niệm xứ.

Tattha bhāvetvāti uppādetvā.

Among these, having developed (bhāvetvā) means having produced.

Trong đó, bhāvetvā (đã tu tập) là đã sinh khởi.

Brūhetvāti vaḍḍhetvā.

Having cultivated (brūhetvā) means having increased.

Brūhetvā (đã phát triển) là đã tăng trưởng.

Satipaṭṭhānādiggahaṇena āgamanapaṭipadaṃ matthakaṃ pāpetvā dasseti.

By mentioning the foundations of mindfulness (satipaṭṭhānā) and so forth, it shows the culmination of the path of practice.

Việc đề cập đến satipaṭṭhānā (niệm xứ) v.v. cho thấy con đường hành trì đã đạt đến đỉnh cao.

Vipassanāsahagatā eva vā satipaṭṭhānādayo daṭṭhabbā.

Or, the foundations of mindfulness (satipaṭṭhānā) and so forth should be understood as accompanied by insight (vipassanā).

Hoặc satipaṭṭhānā (niệm xứ) v.v. cần được xem là đi kèm với tuệ quán.

Ettha ca ‘‘yena abhinīhārenā’’tiādinā āgamanapaṭipadāya ādiṃ dasseti, ‘‘dānapāramī’’tiādinā majjhaṃ, ‘‘cattāro satipaṭṭhāne’’tiādinā pariyosānanti veditabbaṃ.

Here, it should be understood that the beginning of the path of practice is shown by ‘‘yena abhinīhārenā’’ and so forth, the middle by ‘‘dānapāramī’’ and so forth, and the conclusion by ‘‘cattāro satipaṭṭhāne’’ and so forth.

Và ở đây, với cụm từ ‘‘yena abhinīhārenā’’ (do sự quyết tâm nào) v.v. cho thấy khởi điểm của con đường hành trì; với cụm từ ‘‘dānapāramī’’ (bố thí Ba-la-mật) v.v. cho thấy phần giữa; và với cụm từ ‘‘cattāro satipaṭṭhāne’’ (bốn niệm xứ) v.v. cho thấy phần kết thúc, cần phải hiểu như vậy.

323

Sampatijātoti muhuttajāto manussānaṃ hatthato muttamatto, na mātukucchito nikkhantamatto.

Just born (sampatijāto) refers to having been born a moment ago, having just been released from the hands of humans, not immediately upon emergence from the mother's womb.

Sampatijāto (mới sinh) là vừa mới sinh ra, vừa thoát khỏi tay loài người, không phải vừa ra khỏi bụng mẹ.

Nikkhantamattañhi mahāsattaṃ paṭhamaṃ brahmāno suvaṇṇajālena paṭiggaṇhiṃsu, tesaṃ hatthato cattāro mahārājāno ajinappaveṇiyā, tesaṃ hatthato manussā dukūlacumbaṭakena paṭiggaṇhiṃsu, manussānaṃ hatthato muccitvā pathaviyaṃ patiṭṭhitoti.

For the Great Being, immediately upon emergence, the Brahmās first received him in a golden net; from their hands, the four Great Kings received him in a deerskin carpet; from their hands, humans received him in a silken cloth; having been released from the hands of humans, he stood on the earth.

Đại Bồ tát vừa ra đời trước hết được các Phạm thiên đón nhận bằng lưới vàng, từ tay họ được bốn Đại Thiên Vương đón nhận bằng tấm thảm da thú, từ tay họ được loài người đón nhận bằng tấm vải lụa; sau khi thoát khỏi tay loài người, Ngài đứng vững trên mặt đất.

Yathāha bhagavā mahāpadānadesanāyaṃ.

As the Blessed One said in the Mahāpadāna discourse.

Yathāha (như đã nói) Đức Thế Tôn trong bài thuyết Mahāpadāna.

Setamhi chatteti dibbasetacchatte.

Under a white canopy (setamhi chatte) means under a divine white canopy.

Setamhi chatte (dưới lọng trắng) là dưới lọng trắng của chư thiên.

Anudhārīyamāneti dhārīyamāne.

Being held (anudhārīyamāne) means being held.

Anudhārīyamāne (đang được che) là đang được che.

Ettha ca chattaggahaṇeneva khaggādīni pañca kakudhabhaṇṭānipi vuttānevāti daṭṭhabbaṃ.

Here, it should be understood that by the mention of the canopy, the other five royal insignias, such as the sword, are also stated.

Và ở đây, chỉ với việc đề cập đến lọng, cần phải hiểu rằng năm bảo vật vương quyền như gươm v.v. cũng đã được nói đến.

Khaggatālavaṇṭamorahatthakavālabījanīuṇhīsapaṭṭāpi hi chattena saha tadā upaṭṭhitā ahesuṃ, chattādīniyeva ca tadā paññāyiṃsu, na chattādiggāhakā.

For the sword, the fan, the yak-tail whisk, the hand-held fan, and the turban were also present with the canopy at that time, and only the canopy and other insignias were perceived, not those who held them.

Thật vậy, gươm, quạt lá, phất trần lông đuôi công, quạt, khăn vấn đầu cũng xuất hiện cùng với lọng vào lúc đó, và chỉ có lọng v.v. được thấy rõ vào lúc đó, chứ không phải những người cầm lọng v.v.

Sabbā ca disāti dasapi disā.

All directions (sabbā ca disā) means all ten directions.

Sabbā ca disā (và tất cả các phương) là mười phương.

Nayidaṃ sabbadisāvilokanaṃ sattapadavītihāruttarakālaṃ daṭṭhabbaṃ.

This looking in all directions should not be understood as occurring after the seven steps have been taken.

Việc nhìn khắp các phương này không nên được xem là sau khi đi bảy bước.

Mahāsatto hi manussānaṃ hatthato muccitvā puratthimadisaṃ olokesi.

For the Great Being, after being released from the hands of humans, looked towards the eastern direction.

Thật vậy, Đại Bồ tát sau khi thoát khỏi tay loài người, nhìn về phương đông.

Tattha devamanussā gandhamālādīhi pūjayamānā ‘‘mahāpurisa idha tumhehi sadisopi natthi, kuto uttaritaro’’ti āhaṃsu.

There, devas and humans, worshipping with perfumes, garlands, etc., said: “Great man, there is no one like you here, how could there be anyone superior?”

Ở đó, chư thiên và loài người cúng dường bằng hương hoa v.v. và nói: ‘‘Này Đại nhân, ở đây không có ai giống Ngài, huống chi là hơn Ngài.’’

Evaṃ catasso disā, catasso anudisā; heṭṭhā, uparīti sabbā disā anuviloketvā sabbattha attanā sadisaṃ adisvā ‘‘ayaṃ uttarā disā’’ti tattha sattapadavītihārena agamāsi.

In this way, having looked over the four cardinal directions, the four intermediate directions, below, and above—all directions—and seeing no one like himself anywhere, he said: “This is the northern direction,” and walked seven steps in that direction.

Như vậy, sau khi nhìn khắp bốn phương chính, bốn phương phụ; phía dưới, phía trên, không thấy ai giống mình ở khắp mọi nơi, Ngài nói: ‘‘Đây là phương bắc’’, và đi bảy bước về hướng đó.

Āsabhinti uttamaṃ.

Lion-like (āsabhiṃ) means supreme.

Āsabhaṃ (tối thượng) là tối thượng.

Aggoti sabbapaṭhamo.

Foremost (aggo) means first of all.

Aggo (đứng đầu) là người đầu tiên trong tất cả.

Jeṭṭho seṭṭhoti ca tasseva vevacanaṃ.

Eldest, noblest (jeṭṭho seṭṭho) are synonyms for the same.

Jeṭṭho seṭṭho (trưởng thượng, tối thắng) là đồng nghĩa với từ đó.

Ayamantimā jāti, natthi dāni punabbhavoti imasmiṃ attabhāve pattabbaṃ arahattaṃ byākāsi.

This is my last birth, there is now no more rebirth (ayamantimā jāti, natthi dāni punabbhavo) – with these words, he declared the Arahantship to be attained in this existence.

Ayamantimā jāti, natthi dāni punabbhavo (đây là kiếp cuối cùng, không còn tái sinh nữa) là Ngài đã tuyên bố về quả vị A-la-hán sẽ đạt được trong đời này.

324

Anekesaṃ visesādhigamānaṃ pubbanimittabhāvenāti saṃkhittena vuttamatthaṃ ‘‘yañhī’’tiādinā vitthārato dasseti.

The meaning stated concisely as "by being a prefigurement of many special attainments" (anekesaṃ visesādhigamānaṃ pubbanimittabhāvenā) is shown in detail by ‘‘yañhī’’ and so forth.

Ý nghĩa đã được nói tóm tắt là ‘‘aneakesaṃ visesādhigamānaṃ pubbanimittabhāvenā’’ (do là điềm báo trước của nhiều sự chứng đắc đặc biệt) được giải thích chi tiết bằng cụm từ ‘‘yañhī’’ (vì lẽ đó) v.v.

Tattha etthāti –

There, in this (etthā) refers to —

Trong đó, etthā (ở đây) là –

325

‘‘Anekasākhañca sahassamaṇḍalaṃ,

“The devas held a canopy,

‘‘Lọng có nhiều nhánh và ngàn vòng tròn,

326

Chattaṃ marū dhārayumantalikkhe;

Having many branches and a thousand circles, in the sky;

Chư thiên che trong không trung;

327

Suvaṇṇadaṇḍā vītipatanti cāmarā,

Fly-whisks with golden handles moved about,

Phất trần cán vàng bay lượn,

328

Na dissare cāmarachattagāhakā’’ti.(su. ni. 693);

But no holders of the fly-whisks or canopy were seen.”

Không thấy người cầm phất trần và lọng’’ (Su. Ni. 693);

329

Imissā gāthāya.

This refers to this verse.

Trong bài kệ này.

Sabbaññutaññāṇameva sabbattha appaṭihatacāratāya anāvaraṇañāṇanti āha ‘‘sabbaññutānāvaraṇañāṇapaṭilābhassā’’ti.

He says ‘‘sabbaññutānāvaraṇañāṇapaṭilābhassā’’ (of the attainment of omniscient, unimpeded knowledge) because omniscient knowledge itself is unimpeded knowledge everywhere due to its unhindered range.

Chính trí tuệ Toàn giác, do sự vận hành không bị chướng ngại ở khắp mọi nơi, là trí tuệ vô ngại, nên nói ‘‘sabbaññutānāvaraṇañāṇapaṭilābhassā’’ (do sự thành tựu trí tuệ toàn giác vô ngại).

Tathā ayaṃ bhagavāpi gato…pe… pubbanimittabhāvenāti etena abhijātiyaṃ dhammatāvasena uppajjanakavisesā sabbabodhisattānaṃ sādhāraṇāti dasseti.

By ‘‘Tathā ayaṃ bhagavāpi gato…pe… pubbanimittabhāvenā’’ (Similarly, this Blessed One also went… and so forth… by being a prefigurement), it shows that the special characteristics arising by way of inherent nature at birth are common to all Bodhisattas.

Tathā ayaṃ bhagavāpi gato…pe… pubbanimittabhāvenā (cũng như Đức Thế Tôn này đã đến… v.v… do là điềm báo trước) điều này cho thấy rằng những đặc điểm đặc biệt xuất hiện theo quy luật tự nhiên khi sinh ra là chung cho tất cả các vị Bồ tát.

Pāramitānissandā hi teti.

For these are the outcomes of the perfections.

Vì chúng là kết quả của các Ba-la-mật.

330

Vikkamīti agamāsi.

He strode (vikkamī) means he went.

Vikkamī (đã bước đi) là đã đi.

Marūti devā.

Marūs means devas.

Marū (chư thiên) là các vị thần.

Samāti vilokanasamatāya samā sadisiyo.

Equal (samā) means equal or similar in their capacity for observation.

Samā (bằng nhau) là giống nhau, tương tự về khả năng nhìn.

Mahāpuriso hi yathā ekaṃ disaṃ vilokesi, evaṃ sesadisāpi, na katthaci vilokane vibandho tassa ahosīti.

For just as the Great Being looked in one direction, so too he looked in the other directions; there was no impediment to his looking anywhere.

Đại nhân nhìn một phương như thế nào, thì các phương còn lại cũng như thế, Ngài không gặp trở ngại nào trong việc nhìn.

Samāti vā viloketuṃ yuttā, visamarahitāti attho.

Or, equal (samā) means fit to be looked at, meaning free from unevenness.

Hoặc samā (bằng nhau) là đáng để nhìn, có nghĩa là không có sự bất bình đẳng.

Na hi tadā bodhisattassa virūpabībhacchavisamarūpāni viloketuṃ ayuttāni disāsu upaṭṭhahantīti.

For at that time, no ugly, repulsive, or uneven forms unsuitable for the Bodhisatta to behold appeared in the directions.

Vì vào lúc đó, không có những hình dạng xấu xí, ghê tởm, bất bình đẳng xuất hiện ở các phương mà Bồ tát không nên nhìn.

331

Evaṃ ‘‘tathā gato’’ti kāyagamanaṭṭhena gata-saddena tathāgata-saddaṃ niddisitvā idāni ñāṇagamanaṭṭhena taṃ dassetuṃ ‘‘atha vā’’tiādimāha.

Having thus designated the word Tathāgata by the word gata in the sense of bodily going, as in ‘‘tathā gato’’ (thus gone), he now says ‘‘atha vā’’ (or else) and so forth to show it in the sense of going by knowledge.

Như vậy, sau khi chỉ định từ Tathāgata (Như Lai) bằng từ gata (đã đi) theo nghĩa đi bằng thân trong cụm từ ‘‘tathā gato’’ (đã đi như vậy), bây giờ để chỉ rõ điều đó theo nghĩa đi bằng trí tuệ, Ngài nói ‘‘atha vā’’ (hoặc là) v.v.

Tattha nekkhammenāti alobhappadhānena kusalacittuppādena.

There, by renunciation (nekkhammena) means by a wholesome mind-state predominantly free from greed.

Trong đó, nekkhammena (do sự xuất ly) là do sự khởi tâm thiện lấy vô tham làm chủ yếu.

Kusalā hi dhammā idha nekkhammaṃ, na pabbajjādayo, ‘‘paṭhamajjhāna’’nti (dī. ni. abhi. ṭī. 1.7.cūḷasīlavaṇṇanā; a. ni. ṭī. 1.1.170) ca vadanti.

For wholesome states here are renunciation, not going forth or similar; and they say, ‘‘first jhāna’’.

Vì các pháp thiện ở đây là sự xuất ly, chứ không phải sự xuất gia v.v., và cũng nói ‘‘sơ thiền’’ (Dī. Ni. Abhi. Ṭī. 1.7. Cūḷasīlavaṇṇanā; A. Ni. Ṭī. 1.1.170).

Pahāyāti pajahitvā.

Having abandoned (pahāyā) means having forsaken.

Pahāyā (đã từ bỏ) là đã từ bỏ.

Gato adhigato, paṭipanno uttarivisesanti attho.

Gone (gato) means attained, meaning having progressed to further special attainments.

Gato (đã đi) là đã chứng đắc, có nghĩa là đã thực hành những điều đặc biệt cao hơn.

Pahāyāti vā pahānahetu, pahānalakkhaṇaṃ vā.

Or, having abandoned (pahāyā) means for the sake of abandoning, or characterized by abandoning.

Hoặc pahāyā (đã từ bỏ) là nguyên nhân của sự từ bỏ, hoặc đặc tính của sự từ bỏ.

Hetulakkhaṇattho hi ayaṃ pahāya-saddo.

For this word pahāya has the meaning of cause or characteristic.

Vì từ pahāya này có nghĩa là nguyên nhân và đặc tính.

Kāmacchandādippahānahetukaṃ ‘‘gato’’ti hettha vuttaṃ gamanaṃ avabodho, paṭipatti eva vā kāmacchandādippahānena ca lakkhīyatīti.

The going mentioned here as ‘‘gato’’ (gone) is comprehension that has as its cause the abandonment of sensual desire and so forth, or indeed the practice itself is characterized by the abandonment of sensual desire and so forth.

Sự đi được nói ở đây là sự giác ngộ có nguyên nhân từ sự từ bỏ các dục lạc v.v., hoặc sự thực hành được đặc trưng bởi sự từ bỏ các dục lạc v.v.

Esa nayo padāletvātiādīsupi.

The same method applies to having pierced (padāletvā) and so forth.

Cũng theo cách này trong padāletvā (đã phá tan) v.v.

Abyāpādenāti mettāya.

By non-ill-will (abyāpādenā) means by loving-kindness.

Abyāpādenā (do sự không sân) là do lòng từ bi.

Ālokasaññāyāti vibhūtaṃ katvā manasikaraṇena (dī. ni. abhi. ṭī. 1.7.cūḷasīlavaṇṇanā) upaṭṭhitaālokasañcānanena.

By the perception of light (ālokasaññāyā) means by making it manifest through mental advertence, by arousing the perception of light.

Ālokasaññāyā (do tưởng ánh sáng) là do sự chú tâm làm cho rõ ràng (Dī. Ni. Abhi. Ṭī. 1.7. Cūḷasīlavaṇṇanā) và do sự vận hành của tưởng ánh sáng đã xuất hiện.

Avikkhepenāti samādhinā.

By non-distraction (avikkhepenā) means by concentration.

Avikkhepenā (do sự không tán loạn) là do định.

Dhammavavatthānenāti kusalādidhammānaṃ yāthāvanicchayena.

By the determination of phenomena (dhammavavatthānenā) means by the precise ascertainment of wholesome and other phenomena.

Dhammavavatthānenā (do sự phân biệt các pháp) là do sự xác định đúng đắn các pháp thiện v.v.

‘‘Sappaccayanāmarūpavavatthānenā’’tipi vadanti.

They also say, ‘‘by the determination of dependent mind-and-matter’’.

Cũng nói ‘‘do sự phân biệt danh sắc có duyên’’.

332

Evaṃ kāmacchandādinīvaraṇappahānena ‘‘abhijjhaṃ loke pahāyā’’tiādinā (vibha. 508) vuttāya paṭhamajjhānassa pubbabhāgapaṭipadāya bhagavato tathāgatabhāvaṃ dassetvā idāni saha upāyena aṭṭhahi samāpattīhi aṭṭhārasahi ca mahāvipassanāhi taṃ dassetuṃ ‘‘ñāṇenā’’tiādimāha.

Having thus shown the Tathāgata-nature of the Blessed One by the preliminary practice of the first jhāna, described as abandoning the hindrances of sensual desire and so forth in ‘‘abhijjhaṃ loke pahāyā’’ (having abandoned covetousness in the world) and so forth, he now says ‘‘ñāṇenā’’ (by knowledge) and so forth to show it together with the means, by the eight attainments and the eighteen great insights.

Như vậy, sau khi chỉ rõ trạng thái Như Lai của Đức Thế Tôn bằng con đường hành trì tiền phần của sơ thiền được nói đến trong cụm từ ‘‘abhijjhaṃ loke pahāyā’’ (đã từ bỏ tham ái trong đời) v.v. do sự từ bỏ các triền cái như dục ái v.v., bây giờ để chỉ rõ điều đó bằng tám thiền định và mười tám đại tuệ quán cùng với phương tiện, Ngài nói ‘‘ñāṇenā’’ (do trí tuệ) v.v.

Nāmarūpapariggahakaṅkhāvitaraṇānañhi vinibandhabhūtassa mohassa dūrīkaraṇena ñātapariññāyaṃ ṭhitassa aniccasaññādayo sijjhanti, tathā jhānasamāpattīsu abhiratinimittena pāmojjena.

For by removing delusion, which is the impediment to comprehending mind-and-matter and overcoming doubt, the perceptions of impermanence and so forth arise for one who stands in the full understanding of what is known, as does joy through the sign of delight in the jhāna attainments.

Thật vậy, do sự loại bỏ si mê là chướng ngại của sự thấu triệt danh sắc và sự vượt qua nghi ngờ, các tưởng vô thường v.v. của người đã an trú trong trí tuệ hiểu biết sẽ thành tựu, cũng như do sự hoan hỷ nhờ dấu hiệu của sự hoan hỷ trong các thiền định.

Tattha ‘‘anabhiratiyā vinoditāya jhānādīnaṃ samadhigamo’’ti samāpattivipassanānaṃ arativinodanaavijjāpadālanādīni upāyo, uppaṭipāṭiniddeso pana nīvaraṇasabhāvāya avijjāya heṭṭhā nivaraṇesupi saṅgahadassanatthanti daṭṭhabbaṃ.

There, ‘‘the attainment of jhānas and so forth is due to the removal of discontent’’ means that the removal of discontent and the piercing of ignorance are the means for the attainments and insights, but the inverted order of presentation is to show that ignorance, being of the nature of a hindrance, is also included among the lower hindrances.

Trong đó, ‘‘sự chứng đắc các thiền định v.v. là do sự loại bỏ sự bất mãn’’, nên sự loại bỏ sự bất mãn, sự phá tan vô minh v.v. là phương tiện của các thiền định và tuệ quán; còn việc sắp xếp ngược thứ tự là để chỉ rõ sự bao gồm vô minh, vốn có bản chất là triền cái, trong các triền cái ở dưới.

Samāpattivihārappavesavibandhanena nīvaraṇāni kavāṭasadisānīti āha ‘‘nīvaraṇakavāṭaṃ ugghāṭetvā’’ti.

He says ‘‘having opened the door of hindrances’’ (nīvaraṇakavāṭaṃ ugghāṭetvā) because the hindrances are like doors, obstructing entry into the abiding of attainments.

Các triền cái giống như cánh cửa cản trở việc đi vào các thiền định và trú xứ, nên nói ‘‘nīvaraṇakavāṭaṃ ugghāṭetvā’’ (đã mở cánh cửa triền cái).

‘‘Rattiṃ anuvitakketvā anuvicāretvā divā kammante payojetī’’ti (ma. ni. 1.251) vuttaṭṭhāne vitakkavicārā dhūmāyanāti adhippetāti āha ‘‘vitakkavicāradhūma’’nti.

He says ‘‘vitakka-vicāra smoke’’ (vitakkavicāradhūmaṃ) meaning that in the passage ‘‘thinking and pondering at night, one applies oneself to work by day,’’ the thoughts and deliberations are implied to be smoldering.

Trong đoạn văn ‘‘rattiṃ anuvitakketvā anuvicāretvā divā kammante payojetī’’ (Ma. Ni. 1.251) (ban đêm suy tư, suy xét, ban ngày thực hiện các công việc), ý muốn nói rằng tầm và tứ đang bốc khói, nên nói ‘‘vitakkavicāradhūma’’ (khói tầm và tứ).

Kiñcāpi paṭhamajjhānupacāreyeva dukkhaṃ, catutthajjhānupacāre ca sukhaṃ pahīyati, atisayappahānaṃ pana sandhāyāha ‘‘catutthajjhānena sukhadukkhaṃ pahāyā’’ti.

Although suffering is abandoned only in the preliminary stage of the first jhāna, and pleasure in the preliminary stage of the fourth jhāna, he states ‘‘by the fourth jhāna, having abandoned pleasure and suffering’’ (catutthajjhānena sukhadukkhaṃ pahāyā) with reference to the exceptional abandonment.

Mặc dù khổ được từ bỏ trong cận định sơ thiền, và lạc được từ bỏ trong cận định tứ thiền, nhưng ý muốn nói đến sự từ bỏ vượt trội, nên nói ‘‘catutthajjhānena sukhadukkhaṃ pahāyā’’ (đã từ bỏ khổ và lạc bằng tứ thiền).

333

Aniccassa, aniccanti ca anupassanā aniccānupassanā, tebhūmakadhammānaṃ aniccataṃ gahetvā pavattāya vipassanāyetaṃ nāmaṃ.

Seeing the impermanent as impermanent is aniccaanupassanā. This is the name for the insight that arises by comprehending the impermanence of the phenomena of the three planes.

Sự quán sát "vô thường, vô thường" là quán vô thường, đây là tên của tuệ quán được thực hành bằng cách nắm bắt tính vô thường của các pháp thuộc ba cõi.

Niccasaññanti saṅkhatadhammesu ‘‘niccā sassatā’’ti evaṃpavattamicchāsaññaṃ.

Perception of permanence means the wrong perception that arises in conditioned phenomena as "permanent, eternal."

Thường tưởng là tà tưởng phát sinh trong các pháp hữu vi rằng "chúng là thường hằng, vĩnh cửu".

Saññāsīsena diṭṭhicittānampi gahaṇaṃ daṭṭhabbaṃ.

It should be understood that views and thoughts are also included by means of the chief of perception.

Cũng nên hiểu rằng bằng phương thức tưởng, cả tà kiến và tâm cũng được bao gồm.

Esa nayo ito paresupi.

This method applies to what follows also.

Phương pháp này cũng áp dụng cho các trường hợp khác sau đây.

Nibbidānupassanāyāti saṅkhāresu nibbijjanākārena pavattāya anupassanāya.

By nibbidānupassanā is meant the contemplation that proceeds in the manner of becoming disenchanted with conditioned phenomena.

Quán yếm ly là sự quán sát được thực hành theo cách chán ghét đối với các pháp hữu vi.

Nandinti sappītikataṇhaṃ.

Nandi means delight-filled craving.

Hoan hỷ là ái có hỷ.

Virāgānupassanāyāti saṅkhāresu virajjanākārena pavattāya anupassanāya.

By virāgānupassanā is meant the contemplation that proceeds in the manner of dispassion towards conditioned phenomena.

Quán ly tham là sự quán sát được thực hành theo cách ly tham đối với các pháp hữu vi.

Nirodhānupassanāyāti saṅkhārānaṃ nirodhassa anupassanāya.

By nirodhānupassanā is meant the contemplation of the cessation of conditioned phenomena.

Quán diệt là sự quán sát về sự diệt của các pháp hữu vi.

Yathā vā saṅkhārā nirujjhantiyeva, āyatiṃ punabbhavavasena na uppajjanti, evaṃ anupassanā nirodhānupassanā.

Or, the contemplation that conditioned phenomena indeed cease, and do not arise again in the sense of future becoming, is nirodhānupassanā.

Hoặc là, các pháp hữu vi chỉ diệt đi, không tái sinh nữa theo cách tái hữu trong tương lai, sự quán sát như vậy là quán diệt.

Tenevāha ‘‘nirodhānupassanāya nirodheti, no samudetī’’ti.

Therefore, it is said, "By nirodhānupassanā, one brings to cessation, not to accumulation."

Chính vì thế mà Ngài đã nói: "Với quán diệt, nó diệt đi, không sinh khởi nữa".

Muccitukamyatā hi ayaṃ balappattāti.

For this desire for release has become strong.

Thật vậy, đây là sự mong muốn giải thoát đã đạt đến sức mạnh.

Paṭinissajjanākārena pavattā anupassanā paṭinissaggānupassanā, paṭisaṅkhāsantiṭṭhanā hi ayaṃ.

The contemplation that proceeds in the manner of relinquishing is paṭinissaggānupassanā; for this is contemplation based on reflection.

Sự quán sát được thực hành theo cách xả bỏ là quán xả bỏ, thật vậy, đây là sự quán xét và an trụ.

Ādānanti niccādivasena gahaṇaṃ.

Ādāna means grasping in terms of permanence and so forth.

Nắm giữ là sự nắm giữ theo cách thường hằng, v.v.

Santatisamūhakiccārammaṇānaṃ vasena ekattaggahaṇaṃ ghanasaññā.

The grasping of unity in terms of continuity, aggregation, function, and object is ghanasaññā (perception of compactness).

Sự nắm giữ tính duy nhất theo cách liên tục, tập hợp, chức năng và đối tượng là tưởng khối.

Āyūhanaṃ abhisaṅkharaṇaṃ.

Āyūhanaṃ means accumulation.

Tích tập là sự tạo tác.

Avatthāvisesāpatti vipariṇāmo.

Attaining a specific state is vipariṇāmo (alteration).

Sự biến đổi thành một trạng thái đặc biệt là biến hoại.

Dhuvasaññanti thirabhāvaggahaṇaṃ.

Dhuvasañña means the grasping of stability.

Thường tưởng là sự nắm giữ tính kiên cố.

Nimittanti samūhādighanavasena sakiccaparicchedatāya ca saṅkhārānaṃ saviggahaggahaṇaṃ.

Nimitta means the grasping of conditioned phenomena with their form, in terms of the compactness of aggregation and so forth, and in terms of their functional delimitation.

Tướng là sự nắm giữ các pháp hữu vi với hình tướng theo cách khối tập hợp, v.v., và theo cách phân định chức năng của chúng.

Paṇidhinti rāgādipaṇidhiṃ.

Paṇidhi means longing such as craving.

Nguyện là nguyện ái, v.v.

Sā panatthato taṇhāvasena saṅkhāresu ninnatā.

Essentially, it is the inclination towards conditioned phenomena by way of craving.

Nhưng về bản chất, đó là sự hướng về các pháp hữu vi theo cách tham ái.

Abhinivesanti attānudiṭṭhiṃ.

Abhinivesa means the perception of self.

Chấp thủ là tà kiến về ngã.

334

Aniccadukkhādivasena sabbadhammatīraṇaṃ adhipaññādhammavipassanā.

The discernment of all phenomena in terms of impermanence, suffering, and so forth, is adhipaññādhammavipassanā (insight into phenomena by means of higher wisdom).

Sự phân biệt tất cả các pháp theo cách vô thường, khổ, v.v., là thắng tuệ quán pháp.

Sārādānābhinivesanti asāresu sāraggahaṇavipallāsaṃ.

Sārādānābhinivesa means the perversion of grasping essence in the non-essential.

Chấp thủ nắm giữ tinh túy là sự điên đảo nắm giữ tinh túy trong những cái không phải tinh túy.

Issarakuttādivasena loko samuppannoti abhiniveso sammohābhiniveso.

The adherence that the world arose due to a creator god's wrath and so forth, is sammohābhiniveso (adherence to delusion).

Sự chấp thủ rằng thế gian được sinh ra bởi một đấng tạo hóa, v.v., là chấp thủ si mê.

Keci pana ‘‘ahosiṃ nu kho ahaṃ atītamaddhānantiādinā (ma. ni. 1.18; saṃ. ni. 2.20) pavattasaṃsayāpatti sammohābhiniveso’’ti vadanti.

However, some say that the state of doubt arising as in "Was I, indeed, in the past?" is sammohābhiniveso.

Một số người nói rằng: "Sự nghi ngờ phát sinh như 'Phải chăng tôi đã từng có mặt trong quá khứ?' v.v., là chấp thủ si mê".

Saṅkhāresu leṇatāṇabhāvaggahaṇaṃ ālayābhiniveso.

The grasping of conditioned phenomena as a shelter or refuge is ālayābhiniveso (adherence to attachment).

Sự nắm giữ các pháp hữu vi như là nơi trú ẩn, nơi nương tựa là chấp thủ trú xứ.

‘‘Ālayaratā ālayasammuditā’’ti (dī. ni. 2.64, 67; ma. ni. 1.281; 2.337; saṃ. ni. 1.172; mahāva. 7, 8) vacanato ālayo taṇhā, sāyeva cakkhādīsu rūpādīsu ca abhinivisanavasena pavattiyā ālayābhinivesoti keci.

Some say that, as stated, "delighting in attachment, pleased with attachment," attachment is craving; and the very act of craving manifesting by adhering to the eye and other sense organs, and to forms and other objects, is ālayābhiniveso.

Một số người nói rằng: "Theo lời dạy 'hoan hỷ trú xứ, vui thích trú xứ', trú xứ là tham ái, chính tham ái đó, khi phát sinh theo cách chấp thủ vào mắt, v.v., và sắc, v.v., là chấp thủ trú xứ".

‘‘Evaṃvidhā saṅkhārā paṭinissajjīyantī’’ti pavattaṃ ñāṇaṃ paṭisaṅkhānupassanā.

The knowledge that arises as "Such conditioned phenomena are to be relinquished" is paṭisaṅkhānupassanā (contemplation by reflection).

Trí tuệ phát sinh rằng "các pháp hữu vi như vậy cần được xả bỏ" là quán quán xét.

Vaṭṭato vigatattā vivaṭṭaṃ, nibbānaṃ, tattha ārammaṇakaraṇasaṅkhātena anupassanena pavattiyā vivaṭṭānupassanā, gotrabhū.

That which is disjoined from the round (of existence) is Nibbāna, called vivaṭṭaṃ; the contemplation that proceeds by taking it as an object is vivaṭṭānupassanā, which is gotrabhū.

Vì đã thoát khỏi vòng luân hồi nên là sự thoát ly, tức Niết Bàn. Sự quán sát được thực hành bằng cách lấy Niết Bàn làm đối tượng là quán thoát ly, tức chuyển tộc.

Saṃyogābhinivesanti saṃyujjanavasena saṅkhāresu nivisanaṃ.

Saṃyogābhinivesa means adhering to conditioned phenomena by way of being conjoined.

Chấp thủ trói buộc là sự bám víu vào các pháp hữu vi theo cách trói buộc.

Diṭṭhekaṭṭheti diṭṭhiyā sahajātekaṭṭhe pahānekaṭṭhe ca.

Diṭṭhekaṭṭhe means in that which is born together with views, and in that which is to be abandoned together with them.

Đồng nhất với kiến là đồng nhất với kiến sinh khởi cùng với nó và đồng nhất với kiến bị đoạn trừ.

Oḷāriketi uparimaggavajjhakilese apekkhitvā vuttaṃ, aññathā dassanena pahātabbāpi dutiyamaggavajjhehi oḷārikāti.

Oḷārike (gross) is said with reference to defilements that are to be abandoned by the higher paths; otherwise, defilements to be abandoned by insight are also gross compared to those abandoned by the second path.

Thô thiển được nói đến khi so sánh với các phiền não bị đoạn trừ bởi các đạo cao hơn; nếu không, ngay cả những phiền não bị đoạn trừ bởi kiến cũng thô thiển so với những phiền não bị đoạn trừ bởi đạo thứ hai.

Aṇusahagateti aṇubhūte.

Aṇusahagate means minute.

Đồng hành với vi tế là những cái vi tế.

Idaṃ heṭṭhimamaggavajjhe apekkhitvā vuttaṃ.

This is said with reference to defilements to be abandoned by the lower paths.

Điều này được nói đến khi so sánh với những phiền não bị đoạn trừ bởi các đạo thấp hơn.

Sabbakileseti avasiṭṭhasabbakilese.

Sabbakilese means all remaining defilements.

Tất cả phiền não là tất cả các phiền não còn lại.

Na hi paṭhamādimaggehi pahīnā kilesā puna pahīyantīti.

For defilements abandoned by the first and subsequent paths are not abandoned again.

Thật vậy, những phiền não đã bị đoạn trừ bởi các đạo đầu tiên, v.v., không bị đoạn trừ lại nữa.

335

Kakkhaḷattaṃ kathinabhāvo.

Kakkhaḷattaṃ is hardness.

Tính cứng rắn là tính chất cứng.

Paggharaṇaṃ dravabhāvo.

Paggharaṇaṃ is fluidity.

Tính chảy là tính chất lỏng.

Lokiyavāyunā bhastassa viya yena vāyunā taṃtaṃkalāpassa uddhumāyanaṃ, thaddhabhāvo vā, taṃ vitthambhanaṃ.

The swelling up of each kalāpa by the wind, like a bellows by worldly wind, or its stiffness, is vitthambhanaṃ.

Sự phồng lên của từng nhóm nhỏ bởi gió, giống như cái bễ bởi gió thế gian, hoặc tính chất cứng đơ, đó là sự trương phồng.

Vijjamānepi kalāpantarabhūtānaṃ kalāpantarabhūtehi samphuṭṭhabhāve taṃtaṃbhūtavivittatā rūpapariyanto ākāsoti yesaṃ yo paricchedo, tehi so asamphuṭṭhova, aññathā bhūtānaṃ paricchedasabhāvo na siyā byāpībhāvāpattito, abyāpitāva asamphuṭṭhatāti yasmiṃ kalāpe bhūtānaṃ paricchedo, tehi asamphuṭṭhabhāvo asamphuṭṭhalakkhaṇaṃ.

Even though the constituent elements of a kalāpa are in contact with the constituent elements of another kalāpa, the distinctness of each element, where the boundary of space is the limit of form, means that it is not in contact with that boundary; otherwise, the delimiting nature of the elements would not exist, as it would lead to pervasiveness, and non-pervasiveness is non-contact; thus, asamphuṭṭhalakkhaṇaṃ (characteristic of non-contact) is the non-contact of the elements in a kalāpa where their boundary is established.

Mặc dù có sự tiếp xúc giữa các nhóm nguyên tố khác nhau với nhau, nhưng sự riêng biệt của từng nguyên tố, tức là không gian là giới hạn của sắc, và bất kỳ giới hạn nào của chúng, chúng không tiếp xúc với nhau; nếu không, tính chất phân định của các nguyên tố sẽ không tồn tại do sẽ có sự lan rộng, và sự không lan rộng là sự không tiếp xúc. Do đó, trong một nhóm nguyên tố, sự phân định của các nguyên tố và tính chất không tiếp xúc với chúng là đặc tính không tiếp xúc.

Tenāha bhagavā ākāsadhātuniddese (dha. sa. 637) ‘‘asamphuṭṭhaṃ catūhi mahābhūtehī’’ti.

Therefore, the Blessed One said in the description of the space element, "not in contact with the four great elements."

Vì thế, Đức Phật đã nói trong diễn giải về không đại rằng: "không tiếp xúc với bốn đại".

336

Virodhipaccayasannipāte visadisuppatti ruppanaṃ.

The arising of a dissimilar state upon the confluence of opposing conditions is ruppanaṃ (affliction).

Sự sinh khởi khác biệt khi các nhân đối nghịch hội tụ là sự biến hoại.

Cetanāpadhānattā saṅkhārakkhandhadhammānaṃ cetanāvasenetaṃ vuttaṃ ‘‘saṅkhārānaṃ abhisaṅkharaṇalakkhaṇa’’nti.

Because the phenomena of the saṅkhāra-khandha are predominantly volitional, it is said, "the characteristic of volitional formations is accumulation," referring to volition.

Vì các pháp thuộc uẩn hành lấy tư tâm sở làm chủ yếu, nên điều này được nói theo cách tư tâm sở là "đặc tính tạo tác của các hành".

Tathā hi suttantabhājanīye saṅkhārakkhandhavibhaṅge (vibha. 92) ‘‘cakkhusamphassajā cetanā’’tiādinā cetanāva vibhattā.

For in the suttanta division of the saṅkhāra-khandha, volition itself is elaborated upon, beginning with "volition born of eye-contact."

Thật vậy, trong phân tích uẩn hành trong Suttanta , tư tâm sở được phân tích bằng cách nói "tư tâm sở sinh ra từ xúc nhãn", v.v.

Abhisaṅkharaṇalakkhaṇā ca cetanā.

And volition has the characteristic of accumulation.

Và tư tâm sở có đặc tính tạo tác.

Yathāha ‘‘tattha katamo puññābhisaṅkhāro?

As it is said, "What is wholesome accumulation there?

Như đã nói: "Trong đó, thế nào là phước hành?

Kusalā cetanā kāmāvacarā’’tiādi.

Wholesome volition in the kāma-sphere" and so forth.

Là tư tâm sở thiện thuộc dục giới", v.v.

Pharaṇaṃ savipphārikatā.

Pharaṇaṃ is pervasion.

Sự lan tỏa là tính chất bao trùm.

Assaddhiyeti asaddhiyahetu.

Assaddhiye means due to lack of faith.

Trong sự bất tín tức là do nguyên nhân bất tín.

Nimittatthe bhummaṃ.

The locative case is used in the sense of cause.

Là cách dùng định sở cách (bhumma) với nghĩa biểu thị nguyên nhân.

Esa nayo kosajjetiādīsu.

This method applies to kosajje (idleness) and so forth.

Phương pháp này cũng áp dụng cho biếng nhác, v.v.

Upasamalakkhaṇanti kāyacittapariḷāhūpasamalakkhaṇaṃ.

Upasamalakkhaṇa means the characteristic of the calming of bodily and mental agitation.

Đặc tính an tịnh là đặc tính an tịnh sự bức bách của thân và tâm.

Līnuddhaccarahite adhicitte pavattamāne paggahaniggahasampahaṃsanesu abyāvaṭatāya ajjhupekkhanaṃ paṭisaṅkhānaṃ pakkhapātupacchedato.

Paṭisaṅkhānaṃ (reflection) is looking on with equanimity, without being involved in encouraging, restraining, or gladdening, when the higher mind, free from sluggishness and restlessness, is active, because it cuts off partiality.

Sự quán xét là sự buông xả khi tâm cao thượng, không có sự uể oải và phóng dật, đang được thực hành, không bận tâm đến việc thúc đẩy, kiềm chế và khích lệ, vì nó đoạn trừ sự thiên vị.

337

Musāvādādīnaṃ visaṃvādanādikiccatāya lūkhānaṃ apariggāhakānaṃ paṭipakkhabhāvato pariggāhakasabhāvā sammāvācā siniddhabhāvato sampayuttadhamme sammāvācāpaccayasubhāsitānaṃ sotārañca puggalaṃ pariggaṇhātīti tassā pariggāhalakkhaṇaṃ vuttaṃ.

Right speech is said to have the characteristic of apprehending because it grasps the associated phenomena and the person listening to well-spoken words which are causes of right speech, due to its smooth nature, being opposed to the rough and ungrasping nature of false speech and similar actions, which perform acts of deceit and so forth.

Vì tà ngữ, v.v., có chức năng lừa dối, v.v., và thô thiển, không bao dung, nên chánh ngữ có tính chất bao dung vì nó đối lập với chúng, và vì tính chất mềm mỏng của nó, nó bao dung các pháp tương ưng và người nghe những lời nói tốt đẹp do chánh ngữ làm nhân. Vì vậy, đặc tính bao dung của nó được nói đến.

Kāyikakiriyā kiñci kattabbaṃ samuṭṭhāpeti, sayañca samuṭṭhahanaṃ ghaṭanaṃ hotīti sammākammanta saṅkhātāya viratiyā samuṭṭhānalakkhaṇaṃ daṭṭhabbaṃ.

Bodily action initiates something to be done, and its own initiation becomes an effort; thus, samuṭṭhānalakkhaṇaṃ (characteristic of origination) should be seen in the abstinence known as right action.

Hành động thân thể khởi lên một việc gì đó cần làm, và chính sự khởi lên đó là sự kết hợp. Vì vậy, đặc tính khởi lên của sự kiêng cữ được gọi là chánh nghiệp cần được hiểu.

Sampayuttadhammānaṃ vā ukkhipanaṃ samuṭṭhāpanaṃ kāyikakiriyāya bhārukkhipanaṃ viya.

Or the uplifting of associated phenomena is samuṭṭhāpanaṃ, like the uplifting of a burden by bodily action.

Hoặc là, sự nâng đỡ các pháp tương ưng là sự khởi lên, giống như việc nâng gánh của hành động thân thể.

Jīvamānassa sattassa, sampayuttadhammānaṃ vā jīvitindriyappavattiyā, ājīvasseva vā suddhi vodānaṃ.

The purity of a living being, or of associated phenomena by way of the functioning of the life-faculty, or simply the purity of livelihood, is vodānaṃ (purification).

Sự thanh tịnh của chúng sinh đang sống, hoặc sự tiếp diễn của sinh mạng của các pháp tương ưng, hoặc sự thanh tịnh của chính sinh kế là sự thanh tịnh.

Sasampayuttadhammassa cittassa saṃkilesapakkhe patituṃ adatvā sammadeva paggaṇhanaṃ paggaho.

Paggaho (exertion) is the proper uplifting of the mind and its associated phenomena, not allowing them to fall into the defilement side.

Sự nắm giữ đúng đắn tâm của các pháp tương ưng mà không để nó rơi vào phe ô nhiễm là sự thúc đẩy.

338

‘‘Saṅkhārā’’ti idha cetanā adhippetāti vuttaṃ ‘‘saṅkhārānaṃ cetanālakkhaṇa’’nti.

It is said that "conditioned phenomena" here refers to volition, thus "the characteristic of conditioned phenomena is volition."

"Các hành" ở đây có nghĩa là tư tâm sở, nên đã nói "đặc tính tư tâm sở của các hành".

Namanaṃ ārammaṇābhimukhabhāvo.

Namanaṃ (bending) is being directed towards an object.

Sự hướng về là sự hướng mặt về đối tượng.

Āyatanaṃ pavattanaṃ.

Āyatanaṃ (sphere) is manifestation.

Xứ là sự tiếp diễn.

Āyatanānaṃ vasena hi āyasaṅkhātānaṃ cittacetasikānaṃ pavatti.

For the mind and mental factors, which are called "āya," manifest according to the spheres.

Thật vậy, sự tiếp diễn của tâm và các tâm sở, được gọi là "áy", là do các xứ.

Taṇhāya hetulakkhaṇanti vaṭṭassa janakahetubhāvo, maggassa pana nibbānasampāpakattanti ayametesaṃ viseso.

The characteristic of craving as cause means being the generating cause of the round of existence, whereas the path is that which leads to Nibbāna; this is their distinction.

Đặc tính nguyên nhân của tham ái là tính chất là nguyên nhân sinh ra vòng luân hồi, còn đối với đạo thì là sự đưa đến Niết Bàn. Đây là sự khác biệt giữa chúng.

339

Tathalakkhaṇaṃ aviparītasabhāvo.

Tathalakkhaṇaṃ (true characteristic) is an unperverted nature.

Đặc tính như thật là tính chất không sai lệch.

Ekaraso aññamaññānativattanaṃ anūnānadhikabhāvo.

Ekaraso (single taste) is not exceeding one another, being neither deficient nor excessive.

Một vị là sự không vượt quá lẫn nhau, là tính chất không thiếu không thừa.

Yuganaddhā samathavipassanāva.

Yuganaddhā is samatha and vipassanā itself.

Song hành là chỉ có chỉ và quán.

Saddhāpaññā paggahāvikkhepātipi vadanti.

Some also say faith and wisdom, exertion and non-distraction.

Một số người cũng nói là tín và tuệ, thúc đẩy và không phóng dật.

340

Khīṇoti kilese khepatīti khayo, maggo.

Khayo (destruction) means that which destroys defilements, i.e., the path.

Diệt là diệt trừ các phiền não, tức là đạo.

Anuppādapariyosānatāya anuppādo, phalaṃ.

Anuppādo (non-arising) means its culmination in non-arising, i.e., the fruit.

Bất sinh là sự chấm dứt không tái sinh, tức là quả.

Passaddhi kilesavūpasamo.

Passaddhi (tranquillity) is the calming of defilements.

Khinh an là sự an tịnh của các phiền não.

Chandassāti kattukāmatāchandassa.

Chandassā means of the desire to act.

Của dục là của dục muốn làm.

Mūlalakkhaṇaṃ patiṭṭhābhāvo.

The root characteristic is the state of being a foundation.

Đặc tính gốc (Mūlalakkhaṇaṃ) là không có sự thiết lập.

Samuṭṭhānabhāvo samuṭṭhānalakkhaṇaṃ ārammaṇapaṭipādakatāya sampayuttadhammānaṃ uppattihetutā.

The state of origination is the characteristic of origination, which is the causality for the arising of associated phenomena by bringing about the object.

Sự khởi lên là đặc tính khởi lên (samuṭṭhānalakkhaṇaṃ), tức là nguyên nhân cho sự phát sinh của các pháp tương ưng (sampayuttadhammā) do sự cung cấp đối tượng.

Samodhānaṃ visayādisannipātena gahetabbākāro, yā saṅgatīti vuccati.

Confluence is the manner of being grasped by the conjunction of objects and so forth, which is called concordance.

Sự hòa hợp (Samodhānaṃ) là cách thức được nắm giữ bởi sự tụ hội của đối tượng, v.v., tức là sự kết hợp.

Samaṃ saha odahanti anena sampayuttadhammāti vā samodhānaṃ, phasso.

Or, that by which associated phenomena are placed together equally is confluence; contact.

Hoặc, các pháp tương ưng cùng nhau hòa hợp bởi điều này, nên gọi là samodhānaṃ, tức xúc (phasso).

Samosaranti sannipatanti etthāti samosaraṇaṃ.

That in which they converge, in which they assemble, is convergence.

Các pháp tụ hội tại đây, nên gọi là sự tụ hội (samosaraṇaṃ).

Vedanāya vinā appavattamānā sampayuttadhammā vedanānubhavananimittaṃ samosaṭā viya hontīti evaṃ vuttaṃ.

Associated phenomena, which do not proceed without feeling, are said to be as if converged for the experience of feeling.

Các pháp tương ưng không khởi lên nếu không có thọ, dường như chúng tụ hội vì mục đích cảm thọ; điều này được nói như vậy.

Gopānasīnaṃ kūṭaṃ viya sampayuttānaṃ pāmokkhabhāvo pamukhalakkhaṇaṃ.

The characteristic of prominence is the prominence of associated phenomena, like the peak of a rafter.

Sự nổi bật (pāmokkhabhāvo) của các pháp tương ưng, như đỉnh của các vì kèo, là đặc tính hàng đầu (pamukhalakkhaṇaṃ).

Tato, tesaṃ vā sampayuttadhammānaṃ uttari padhānanti tatuttari, paññuttarā hi kusalā dhammā.

Therefore, or that which is superior and principal among associated phenomena is that which is superior; for wholesome phenomena are supreme in wisdom.

Từ đó, hoặc sự tối thượng (uttari) của các pháp tương ưng đó là sự tối thượng (tatuttari), vì các pháp thiện là tối thượng bởi tuệ (paññā).

Vimuttiyāti phalassa.

By liberation means of the fruit.

Của sự giải thoát (Vimuttiyā) là của quả.

Tañhi sīlādiguṇasārassa paramukkaṃsabhāvena sāraṃ.

For that, by virtue of the supreme excellence of the essence of virtues such as sīla, is the essence.

Vì điều đó, với bản chất tối thượng của các đức tính như giới, là cốt lõi (sāraṃ).

Ayañca lakkhaṇavibhāgo chadhātupañcajhānaṅgādivasena taṃtaṃsuttapadānusārena porāṇaṭṭhakathāyaṃ āgatanayena ca katoti daṭṭhabbaṃ.

And this classification of characteristics should be understood as made according to the method found in the ancient commentaries, following the specific suttas based on the six elements, the five jhāna factors, and so forth.

Và sự phân chia đặc tính này cần được hiểu là đã được thực hiện theo các đoạn kinh tương ứng dựa trên sáu giới, năm chi thiền, v.v., và theo cách được trình bày trong các chú giải cổ xưa.

Tathā hi pubbe vuttopi koci dhammo pariyāyantarapakāsanatthaṃ puna dassito.

Thus, some dhamma previously stated is again shown for the purpose of clarifying a different aspect.

Vì vậy, một số pháp đã được đề cập trước đó cũng được trình bày lại để làm sáng tỏ một khía cạnh khác.

Tato eva ca ‘‘chandamūlakā kusalā dhammā manasikārasamuṭṭhānā phassasamodhānā vedanāsamosaraṇā’’ti, ‘‘paññuttarā kusalā dhammā’’ti, ‘‘vimuttisāramidaṃ brahmacariya’’nti, ‘‘nibbānogadhañhi āvuso brahmacariyaṃ nibbānapariyosāna’’nti (ma. ni. 1.466) ca suttapadānaṃ vasena ‘‘chandassa mūlalakkhaṇa’’ntiādi vuttaṃ.

And for that very reason, with reference to the sutta passages, “‘Wholesome phenomena have desire as their root, origination in attention, confluence with contact, and convergence with feeling’,” “‘Wholesome phenomena are supreme in wisdom’,” “‘This holy life has liberation as its essence’,” and “‘Indeed, friends, the holy life is grounded in Nibbāna, ending in Nibbāna’,” ‘the root characteristic of desire’ and so forth were stated.

Và vì vậy, theo các đoạn kinh như: “Các pháp thiện có dục (chanda) làm gốc, có tác ý (manasikāra) làm khởi lên, có xúc (phassa) làm hòa hợp, có thọ (vedanā) làm tụ hội,” và “Các pháp thiện là tối thượng bởi tuệ,” và “Phạm hạnh này có giải thoát (vimutti) làm cốt lõi,” và “Này chư hiền, phạm hạnh này hướng đến Niết Bàn, có Niết Bàn làm cứu cánh” (M.i, 466), nên mới nói “dục là đặc tính gốc”, v.v.

341

Tathadhammā nāma cattāri ariyasaccāni aviparītasabhāvattā.

True phenomena are the four Noble Truths because their nature is not perverted.

Các pháp như thật (Tathadhammā) là Tứ Thánh Đế, vì bản chất của chúng không bị đảo lộn.

Tathāni taṃsabhāvattā.

True because their nature is such.

Như thật (Tathāni) vì bản chất của chúng là như vậy.

Avitathāni amusāsabhāvattā.

Unaltered because their nature is not false.

Không sai khác (Avitathāni) vì bản chất của chúng không dối trá.

Anaññathāni aññākārarahitattā.

Not otherwise because they are devoid of any other aspect.

Không khác biệt (Anaññathāni) vì không có trạng thái khác.

Jātipaccayasambhūtasamudāgataṭṭhoti jātipaccayā sambhūtaṃ hutvā sahitassa attano paccayānurūpassa uddhaṃ āgatabhāvo, anupavattanaṭṭhoti attho.

The meaning of 'arisen and proceeded from birth as a condition' means the state of having arisen and proceeded upwards in accordance with its own conditions, having been born from the condition of birth; the meaning is the state of not ceasing to exist.

Ý nghĩa của sự sinh khởi và xuất hiện do duyên sinh (Jātipaccayasambhūtasamudāgataṭṭho) là trạng thái xuất hiện lên sau khi đã sinh khởi do duyên sinh, phù hợp với duyên của chính nó; nghĩa là ý nghĩa của sự không tiếp tục.

Atha vā sambhūtaṭṭho ca samudāgataṭṭho ca sambhūtasamudāgataṭṭho, na jātito jarāmaraṇaṃ na hoti, na ca jātiṃ vinā aññato hotīti jātipaccayasambhūtaṭṭho.

Alternatively, the meaning of 'arisen' and the meaning of 'proceeded' together form 'arisen and proceeded'; 'old age and death do not arise from birth, nor do they arise from anything else without birth' is the meaning of 'arisen from birth as a condition'.

Hoặc, ý nghĩa của sự sinh khởi và ý nghĩa của sự xuất hiện là ý nghĩa của sự sinh khởi và xuất hiện (sambhūtasamudāgataṭṭho). Không phải từ sự sinh mà già chết không có, cũng không phải không có sự sinh mà già chết lại có từ một cái khác; đây là ý nghĩa của sự sinh khởi do duyên sinh (jātipaccayasambhūtaṭṭho).

Itthañca jātito samudāgacchatīti jātipaccayasamudāgataṭṭho, yā yā jāti yathā yathā paccayo hoti, tadanurūpaṃ pātubhāvoti attho.

And thus, 'it proceeds from birth' is the meaning of 'proceeded from birth as a condition'; the meaning is that whatever birth, in whatever way it is a condition, corresponds to that manifestation.

Và theo cách này, nó xuất hiện từ sự sinh, nên là ý nghĩa của sự xuất hiện do duyên sinh (jātipaccayasamudāgataṭṭho); nghĩa là, bất kỳ sự sinh nào là duyên như thế nào, thì sự xuất hiện cũng phù hợp với điều đó.

Avijjāya saṅkhārānaṃ paccayaṭṭhoti etthāpi na avijjā saṅkhārānaṃ paccayo na hoti, na ca avijjaṃ vinā saṅkhārā uppajjanti, yā yā avijjā yesaṃ yesaṃ saṅkhārānaṃ yathā yathā paccayo hoti, ayaṃ avijjāya saṅkhārānaṃ paccayaṭṭho paccayabhāvoti attho.

Regarding 'the conditionality of formations by ignorance,' here too, ignorance is not not a condition for formations, nor do formations arise without ignorance; whatever ignorance, for whatever formations, in whatever way it is a condition, this is the conditionality, the state of being a condition, of formations by ignorance.

Trong câu “vô minh là duyên của các hành (avijjāya saṅkhārānaṃ paccayaṭṭho)” này cũng vậy, không phải vô minh không phải là duyên của các hành, cũng không phải không có vô minh mà các hành lại sinh khởi. Bất kỳ vô minh nào là duyên của bất kỳ hành nào như thế nào, thì đây là ý nghĩa của sự duyên khởi của vô minh đối với các hành, nghĩa là trạng thái duyên khởi.

342

Bhagavā taṃ sabbākārato jānāti passatīti sambandho.

The connection is that the Blessed One knows and sees it in all its aspects.

Đức Thế Tôn biết và thấy điều đó trong mọi khía cạnh; đó là sự liên kết.

Tenāti bhagavatā.

By him means by the Blessed One.

Bởi Ngài (Tenā) tức là bởi Đức Thế Tôn.

Taṃ vibhajjamānanti yojetabbaṃ.

It should be connected as 'that which is being analyzed'.

Cần phải kết hợp với “điều đó đang được phân tích”.

Tanti rupāyatanaṃ.

That refers to the rūpāyatana (visual object).

Điều đó (Taṃ) tức là sắc xứ (rūpāyatana).

Iṭṭhāniṭṭhādīti ādi-saddena majjhattaṃ saṅgaṇhāti, tathā atītānāgatapaccuppannaparittaajjhattabahiddhātadubhayādibhedaṃ.

Desirable, undesirable, etc.—the word ‘etc.’ includes the neutral, as well as the distinctions of past, future, present, subtle, internal, external, and both internal and external, and so forth.

Dễ chịu, khó chịu, v.v. (Iṭṭhāniṭṭhādī): từ v.v. (ādi) bao gồm cả trung tính (majjhattaṃ), cũng như các phân loại như quá khứ, vị lai, hiện tại, nhỏ nhặt, nội, ngoại, và cả hai.

Labbhamānakapadavasenāti ‘‘rūpāyatanaṃ diṭṭhaṃ, saddāyatanaṃ sutaṃ, gandhāyatanaṃ rasāyatanaṃ phoṭṭhabbāyatanaṃ mutaṃ, sabbaṃ rūpaṃ manasā viññāta’’nti (dha. sa. 966) vacanato diṭṭhapadañca viññātapadañca rūpārammaṇe labbhati, rūpārammaṇaṃ iṭṭhaṃ aniṭṭhaṃ majjhattaṃ parittaṃ atītaṃ anāgataṃ paccuppannaṃ ajjhattaṃ bahiddhā diṭṭhaṃ viññātaṃ rūpaṃ rūpāyatanaṃ rūpadhātu vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītakanti evamādīhi anekehi nāmehi.

According to the terms that are obtainable means that according to the statement, "The visual object is seen, the auditory object is heard, the olfactory object, the gustatory object, the tactile object are perceived, all form is cognized by the mind," (Dhs. 966) the terms 'seen' and 'cognized' are obtainable in relation to the visual object, and the visual object is described by many names such as desirable, undesirable, neutral, subtle, past, future, present, internal, external, seen, cognized, form, rūpāyatana, rūpadhātu, appearance, lustre, with manifestation, with impingement, blue, yellow, and so forth.

Theo các từ có thể có (Labbhamānakapadavasenā): theo câu “Sắc xứ đã được thấy, thanh xứ đã được nghe, hương xứ, vị xứ, xúc xứ đã được biết, tất cả sắc đã được tâm nhận biết” (Dhs. 966), từ “thấy” và từ “nhận biết” được dùng cho đối tượng sắc. Đối tượng sắc là dễ chịu, khó chịu, trung tính, nhỏ nhặt, quá khứ, vị lai, hiện tại, nội, ngoại, đã được thấy, đã được nhận biết, sắc, sắc xứ, sắc giới, màu sắc, vẻ ngoài, có thể thấy, có đối kháng, xanh, vàng, v.v., bởi nhiều tên gọi như thế.

343

Terasahi vārehīti rūpakaṇḍe (dha. sa. 616) āgate terasa niddesavāre sandhāyāha.

By the thirteen methods refers to the thirteen methods of exposition mentioned in the section on form (Dhs. 616).

Với mười ba cách (Terasahi vārehī): điều này ám chỉ mười ba cách trình bày được đề cập trong phần sắc (Dhs. 616).

Ekekasmiñca vāre catunnaṃ catunnaṃ vavatthāpananayānaṃ vasena ‘‘dvepaññāsāya nayehī’’ti āha.

And within each method, in terms of the four ways of determining, he says, “by fifty-two methods.”

Và trong mỗi cách, theo bốn phương pháp xác định, Ngài nói “với năm mươi hai phương pháp”.

Tathameva aviparītadassitāya appaṭivattiyadesanatāya ca.

In the same way means by showing it without perversion and by teaching it without deviation.

Cũng vậy (Tathameva): bởi sự thấy không sai khác và sự thuyết giảng không thay đổi.

‘‘Jānāmi abhiññāsi’’nti vattamānātītakālesu ñāṇappavattidassanena anāgatepi ñāṇappavatti vuttāyevāti daṭṭhabbā.

It should be understood that by showing the operation of knowledge in the present and past with "I know, I have comprehended," the operation of knowledge in the future is also stated.

“Tôi biết, tôi đã liễu tri (Jānāmi abhiññāsi)”: cần hiểu rằng bằng cách trình bày sự vận hành của trí tuệ trong thì hiện tại và quá khứ, sự vận hành của trí tuệ trong tương lai cũng đã được nói đến.

Vidita-saddo anāmaṭṭhakālaviseso veditabbo ‘‘diṭṭhaṃ sutaṃ muta’’ntiādīsu (dha. sa. 966) viya.

The word 'known' (vidita) should be understood as a specific time unmarked, as in "seen, heard, perceived," etc. (Dhs. 966).

Từ “đã biết (vidita)” cần được hiểu là một khoảng thời gian không được đề cập cụ thể, giống như trong “thấy, nghe, biết” (Dhs. 966), v.v.

Na upaṭṭhāsīti attattaniyavasena na upagacchi.

It did not stand forth means it did not approach in terms of self or belonging to self.

Không phát sinh (Na upaṭṭhāsī): không phát sinh theo nghĩa thuộc về tự ngã.

Yathā rūpārammaṇādayo dhammā yaṃsabhāvā yaṃpakārā ca, tathā ne passati jānāti gacchatīti tathāgatoti evaṃ padasambhavo veditabbo.

The origin of the word Tathāgata should be understood thus: because he sees, knows, and proceeds according to the nature and manner of phenomena such as visual objects.

Giống như các pháp như đối tượng sắc có bản chất và phương thức như thế nào, Ngài thấy, biết và đến với chúng như thế đó, nên cần hiểu từ Tathāgata có nguồn gốc như vậy.

Keci pana ‘‘niruttinayena pisodarādipakkhepena (pāṇini 6.3.109) vā dassi-saddassa lopaṃ, āgata-saddassa cāgamaṃ katvā tathāgato’’ti vaṇṇenti.

Some commentators, however, explain ‘Tathāgata’ by omitting the word ‘dassi’ and appending ‘āgata’, according to the science of etymology, or by the method of Pisodarādi (Pāṇini 6.3.109).

Một số người khác lại giải thích Tathāgata bằng cách lược bỏ từ “dassi” và thêm từ “āgata” theo quy tắc ngữ nguyên (niruttinaya) hoặc theo cách của nhóm pisodarādi (Pāṇini 6.3.109).

344

Niddosatāya anupavajjaṃ.

Unblameworthy due to being faultless.

Không có lỗi, nên không đáng chê trách (anupavajjaṃ).

Pakkhipitabbābhāvena anūnaṃ.

Not deficient due to the absence of anything to be added.

Không có gì để thêm vào, nên không thiếu (anūnaṃ).

Apanetabbābhāvena anadhikaṃ.

Not excessive due to the absence of anything to be removed.

Không có gì để loại bỏ, nên không thừa (anadhikaṃ).

Atthabyañjanādisampattiyā sabbākāraparipuṇṇaṃ.

Complete in all aspects due to the perfection of meaning, expression, etc.

Hoàn hảo về mọi mặt (sabbākāraparipuṇṇaṃ) nhờ sự đầy đủ về ý nghĩa và văn tự.

No aññathāti ‘‘tathevā’’ti vuttamevatthaṃ byatirekena sampādeti.

Not otherwise completes the meaning expressed as "just so" by way of antithesis.

Không khác (No aññathā): điều này khẳng định ý nghĩa đã được nói là “cũng vậy” bằng cách phủ định.

Tena yadatthaṃ bhāsitaṃ, ekantena tadatthanipphādanato yathā bhāsitaṃ bhagavatā, tathevāti aviparītadesanataṃ dasseti.

Thereby, it shows the unperverted nature of the teaching, in that what was spoken by the Blessed One unfailingly produced that meaning, just as it was spoken.

Do đó, vì điều đã được nói hoàn toàn đạt được mục đích đó, nên điều Ngài đã nói là như vậy, Ngài trình bày sự giảng dạy không sai khác.

Gadaatthoti etena tathaṃ gadatīti tathāgatoti da-kārassa ta-kāro kato niruttinayenāti dasseti.

The meaning of ‘gada’ shows that in the phrase ‘he speaks truly’ (tathaṃ gadati), the ‘da’ has been changed to ‘ta’ to form Tathāgata, according to the rules of etymology.

Ý nghĩa của lời nói (Gadaattho): điều này cho thấy rằng “Ngài nói đúng sự thật (tathaṃ gadatī) nên là Tathāgata”, chữ “da” đã được đổi thành chữ “ta” theo quy tắc ngữ nguyên.

345

Tathā gatamassāti tathāgato.

He whose going is thus, is Tathāgata.

Ngài đã đi như vậy, nên là Tathāgata.

Gatanti ca kāyavācāpavattīti attho.

And going means the activity of body and speech.

Và đi (Gata) có nghĩa là sự vận hành của thân và khẩu.

Tathāti ca vutte yaṃtaṃsaddānaṃ abyabhicārisambandhitāya yathāti ayamattho upaṭṭhitoyeva hoti, kāyavacīkiriyānañca aññamaññānulomena vacanicchāyaṃ kāyassa vācā, vācāya ca kāyo sambandhībhāvena upatiṭṭhatīti imamatthaṃ dassento āha ‘‘bhagavato hī’’tiādi.

And when ‘thus’ is stated, the meaning ‘as’ is implicitly understood due to the unfailing connection between ‘that’ and ‘which’; and showing this meaning, that in the desire for words to be in harmony with bodily actions and vice versa, the body relates to speech and speech relates to the body, he says, “For the Blessed One,” and so forth.

Và khi nói “như vậy (Tathā)”, ý nghĩa “như thế nào” tự nó xuất hiện do mối liên hệ không sai lạc của các đại từ “cái đó” và “cái này”. Và khi muốn nói về sự tương ứng giữa hành động của thân và lời nói, thân và lời nói trở thành mối liên hệ của nhau; trình bày ý nghĩa này, Ngài nói “vì của Đức Thế Tôn”, v.v.

Imasmiṃ pana atthe tathāvādītāya tathāgatoti ayampi attho siddho hoti.

In this sense, by being a speaker of truth, this meaning of Tathāgata is also established.

Trong ý nghĩa này, bởi sự nói như vậy, ý nghĩa Tathāgata này cũng được thành lập.

So pana pubbe pakārantarena dassitoti āha ‘‘evaṃ tathākāritāya tathāgato’’ti.

But since that was shown earlier by another aspect, he says, “Thus, by acting truly, he is Tathāgata.”

Nhưng điều đó đã được trình bày theo một cách khác trước đây, nên Ngài nói “như vậy, bởi sự hành động như thế, nên là Tathāgata”.

346

Tiriyaṃ aparimāṇāsu lokadhātūsūti etena yadeke ‘‘tiriyaṃ viya upari adho ca santi lokadhātuyo’’ti vadanti, taṃ paṭisedheti.

In innumerable world-systems in the horizontal direction—by this, he refutes those who say that world-systems exist horizontally, as well as vertically above and below.

Trong các thế giới vô lượng theo chiều ngang (Tiriyaṃ aparimāṇāsu lokadhātūsu): điều này bác bỏ quan điểm của một số người nói rằng “có các thế giới theo chiều ngang cũng như chiều trên và chiều dưới”.

Desanāvilāsoyeva desanāvilāsamayo yathā ‘‘puññamayaṃ, dānamaya’’ntiādīsu.

Desanāvilāsamayo (consisting of the beauty of teaching) is simply the beauty of teaching, as in "consisting of merit, consisting of giving," etc.

Chính sự phong phú của lời dạy là sự phong phú của lời dạy (desanāvilāsamayo), giống như trong “do phước (puññamayaṃ), do bố thí (dānamayaṃ)”, v.v.

347

Nipātānaṃ vācakasaddasannidhāne tadatthajotanabhāvena pavattanato gata-saddoyeva avagatatthaṃ atītatthañca vadatīti āha ‘‘gatoti avagato atīto’’ti.

Since particles operate by expressing their meaning in the presence of the word they qualify, the word ‘gata’ itself expresses both the meaning of ‘understood’ and ‘past,’ so he says, “‘Gata’ means understood, past.”

Vì các giới từ (nipāta) hoạt động bằng cách làm rõ ý nghĩa khi có mặt các từ biểu thị ý nghĩa đó, nên chính từ “gata” nói lên ý nghĩa đã hiểu và ý nghĩa quá khứ; do đó, Ngài nói “gata có nghĩa là đã hiểu, đã qua”.

348

Atha vā abhinīhārato paṭṭhāya yāva sammāsambodhi, etthantare mahābodhiyānapaṭipattiyā hānaṭṭhānasaṃkilesanivattīnaṃ abhāvato yathā paṇidhānaṃ, tathā gato abhinīhārānurūpaṃ paṭipannoti tathāgato.

Alternatively, from the time of his aspiration up to perfect enlightenment, in this interval, there was no regression, defilement, or cessation in his practice of the path to great enlightenment; thus, he proceeded in accordance with his aspiration, he practiced in conformity with his aspiration, and so he is Tathāgata.

Hoặc, từ khi phát nguyện (abhinīhāra) cho đến Chánh Đẳng Giác, trong khoảng thời gian này, do không có sự suy giảm, sự ô nhiễm, và sự dừng lại trong con đường Bồ Đề vĩ đại, Ngài đã đi theo đúng lời nguyện, đã thực hành phù hợp với sự phát nguyện, nên là Tathāgata.

Atha vā mahiddhikatāya paṭisambhidānaṃ ukkaṃsādhigamena anāvaraṇañāṇatāya ca katthacipi paṭighātābhāvato yathā ruci, tathā kāyavacīcittānaṃ gatāni gamanāni pavattiyo etassāti tathāgato.

Alternatively, because of his great power, the supreme attainment of analytical knowledge (paṭisambhidā), and his unobstructed knowledge, there is no impediment anywhere; thus, he is Tathāgata because the goings (movements) and activities of his body, speech, and mind are as he wishes.

Hoặc, do thần thông lớn, với sự chứng đắc tối thượng các tuệ phân tích (paṭisambhidā) và do trí vô ngại (anāvaraṇañāṇa), không có sự ngăn trở ở bất cứ đâu, nên các hành vi (gatāni), sự đi lại (gamanāni) và sự vận hành (pavattiyo) của thân, khẩu, ý của vị ấy đều tùy theo ý muốn. Vì vậy, vị ấy là Tathāgata.

Yasmā ca loke vidha-yutta-gata-ppakāra-saddā samānatthā dissanti.

And because in the world, the words vidha (kind), yutta (appropriate), gata (gone), and ppakāra (manner) are seen to be synonymous.

Và vì trong đời, các từ như vidha, yutta, gata và ppakāra được thấy là có cùng nghĩa.

Tasmā yathāvidhā vipassīādayo bhagavanto, ayampi bhagavā tathāvidhoti tathāgato, yathāyuttā ca te bhagavanto, ayampi bhagavā tathāyuttoti tathāgato.

Therefore, just as the Buddhas Vipassī and others were of a certain kind, so too is this Buddha of that kind, hence Tathāgata; and just as those Buddhas were appropriate, so too is this Buddha appropriate, hence Tathāgata.

Do đó, như các Đức Thế Tôn Vipassī và các vị khác đã đạt đến trạng thái (yathāvidhā), Đức Thế Tôn này cũng đã đạt đến trạng thái ấy (tathāvidho), nên Ngài là Tathāgata. Và như các Đức Thế Tôn ấy đã được kết hợp (yathāyuttā), Đức Thế Tôn này cũng được kết hợp (tathāyutto), nên Ngài là Tathāgata.

Atha vā yasmā saccaṃ tacchaṃ tathanti ñāṇassetaṃ adhivacanaṃ, tasmā tathena ñāṇena āgatoti tathāgato.

Alternatively, since "tatha" is a designation for knowledge that is true and factual, therefore, he who has come by true knowledge is Tathāgata.

Hoặc, vì chân lý (saccaṃ), sự thật (tacchaṃ) và sự như thật (tathaṃ) là những từ đồng nghĩa với trí tuệ, do đó, vị ấy đã đến bằng trí tuệ như thật (tathena ñāṇena āgato), nên Ngài là Tathāgata.

Evampi tathāgata-saddassa attho veditabbo.

Thus also should the meaning of the word Tathāgata be understood.

Ý nghĩa của từ Tathāgata cũng nên được hiểu như vậy.

349

Pahāya kāmādimale yathā gatā,

Having abandoned defilements such as sensual pleasures, just as Vipassī and others,

Sau khi đoạn trừ các cấu uế như dục, như các bậc Đại Hiền Vipassī và các vị khác đã đạt đến,

350

Samādhiñāṇehi vipassiādayo;

The great sages, the Sakyan Sage, the radiant one, by means of concentration and knowledge,

Với thiền định và trí tuệ, Đức Thích Ca Mâu Ni, bậc có hào quang rực rỡ,

351

Mahesino sakyamunī jutindharo,

Went thus; therefore, he is considered Tathāgata.

Đã đi đến như vậy, vì thế Ngài được xem là Tathāgata.

352

Tathā gato tena mato tathāgato.

And the characteristic of elements, sense bases, etc., is thus.

Ngài là vị Tathāgata.

353

Tathañca dhātāyatanādilakkhaṇaṃ,

And the characteristic of elements, sense bases, etc., is thus.

Và những pháp như thật mang đặc tính của các giới, xứ, v.v.,

354

Sabhāvasāmaññavibhāgabhedato;

Due to the distinction of individual and common characteristics;

Do sự phân biệt về tự tính, tính phổ biến và sự sai biệt,

355

Sayambhuñāṇena jino samāgato,

The Conqueror, endowed with self-arisen knowledge,

Đức Chiến Thắng đã đạt đến bằng trí tuệ tự sinh,

356

Tathāgato vuccati sakyapuṅgavo.

The Sakyan Bull is called Tathāgata.

Bậc tối thắng của dòng Sakya được gọi là Tathāgata.

357

Tathāni saccāni samantacakkhunā,

And such truths, with the all-seeing eye,

Và những chân lý như thật,

358

Tathā idappaccayatā ca sabbaso;

And such dependent origination in every way;

Và sự duyên khởi này trong mọi phương diện,

359

Anaññaneyyena yato vibhāvitā,

Since they were made clear by him, needing no other guidance,

Vì đã được Ngài hiển bày bằng trí tuệ không cần ai dẫn dắt,

360

Yāthāvato tena jino tathāgato.

Therefore, the Conqueror is Tathāgata in reality.

Do đó, Đức Chiến Thắng là Tathāgata một cách chân thật.

361

Anekabhedāsupi lokadhātusu,

Even in world-systems of various kinds,

Ngay cả trong vô số cõi giới khác nhau,

362

Jinassa rūpāyatanādigocare;

In the sphere of the Conqueror's sense objects like visible forms;

Trong phạm vi đối tượng của Đức Chiến Thắng như sắc, xứ, v.v.,

363

Vicitrabhedaṃ tathameva dassanaṃ,

The seeing is likewise of diverse kinds,

Sự thấy biết cũng đa dạng và như thật,

364

Tathāgato tena samantalocano.

Therefore, the Tathāgata has an all-seeing eye.

Do đó, Ngài là Tathāgata, bậc có mắt toàn diện.

365

Yato ca dhammaṃ tathameva bhāsati,

And since he teaches the Dhamma just as it is,

Và vì Ngài thuyết pháp như thật,

366

Karoti vācāyanulomamattano;

And his speech accords with himself;

Lời nói của Ngài phù hợp với chính Ngài,

367

Guṇehi lokaṃ abhibhuyyirīyati,

He moves about, overcoming the world with his virtues,

Ngài vượt trội thế gian bằng các đức tính của mình,

368

Tathāgato tenapi lokanāyako.

Therefore, the Tathāgata is also the leader of the world.

Do đó, Ngài là Tathāgata và là vị lãnh đạo thế gian.

369

Yathābhinīhāramato yathāruci,

According to his aspiration, according to his wish,

Như sự phát nguyện của Ngài, như ý muốn của Ngài,

370

Pavattavācā tanucittabhāvato;

Due to his developed speech and purified mind;

Lời nói và tâm của Ngài vận hành,

371

Yathāvidhā yena purā mahesino,

As the great sage was previously, in that manner,

Như các bậc Đại Hiền đã hành trước đây,

372

Tathāvidho tena jino tathāgatoti.(itivu. aṭṭha. 38; dī. ni. ṭī. 1.7 cūḷasīlavaṇṇanā);

Therefore, the Conqueror is Tathāgata in that manner.

Đức Chiến Thắng cũng như vậy, do đó Ngài là Tathāgata. (Itivu. aṭṭha. 38; Dī. Ni. ṭī. 1.7 Cūḷasīlavaṇṇanā)

373

Ārakattātiādīnaṃ padānaṃ attho visuddhimagge (visuddhi. 1.125) buddhānussatisaṃvaṇṇanāya vuttanayeneva veditabbo.

The meaning of terms such as Ārakattā is to be understood in the manner stated in the commentary on the recollection of the Buddha in the Visuddhimagga.

Ý nghĩa của các từ như Ārakattā v.v. nên được hiểu theo cách đã nói trong phần giải thích về Phật tùy niệm trong Thanh Tịnh Đạo (Visuddhi. 1.125).

Sammā sāmañca sabbadhammānaṃ buddhattāti imināssa paropadesarahitassa sabbākārena sabbadhammāvabodhanasamatthassa ākaṅkhāpaṭibaddhavuttino anāvaraṇañāṇasaṅkhātassa sabbaññutaññāṇassa adhigamo dassito.

By "Because of the perfect and complete enlightenment regarding all phenomena," is shown the attainment of omniscience (sabbaññutaññāṇa), which is called unobstructed knowledge (anāvaraṇañāṇa), capable of comprehending all phenomena in every way, without external instruction, and whose occurrence is bound by aspiration.

Với câu "Do tự mình giác ngộ tất cả các pháp một cách chân chánh", đã chỉ ra sự chứng đắc của trí tuệ toàn tri (sabbaññutaññāṇa), tức là trí vô ngại (anāvaraṇañāṇa), có khả năng thấu hiểu tất cả các pháp trong mọi phương diện mà không cần sự hướng dẫn của người khác, và có sự vận hành không bị giới hạn bởi mong muốn.

374

Nanu ca (itivu. aṭṭha. 38) sabbaññutaññāṇato aññaṃ anāvaraṇañāṇaṃ, aññathā cha asādhāraṇañāṇāni buddhañāṇānīti vacanaṃ virujjheyyāti?

But is not unobstructed knowledge different from omniscience, otherwise the statement that the six uncommon knowledges are Buddha-knowledges would be contradictory?

Há chẳng phải trí vô ngại là khác với trí toàn tri sao? Nếu không, lời nói rằng sáu trí bất cộng là Phật trí sẽ mâu thuẫn chăng?

Na virujjhati visayappavattibhedavasena aññehi asādhāraṇañāṇabhāvadassanatthaṃ ekasseva ñāṇassa dvidhā vuttattā.

There is no contradiction, as the same knowledge is stated in two ways to show its uncommon knowledge aspect due to the distinction in the sphere of its operation.

Không mâu thuẫn, vì cùng một trí tuệ đã được nói đến theo hai cách, để chỉ ra sự bất cộng với các trí khác do sự khác biệt trong phạm vi vận hành.

Ekameva hi taṃ ñāṇaṃ anavasesasaṅkhatāsaṅkhatasammutidhammavisayatāya sabbaññutaññāṇaṃ, tattha ca āvaraṇābhāvato nissaṅgacāramupādāya anāvaraṇañāṇanti vuttaṃ.

Indeed, that one knowledge is omniscience because its domain encompasses all conditioned, unconditioned, and conventional phenomena without remainder; and it is called unobstructed knowledge because there is no obstruction therein, leading to its unimpeded operation.

Thật vậy, trí tuệ ấy là trí toàn tri (sabbaññutaññāṇa) vì nó có đối tượng là tất cả các pháp hữu vi, vô vi và tục đế mà không còn sót lại. Và vì không có sự ngăn che trong đó, nên nó được gọi là trí vô ngại (anāvaraṇañāṇa) do sự vận hành không bị vướng mắc.

Yathāha paṭisambhidāyaṃ (paṭi. ma. 1.119) ‘‘sabbaṃ saṅkhatāsaṅkhatamanavasesaṃ jānātīti sabbaññutaññāṇaṃ, tatthāvaraṇaṃ natthīti anāvaraṇañāṇa’’ntiādi, tasmā natthi nesaṃ atthato bhedo, ekantena cetaṃ evamicchitabbaṃ, aññathā sabbaññutānāvaraṇañāṇānaṃ sāvaraṇatā asabbadhammārammaṇatā ca āpajjeyya.

As stated in the Paṭisambhidā (Paṭi. Ma. 1.119), "It knows all conditioned and unconditioned phenomena without remainder, hence it is omniscience; there is no obstruction therein, hence it is unobstructed knowledge," and so on. Therefore, there is no essential difference between them, and this must be accepted unequivocally, otherwise omniscience and unobstructed knowledge would become obstructed and not encompass all phenomena.

Như đã nói trong Paṭisambhidā (Paṭi. Ma. 1.119): "Biết tất cả các pháp hữu vi và vô vi một cách không sót lại, đó là trí toàn tri (sabbaññutaññāṇa); không có sự ngăn che trong đó, đó là trí vô ngại (anāvaraṇañāṇa)", v.v. Do đó, về mặt ý nghĩa, chúng không có sự khác biệt. Điều này phải được chấp nhận một cách tuyệt đối, nếu không, trí toàn tri và trí vô ngại sẽ trở nên có sự ngăn che và không phải là đối tượng của tất cả các pháp.

Na hi bhagavato ñāṇassa aṇumatampi āvaraṇaṃ atthi, anāvaraṇañāṇassa ca asabbadhammārammaṇabhāve yattha taṃ nappavattati, tatthāvaraṇasabbhāvato anāvaraṇabhāvoyeva na siyā.

For there is not even an atom of obstruction in the knowledge of the Blessed One; and if unobstructed knowledge did not encompass all phenomena, then where it did not operate, there would be obstruction, and thus it would not be unobstructed.

Thật vậy, trí tuệ của Đức Thế Tôn không có một chút ngăn che nào. Và nếu trí vô ngại không phải là đối tượng của tất cả các pháp, thì ở nơi nào nó không vận hành, do có sự ngăn che ở đó, nó sẽ không còn là vô ngại nữa.

Atha vā pana hotu aññameva anāvaraṇañāṇaṃ sabbaññutaññāṇato, idha pana sabbattha appaṭihatavuttitāya anāvaraṇañāṇanti sabbaññutaññāṇameva adhippetaṃ, tassa cādhigamena bhagavā sabbaññū sabbavidū sammāsambuddhoti ca vuccati, na sakimeva sabbadhammāvabodhato.

Or, let unobstructed knowledge indeed be different from omniscience; but here, omniscience itself is intended by "unobstructed knowledge" due to its unimpeded operation everywhere, and by its attainment, the Blessed One is called omniscient, all-knowing, and perfectly self-enlightened, not by a single, instantaneous comprehension of all phenomena.

Hoặc, có thể trí vô ngại là khác với trí toàn tri, nhưng ở đây, trí toàn tri được hiểu là trí vô ngại vì nó có sự vận hành không bị ngăn trở ở mọi nơi. Và do sự chứng đắc trí tuệ ấy, Đức Thế Tôn được gọi là Toàn Tri (Sabbaññū), Toàn Giác (Sabbavidū) và Chánh Đẳng Chánh Giác (Sammāsambuddha), chứ không phải do giác ngộ tất cả các pháp cùng một lúc.

Tathā ca vuttaṃ paṭisambhidāyaṃ (paṭi. ma. 1.162) ‘‘vimokkhantikametaṃ buddhānaṃ bhagavantānaṃ bodhiyā mūle saha sabbaññutaññāṇassa paṭilābhā sacchikā paññatti yadidaṃ buddho’’ti.

And as stated in the Paṭisambhidā (Paṭi. Ma. 1.162), "This is a true designation leading to liberation for the Buddhas, the Blessed Ones, at the foot of the Bodhi tree, upon the attainment of omniscience, namely, 'Buddha'."

Và như đã nói trong Paṭisambhidā (Paṭi. Ma. 1.162): "Đây là một sự quy định chân thật về sự giải thoát của các Đức Phật Thế Tôn, do sự chứng đắc trí toàn tri dưới cội Bồ đề, đó là Phật."

Sabbadhammāvabodhanasamatthañāṇasamadhigamena hi bhagavato santāne anavasesadhamme paṭivijjhituṃ samatthatā ahosīti.

For by the attainment of knowledge capable of comprehending all phenomena, the Blessed One's mental continuum became capable of penetrating all phenomena without remainder.

Thật vậy, do sự chứng đắc trí tuệ có khả năng giác ngộ tất cả các pháp, trong dòng tâm thức của Đức Thế Tôn đã có khả năng thấu suốt tất cả các pháp một cách không sót lại.

375

Etthāha – kiṃ panidaṃ ñāṇaṃ pavattamānaṃ sakiṃyeva sabbasmiṃ visaye pavattati, udāhu kamenāti.

Here it is asked: Does this knowledge, when it operates, operate on all objects simultaneously, or gradually?

Ở đây, có người hỏi: "Vậy trí tuệ này khi vận hành, là vận hành trên tất cả các đối tượng cùng một lúc, hay tuần tự?"

Kiñcettha – yadi tāva sakiṃyeva sabbasmiṃ visaye pavattati, atītānāgatapaccuppannaajjhattabahiddhādibhedena bhinnānaṃ saṅkhatadhammānaṃ asaṅkhatasammutidhammānañca ekajjhaṃ upaṭṭhāne dūrato cittapaṭaṃ avekkhantassa viya paṭivibhāgenāvabodho na siyā, tathā ca sati ‘‘sabbe dhammā anattā’’ti vipassantānaṃ anattākārena viya sabbe dhammā anirūpitarūpena bhagavato ñāṇassa visayā hontīti āpajjati.

And what is the consequence here? If it operates on all objects simultaneously, then there would be no distinct comprehension of conditioned phenomena, divided into past, future, present, internal, external, etc., and also unconditioned and conventional phenomena, when they are presented together, as if one were looking at a distant canvas. And if that were the case, it would follow that all phenomena would be objects of the Blessed One's knowledge in an undifferentiated manner, just as for those who contemplate "all phenomena are non-self," they are seen in the aspect of non-self.

Và điều gì sẽ xảy ra ở đây? Nếu nó vận hành trên tất cả các đối tượng cùng một lúc, thì khi các pháp hữu vi đã chia thành quá khứ, vị lai, hiện tại, nội tại, ngoại tại, v.v., và các pháp vô vi, tục đế cùng hiện hữu một lúc, sẽ không có sự thấu hiểu phân biệt, giống như khi nhìn một bức tranh từ xa. Và như vậy, sẽ xảy ra trường hợp tất cả các pháp trở thành đối tượng của trí tuệ của Đức Thế Tôn dưới một hình thái không rõ ràng, giống như khi những người quán "tất cả các pháp là vô ngã" thấy chúng dưới hình thái vô ngã.

Yepi ‘‘sabbañeyyadhammānaṃ ṭhitalakkhaṇavisayaṃ vikapparahitaṃ sabbakālaṃ buddhānaṃ ñāṇaṃ pavattati, tena te sabbavidūti vuccanti.

And those who say, "The knowledge of the Buddhas operates at all times, free from conceptualization, concerning the established characteristics of all knowable phenomena, and therefore they are called all-knowing.

Ngay cả những người nói rằng: "Trí tuệ của chư Phật vận hành liên tục, không phân biệt, với đối tượng là đặc tính cố định của tất cả các pháp nên biết, do đó các Ngài được gọi là toàn tri.

Evañca katvā ‘caraṃ samāhito nāgo, tiṭṭhantopi samāhito’ti idampi vacanaṃ suvuttaṃ hotī’’ti vadanti, tesampi vuttadosānativatti.

And having done so, they say, "The saying 'the Nāga is composed when walking, composed even when standing' is well-said," but even for them, the aforementioned fault is not overcome.

Và khi làm như vậy, lời nói 'vị Long tượng đi thì chánh niệm, đứng cũng chánh niệm' cũng được nói đúng", thì những khuyết điểm đã nói vẫn không được vượt qua.

Ṭhitalakkhaṇārammaṇatāya hi atītānāgatasammutidhammānaṃ tadabhāvato ekadesavisayameva bhagavato ñāṇaṃ siyā, tasmā sakiṃyeva ñāṇaṃ pavattatīti na yujjati.

For if the knowledge of the Blessed One were only concerned with a single aspect, due to its object being a fixed characteristic and the absence of such characteristics in past, future, and conventional phenomena, then it would not be appropriate to say that knowledge arises only once.

Thật vậy, nếu đối tượng là đặc tính cố định, thì các pháp quá khứ, vị lai và tục đế không có đặc tính đó, nên trí tuệ của Đức Thế Tôn sẽ chỉ là đối tượng của một phần. Do đó, việc nói rằng trí tuệ vận hành cùng một lúc là không hợp lý.

376

Atha kamena sabbasmiṃ visaye ñāṇaṃ pavattati, evampi na yujjati.

If, however, knowledge arises gradually in all spheres, even this is not appropriate.

Nếu trí tuệ vận hành tuần tự trên tất cả các đối tượng, điều đó cũng không hợp lý.

Na hi jātibhūmisabhāvādivasena disādesakālādivasena ca anekabhedabhinne neyye kamena gayhamāne tassa anavasesapaṭivedho sambhavati apariyantabhāvato ñeyyassa.

For when the knowable, which is divided into many kinds according to birth, plane of existence, nature, etc., and according to directions, places, times, etc., is grasped gradually, its complete penetration is not possible due to the infinitude of the knowable.

Vì các pháp nên biết có vô số loại, khác biệt về chủng loại, cõi giới, tự tính, v.v., và về phương hướng, địa điểm, thời gian, v.v., nên nếu được nắm bắt tuần tự, sự thấu suốt không sót lại sẽ không thể xảy ra vì các pháp nên biết là vô tận.

Ye pana ‘‘atthassa avisaṃvādanato ñeyyassa ekadesaṃ paccakkhaṃ katvā sesepi evanti adhimuccitvā vavatthāpanena sabbaññū bhagavā, tañca ñāṇaṃ ananumānikaṃ saṃsayābhāvato.

But those who say, "The Blessed One is omniscient by directly perceiving a part of the knowable and then determining the rest as 'thus' by inferring from the non-deception of the fact, and that knowledge is not inferential because there is no doubt.

Những người nói rằng: "Đức Thế Tôn là toàn tri vì Ngài đã trực tiếp chứng kiến một phần của các pháp nên biết và sau đó suy luận rằng phần còn lại cũng như vậy, do sự không sai lệch của ý nghĩa, và trí tuệ đó không phải là suy luận vì không có sự nghi ngờ.

Saṃsayānubandhañhi loke anumānañāṇa’’nti vadanti, tesampi taṃ na yuttaṃ.

For inferential knowledge in the world is accompanied by doubt," even for them, that is not appropriate.

Vì trong đời, trí tuệ suy luận là trí tuệ gắn liền với sự nghi ngờ", thì lời nói của họ cũng không đúng.

Sabbassa hi appaccakkhabhāve atthassa avisaṃvādanena ñeyyassa ekadesaṃ paccakkhaṃ katvā sesepi evanti adhimuccitvā vavatthāpanassa asambhavato.

For if everything is not directly perceived, it is impossible to determine the rest as 'thus' by inferring from the non-deception of the fact, having directly perceived a part of the knowable.

Vì nếu tất cả đều không được trực tiếp chứng kiến, thì việc trực tiếp chứng kiến một phần của các pháp nên biết và sau đó suy luận rằng phần còn lại cũng như vậy, do sự không sai lệch của ý nghĩa, là không thể xảy ra.

Yañhi taṃ sesaṃ, taṃ appaccakkhanti.

For that 'rest' is not directly perceived.

Vì cái còn lại đó là không được trực tiếp chứng kiến.

Atha tampi paccakkhaṃ, tassa sesabhāvo eva na siyāti?

If that too is directly perceived, then it would not be 'the rest', would it?

Nếu cái đó cũng được trực tiếp chứng kiến, thì nó sẽ không còn là phần còn lại nữa chăng?

Sabbametaṃ akāraṇaṃ.

All of this is baseless.

Tất cả những điều này đều vô lý.

Kasmā?

Why?

Tại sao?

Avisayavicāraṇabhāvato.

Because it is a consideration of what is beyond the scope.

Vì đó là sự suy xét về điều không phải là đối tượng.

Vuttañhetaṃ bhagavatā ‘‘buddhavisayo bhikkhave, acinteyyo na cintetabbo, yo cinteyya, ummādassa vighātassa bhāgī assā’’ti (a. ni. 4.77).

For it has been said by the Blessed One: "The domain of the Buddhas, bhikkhus, is inconceivable, it should not be conceived; whoever conceives it would be a partaker of madness and vexation."

Đức Thế Tôn đã nói: "Này các Tỳ-kheo, phạm vi của chư Phật là điều không thể nghĩ bàn, không nên suy nghĩ. Ai suy nghĩ về điều đó sẽ trở thành người điên hoặc bị tổn hại" (A. Ni. 4.77).

Idaṃ panettha sanniṭṭhānaṃ – yaṃ kiñci bhagavatā ñātuṃ icchitaṃ sakalamekadeso vā, tattha appaṭihatavuttitāya paccakkhato ñāṇaṃ pavattati, niccasamādhānañca vikkhepābhāvato, ñātuṃ icchitassa ca sakalassa avisayabhāve tassa ākaṅkhāpaṭibaddhavuttitā na siyā, ekanteneva ca sā icchitabbā ‘‘sabbe dhammā buddhassa bhagavato āvajjanapaṭibaddhā ākaṅkhapaṭibaddhā manasikārapaṭibaddhā cittuppādapaṭibaddhā’’ti (mahāni. 69, 156; cūḷani. 85; paṭi. ma. 3.5) vacanato.

This is the conclusion here: whatever the Blessed One wishes to know, whether in its entirety or in part, knowledge arises directly, with unhindered progress, and with constant concentration due to the absence of distraction. If what is desired to be known in its entirety were not an object of knowledge, then its occurrence would not be bound by desire. And it is certainly to be desired, as it is said: "All phenomena are dependent on the Buddha, the Blessed One's attention, dependent on his aspiration, dependent on his mental application, dependent on his thought-arising."

Đây là kết luận ở đây – bất cứ điều gì Đức Thế Tôn muốn biết, dù toàn bộ hay một phần, thì trí tuệ của Ngài vận hành một cách trực tiếp, không bị chướng ngại, và sự định tâm thường xuyên do không có tán loạn. Nếu toàn bộ những gì muốn biết không phải là đối tượng, thì sự vận hành của trí tuệ đó sẽ không bị ràng buộc bởi ước muốn. Và điều đó nhất định phải được ước muốn, bởi vì có lời dạy: “Tất cả các pháp của Đức Phật Thế Tôn đều bị ràng buộc bởi sự chú ý, bị ràng buộc bởi ước muốn, bị ràng buộc bởi sự tác ý, bị ràng buộc bởi sự khởi tâm.”

Atītānāgatavisayampi bhagavato ñāṇaṃ anumānāgamatakkagahaṇavirahitattā paccakkhameva.

The Blessed One's knowledge, even concerning past and future objects, is direct, being free from inference, tradition, or reasoning.

Trí tuệ của Đức Thế Tôn về quá khứ và vị lai cũng là trực tiếp, vì không bị vướng mắc bởi suy luận, kinh điển hay lý lẽ.

377

Nanu ca etasmimpi pakkhe yadā sakalaṃ ñātuṃ icchitaṃ, tadā sakiṃyeva sakalavisayatāya anirūpitarūpena bhagavato ñāṇaṃ pavatteyyāti vuttadosānativattiyevāti?

But is it not the case that even in this view, when the entirety is desired to be known, the Blessed One's knowledge would then arise all at once, in an unanalyzed form, and thus the aforementioned fault would not be overcome?

Nếu vậy, trong trường hợp này, khi toàn bộ được mong muốn biết, thì trí tuệ của Đức Thế Tôn sẽ vận hành ngay lập tức bao trùm toàn bộ đối tượng một cách không phân biệt, và lỗi đã nêu vẫn không được khắc phục ư?

Na, tassa visodhitattā.

No, because that has been clarified.

Không, vì điều đó đã được thanh lọc.

Visodhito hi so buddhavisayo acinteyyoti.

Indeed, that Buddha-domain has been clarified as inconceivable.

Thật vậy, đối tượng của Đức Phật là không thể nghĩ bàn đã được thanh lọc.

Aññathā pacurajanañāṇasamānavuttitāya buddhānaṃ bhagavantānaṃ ñāṇassa acinteyyatā na siyā, tasmā sakaladhammārammaṇampi taṃ ekadhammārammaṇaṃ viya suvavatthāpiteyeva te dhamme katvā pavattatīti idamettha acinteyyaṃ, anantañca ñāṇaṃ ñeyyaṃ viya.

Otherwise, the knowledge of the Buddhas, the Blessed Ones, would not be inconceivable, being similar in function to the knowledge of ordinary people. Therefore, even when that knowledge takes all phenomena as its object, it proceeds by placing those phenomena in good order, just like taking a single phenomenon as its object; this is what is inconceivable here, and knowledge is infinite, just like the knowable.

Nếu không, trí tuệ của các Đức Phật Thế Tôn sẽ không phải là không thể nghĩ bàn, vì nó sẽ vận hành tương tự như trí tuệ của đại đa số chúng sinh. Do đó, ngay cả khi trí tuệ ấy có đối tượng là tất cả các pháp, nó vẫn vận hành sau khi đã sắp xếp rõ ràng các pháp đó, giống như khi có đối tượng là một pháp duy nhất – đây là điều không thể nghĩ bàn ở đây, và trí tuệ là vô hạn, giống như đối tượng của trí tuệ.

Vuttañhetaṃ ‘‘yāvatakaṃ ñeyyaṃ, tāvatakaṃ ñāṇaṃ.

For it is said: "As far as the knowable extends, so far does knowledge extend.

Điều này đã được nói: “Đối tượng của trí tuệ bao nhiêu thì trí tuệ bấy nhiêu.

Yāvatakaṃ ñāṇaṃ, tāvatakaṃ ñeyyaṃ.

As far as knowledge extends, so far does the knowable extend.

Trí tuệ bao nhiêu thì đối tượng của trí tuệ bấy nhiêu.

Ñeyyapariyantikaṃ ñāṇaṃ, ñāṇapariyantikaṃ ñeyya’’nti (mahāni. 69, 156; cūḷani. 85; paṭi. ma. 3.5).

Knowledge is bounded by the knowable, the knowable is bounded by knowledge."

Trí tuệ có giới hạn là đối tượng của trí tuệ, đối tượng của trí tuệ có giới hạn là trí tuệ.”

Evamekajjhaṃ, visuṃ sakiṃ, kamena vā icchānurūpaṃ sammā sāmañca sabbadhammānaṃ buddhattā sammāsambuddho.

Thus, the Perfectly Self-Enlightened One is called sammāsambuddho because all phenomena are understood, known directly, simultaneously, separately, or successively, according to his wish.

Như vậy, do tự mình đã giác ngộ tất cả các pháp một cách đúng đắn, dù là đồng thời, riêng biệt, ngay lập tức hay tuần tự tùy theo ước muốn, nên Ngài là Sammāsambuddha (Chánh Đẳng Giác).

378

Tanti yathāvuttaṃ pathavīādibhedaṃ.

That refers to what has been said, categorized as earth and so on.

Đó là những gì đã nói, sự phân biệt như đất, v.v.

Pariññātanti parito samantato sabbākārato ñātaṃ, taṃ parijānitabbabhāvaṃ kiñci asesetvā ñātanti attho.

Fully understood means known completely, comprehensively, in all aspects, meaning that nothing to be fully understood remains unknown.

Đã liễu tri (pariññāta) nghĩa là đã biết một cách toàn diện, từ mọi phía, với mọi khía cạnh; nghĩa là đã biết không sót một chút gì cần phải liễu tri.

Ayameva hi attho ‘‘pariññātanta’’nti imināpi padena pakāsitoti dassento ‘‘pariññātantaṃ nāmā’’tiādimāha.

Indeed, this very meaning is revealed by the word " fully understood," and so he says, " What is meant by 'fully understood'" and so on.

Chỉ ra rằng ý nghĩa này cũng được diễn đạt bằng từ “pariññātaṃ”, nên Ngài nói “pariññātaṃ nāma” (gọi là đã liễu tri), v.v.

Tena tena maggena kilesappahānena viseso natthīti idaṃ taṃtaṃmaggavajjhakilesānaṃ buddhānaṃ sāvakānañca tena tena maggeneva pahātabbabhāvasāmaññaṃ sandhāya vuttaṃ, na sāvakehi buddhānaṃ kilesappahānavisesābhāvato.

The statement, " There is no distinction in the abandoning of defilements by this or that path," is said with reference to the common characteristic that the defilements to be eradicated by this or that path are to be abandoned by both Buddhas and disciples by that very path, not because there is no distinction in the abandonment of defilements between Buddhas and disciples.

Không có sự khác biệt trong việc đoạn trừ phiền não bằng con đường này, con đường kia, điều này được nói để chỉ sự tương đồng trong việc các phiền não cần được đoạn trừ bởi con đường này, con đường kia, đối với cả chư Phật và các đệ tử, chứ không phải do không có sự khác biệt trong việc đoạn trừ phiền não của chư Phật so với các đệ tử.

Tathā hi sammāsambuddhā eva savāsanakilese jahanti, na sāvakā.

Thus, only Perfectly Self-Enlightened Ones abandon defilements together with their latent tendencies, not disciples.

Thật vậy, chỉ có các vị Chánh Đẳng Giác mới đoạn trừ phiền não cùng với tùy miên (savāsana), chứ không phải các đệ tử.

Ekadesamevāti attano santānagatameva.

Only a part means what is within one's own continuity.

Chỉ một phần (ekadesameva) nghĩa là chỉ những gì thuộc về dòng tâm thức của chính mình.

Sasantatipariyāpannadhammapariññāmattenapi hi catusaccakammaṭṭhānabhāvanā samijjhati.

For even by fully understanding phenomena pertaining to one's own continuity, the cultivation of the four noble truths as a meditation object is accomplished.

Thật vậy, sự tu tập đề mục Tứ Thánh Đế cũng thành tựu chỉ bằng cách liễu tri các pháp thuộc về dòng tâm thức của chính mình.

Tenevāha – ‘‘imasmiṃyeva byāmamatte kaḷevare sasaññimhi samanake lokañca paññapemi lokasamudayañca paññapemī’’tiādi (saṃ. ni. 1.107; a. ni. 4.45).

Therefore, it is said: "In this very fathom-long body, with its perceptions and mind, I declare the world and the origin of the world," and so on.

Chính vì thế, Ngài đã nói: “Trong cái thân thể chỉ một tầm tay này, có tưởng, có ý, Ta tuyên bố thế giới, Ta tuyên bố tập khởi của thế giới,” v.v.

Aṇuppamāṇampi …pe… natthi, yato chattiṃsakoṭisatasahassamukhena buddhānaṃ mahāvajirañāṇaṃ pavattatīti vadanti.

Even a measure... there is not, for they say that the Buddhas' great vajra-knowledge proceeds through three hundred and sixty koṭis of paths.

Dù là nhỏ nhất… không có, vì người ta nói rằng Đại Kim Cang Trí của chư Phật vận hành với sáu mươi triệu trăm ngàn cửa.

379

Tathāgatavārasattamanayavaṇṇanā niṭṭhitā.

The commentary on the seventh mode of the Tathāgata section is concluded.

Phần giải thích phương pháp thứ bảy của Tathāgata đã hoàn tất.

380

Tathāgatavāraaṭṭhamanayavaṇṇanā

Commentary on the Eighth Mode of the Tathāgata Section

Giải thích phương pháp thứ tám của Tathāgata

381

13. Purimataṇhāti purimataresu bhavesu nibbattā paccuppannattabhāvahetubhūtā taṇhā.

13. Former craving means the craving that arose in previous existences and became the cause of the present existence.

13. Khát ái quá khứ (purimataṇhā) nghĩa là khát ái đã sinh khởi trong các kiếp quá khứ, là nguyên nhân của thân hữu hiện tại.

Taggahaṇeneva ca atītaddhasaṅgahā avijjāsaṅkhārā saddhiṃ upādānena saṅgahitāti daṭṭhabbā.

By taking it, avijjā and saṅkhārā are understood to be included, along with upādāna, encompassing the past dimension.

Và cần phải hiểu rằng, chỉ bằng cách nắm giữ nó, vô minh và hành, cùng với thủ, đã được bao gồm trong thời quá khứ.

Etthāti ‘‘bhavā jātī’’ti etasmiṃ pade.

Here refers to the phrase "existence, birth."

Ở đây (ettha) là trong từ “hữu, sinh.”

Tena upapattibhavenāti ‘‘bhavā jātī’’ti jātisīsena vuttaupapattibhavena.

By that becoming of rebirth means by the becoming of rebirth stated under the heading of birth, "from becoming, birth."

Bằng hữu tái sinh đó (tena upapattibhavenā) là bằng hữu tái sinh được nói đến dưới tiêu đề sinh, tức là “hữu sinh.”

Bhūtassāti nibbattassa.

Of what has become means of what has arisen.

Của chúng sinh đã sinh (bhūtassā) nghĩa là của chúng sinh đã được sinh ra.

So pana yasmā satto nāma hoti, tasmā vuttaṃ ‘‘sattassā’’ti.

Since that is called a being, it is said, " of a being."

Vì chúng sinh đó được gọi là hữu tình, nên đã nói “của hữu tình” (sattassā).

Evañca jānitvāti iminā ‘‘bhūtassa jarāmaraṇa’’nti etthāpi ‘‘iti viditvā’’ti idaṃ padaṃ ānetvā yojetabbanti dasseti.

And having known thus shows that the phrase "having understood thus" should also be brought and construed in "aging and death of what has become."

Và đã biết như vậy (evaṃñca jānitvā) chỉ ra rằng từ “iti viditvā” (đã biết như vậy) cũng nên được đưa vào và kết nối ở đây, tức là “jarāmaraṇa của chúng sinh đã sinh.”

382

Yadipi tebhūmakā upādānakkhandhā ‘‘yaṃ kiñci rūpa’’ntiādinā (vibha. 2; ma. ni. 1.244) ekādasasu okāsesu pakkhipitabbā sammasitabbā ca, te pana yasmā bhagavatā ‘‘kimhi nu kho sati jarāmaraṇaṃ hoti, kiṃpaccayā jarāmaraṇa’’ntiādinā (dī. ni. 2.57; saṃ. ni. 2.4, 10) paṭiccasamuppādamukhena sammasitā, paṭiccasamuppādo ca pavattipavattihetubhāvato purimasaccadvayameva hoti, tasmā tadabhisamayaṃ ‘‘maññanābhāvahetu paccayākārapaṭivedho’’ti vibhāvento ‘‘yaṃ bodhirukkhamūle…pe… dassento’’ti āha.

Although the three-fold upādānakkhandhas are to be included in eleven instances and contemplated, as in "Whatever form," and so on, because they were contemplated by the Blessed One through the mode of Dependent Origination, as in "When what exists, does aging and death come to be? Conditioned by what is aging and death?" and so on—and Dependent Origination, being the cause of both the process of existence and its continuation, consists of the first two Noble Truths—therefore, explaining the comprehension of that as "the penetration of causal relations as a result of the absence of misconception," he says, " What at the foot of the Bodhi tree... showing."

Mặc dù các uẩn thủ ba cõi, “bất cứ sắc nào,” v.v., phải được đưa vào và quán sát ở mười một trường hợp, nhưng vì chúng đã được Đức Thế Tôn quán sát thông qua phương pháp Duyên Khởi, “khi có gì thì già chết có, già chết do duyên gì,” v.v., và Duyên Khởi chỉ là hai Thánh Đế đầu tiên do có trạng thái sinh khởi và nguyên nhân của sự sinh khởi, nên để phân biệt sự giác ngộ đó là “sự thâm nhập các nhân duyên do không có tà kiến,” Ngài đã nói “mà dưới cội Bồ-đề… v.v… chỉ ra.”

Saṃkhippanti ettha avijjādayo viññāṇādayo cāti saṅkhepā, atīte hetuādayo ‘‘hetu, phala’’nti evaṃ saṃkhippantīti vā saṅkhepā, avijjādayo viññāṇādayo ca.

They are called saṅkhepas (groups) because avijjā and others, and viññāṇa and others, are condensed here; or they are called saṅkhepas because the causes in the past and so on are condensed as "cause, fruit"; avijjā and others, and viññāṇa and others.

Vô minh, v.v., và thức, v.v., được tóm tắt ở đây, nên gọi là tóm tắt (saṅkhepā); hoặc các nguyên nhân, v.v., trong quá khứ được tóm tắt như “nhân, quả,” nên gọi là tóm tắt (saṅkhepā); vô minh, v.v., và thức, v.v.

Saṅkhepa-saddo bhāgādhivacananti daṭṭhabbo.

The word saṅkhepa should be understood as meaning "portion" or "part."

Từ “saṅkhepa” (tóm tắt) cần được hiểu là chỉ phần.

Tenāha ‘‘koṭṭhāsāti attho’’ti.

Therefore, he says, " meaning portions."

Chính vì thế, Ngài nói “koṭṭhāsāti attho” (nghĩa là các phần).

Te pana atīte hetusaṅkhepo, etarahi phalasaṅkhepo, etarahi hetusaṅkhepo, āyatiṃ phalasaṅkhepoti cattāro saṅkhepā etassāti catusaṅkhepo, taṃ catusaṅkhepaṃ.

But there are four such saṅkhepas: the saṅkhepa of cause in the past, the saṅkhepa of fruit in the present, the saṅkhepa of cause in the present, and the saṅkhepa of fruit in the future; thus, it is four-grouped.

Và vì nó có bốn phần tóm tắt: phần tóm tắt nhân trong quá khứ, phần tóm tắt quả trong hiện tại, phần tóm tắt nhân trong hiện tại, và phần tóm tắt quả trong tương lai, nên gọi là catusaṅkhepa (bốn phần tóm tắt).

Hetuphalasandhi, phalahetusandhi, puna hetuphalasandhīti evaṃ tayo sandhī etassāti tisandhi, taṃ tisandhiṃ.

There are three connections: the connection of cause and fruit, the connection of fruit and cause, and again the connection of cause and fruit; thus, it is three-connected.

Và vì nó có ba sự liên kết: liên kết nhân-quả, liên kết quả-nhân, và lại liên kết nhân-quả, nên gọi là tisandhi (ba liên kết).

Atītapaccuppannānāgatabhedā tayo addhā etassāti tiyaddho, taṃ tiyaddhaṃ.

There are three dimensions, divided into past, present, and future; thus, it is three-dimensional.

Và vì nó có ba thời kỳ: quá khứ, hiện tại và vị lai, nên gọi là tiyaddha (ba thời).

Sarūpato avuttāpi tasmiṃ tasmiṃ saṅkhepe ākirīyanti avijjāsaṅkhārādiggahaṇehi pakāsīyantīti ākārā, atītahetuādīnaṃ vā pakārā ākārā, te ekekasaṅkhepe pañca pañca katvā vīsati ākārā etassāti vīsatākāro, taṃ vīsatākāraṃ.

Though not stated in their own form, they are ākārā (aspects) because they are scattered in each group and revealed by the mentions of avijjā, saṅkhārā, and so on; or they are the modes of the past causes and so on, which are ākārā; there are twenty such ākārā, five in each group; thus, it is twenty-aspected.

Các tướng (ākārā) là những điều không được nói rõ về bản chất nhưng được tiết lộ trong mỗi phần tóm tắt thông qua việc nắm giữ vô minh, hành, v.v.; hoặc các loại của nhân quá khứ, v.v., là các tướng (ākārā). Và vì nó có hai mươi tướng, mỗi tướng có năm loại trong mỗi phần tóm tắt, nên gọi là vīsatākāra (hai mươi tướng).

383

Esa sabboti esa catusaṅkhepādipabhedo anavaseso paccayo.

All of this refers to this entire, complete condition, categorized by four groups and so on.

Tất cả cái đó (esa sabbo) là tất cả các duyên không sót lại, được phân loại thành bốn phần tóm tắt, v.v.

Paccayalakkhaṇenāti paccayabhāvena attano phalassa paṭisandhiviññāṇassa paccayabhāvena, avinābhāvalakkhaṇenāti attho.

By the characteristic of conditionality means by the nature of being a condition, by being a condition for its own fruit, the rebirth-consciousness; meaning by the characteristic of inseparability.

Bằng đặc tính nhân duyên (paccayalakkhaṇenā) nghĩa là bằng đặc tính nhân duyên của chính nó đối với quả của nó, tức là thức tái sinh; nghĩa là bằng đặc tính không thể tách rời.

Yathā hi taṇhaṃ vinā avijjādayo viññāṇassa paccayā na honti, evaṃ taṇhāpi avijjādike vināti.

For just as avijjā and others are not conditions for viññāṇa without craving, so also craving is not a condition without avijjā and others.

Thật vậy, giống như vô minh, v.v., không phải là nhân duyên của thức nếu không có khát ái, thì khát ái cũng không phải là nhân duyên nếu không có vô minh, v.v.

Ettha dukkhaggahaṇena viññāṇanāmarūpasaḷāyatanaphassavedanānaṃ, bhavaggahaṇena ca taṇhāsaṅkhārupādānānaṃ gahitatā vuttanayā evāti na uddhaṭā.

Here, the inclusion of viññāṇa, nāmarūpa, saḷāyatana, phassa, and vedanā by the term "suffering," and the inclusion of taṇhā, saṅkhāra, and upādāna by the term "existence," are according to the method stated, and thus are not explicitly elaborated.

Ở đây, việc nắm giữ khổ bao gồm thức, danh sắc, sáu xứ, xúc, thọ, và việc nắm giữ hữu bao gồm khát ái, hành, thủ, đã được nêu theo cách đã trình bày, nên không cần giải thích lại.

384

Idāni te vīsati ākāre paṭisambhidāmaggapāḷiyā vibhāvetuṃ ‘‘evamete’’tiādi vuttaṃ.

Now, in order to explain these twenty aspects according to the Pāli text of the Paṭisambhidāmagga, the phrase " Thus these" and so on is stated.

Bây giờ, để phân biệt hai mươi tướng đó theo Pāḷi của Paṭisambhidāmagga, Ngài đã nói “evamete” (như vậy những điều này), v.v.

Tattha (paṭi. ma. aṭṭha. 1.47) purimakammabhavasminti purime kammabhave, atītajātiyaṃ kammabhave kayiramāneti attho.

There, in the former kamma-bhava means in the former kamma-bhava, meaning in the kamma-bhava performed in a past birth.

Ở đó, trong hữu nghiệp quá khứ (purimakammabhavasmiṃ) nghĩa là trong hữu nghiệp quá khứ, tức là trong hữu nghiệp được thực hiện ở kiếp quá khứ.

Moho avijjāti yo tadā dukkhādīsu moho, yena mūḷho kammaṃ karoti, sā avijjā.

Delusion is ignorance means that delusion concerning suffering and so on, by which one performs kamma when deluded, is avijjā.

Si mê là vô minh (moho avijjā) nghĩa là sự si mê đối với khổ, v.v., vào thời điểm đó, mà do si mê đó người ta tạo nghiệp, đó là vô minh.

Āyūhanā saṅkhārāti taṃ taṃ kammaṃ karonto dānupakaraṇādi sajjanādivasena yā purimacetanāyo, te saṅkhārā.

Accumulation is formations means those former volitions by which one performs such and such kamma, as in providing donations and so on, serving noble ones and so on—those are saṅkhārā.

Sự tích lũy là hành (āyūhanā saṅkhārā) nghĩa là những tư tâm quá khứ khi tạo nghiệp đó, bằng cách chuẩn bị các vật dụng cúng dường, v.v., đó là hành.

Paṭiggāhakānaṃ pana hatthe deyyadhammaṃ patiṭṭhāpayato cetanā bhavo.

But the volition of one who places a gift in the hands of recipients is bhava.

Còn tư tâm của người đặt vật cúng dường vào tay người thọ nhận là hữu.

Ekāvajjanajavanesu vā purimā cetanā āyūhanā saṅkhārā, sattamā bhavo.

Or, in the courses of single-advertence, the former volitions are kammic formations (āyūhanā saṅkhārā); the seventh is existence (bhava).

Hoặc trong các sát na động lực chỉ có một sát na hướng tâm, ý chí đầu tiên là hành tạo tác, sát na thứ bảy là hữu.

Yā kāci vā pana cetanā bhavo, sampayuttā āyūhanā saṅkhārā.

Or, any volition that is existence (bhava), when associated, is kammic formation (āyūhanā saṅkhārā).

Hoặc bất kỳ ý chí nào khác là hữu, là hành tạo tác tương ưng.

Nikanti taṇhāti yaṃ kammaṃ karontassa upapattibhave tassa phalassa nikāmanā patthanā, sā taṇhā nāma.

Delightful craving (nikanti taṇhā): The desire and longing for the result of that action in the realm of rebirth, while performing the action—that is called craving (taṇhā).

Ái dục (Nikanti taṇhā) là sự ham muốn, mong cầu quả của nghiệp đó trong kiếp tái sanh của người đang tạo nghiệp; đó gọi là ái dục (taṇhā).

Upagamanaṃ upādānanti yaṃ kammabhavassa paccayabhūtaṃ ‘‘idaṃ kammaṃ katvā asukasmiṃ nāma ṭhāne kāme sevissāmi ucchijjissāmī’’tiādinā nayena pavattaṃ upagamanaṃ gahaṇaṃ parāmasanaṃ, idaṃ upādānaṃ nāma.

Clinging (upagamanaṃ upādāna): That approaching, grasping, and clinging that arises as a condition for kammic existence, in the manner of 'Having done this action, I will enjoy sensual pleasures in such and such a place, I will become cut off'—this is called clinging (upādāna).

Thủ (Upagamanaṃ upādāna) là sự chấp thủ, nắm giữ, bám víu khởi lên như là nhân duyên của nghiệp hữu, theo cách thức như: “Sau khi tạo nghiệp này, ta sẽ hưởng thụ dục lạc ở nơi nào đó, hoặc ta sẽ đoạn diệt,” v.v…; đó gọi là thủ (upādāna).

Cetanā bhavoti dvīsu atthavikappesu vuttassa āyūhanassa avasāne vuttacetanā, tatiye pana āyūhanasampayuttacetanā bhavo.

Volition is existence (cetanā bhavo): This refers to the volition mentioned at the end of 'kammic formation' (āyūhana) as stated in the two ways of interpretation; in the third, it is the volition associated with kammic formation that is existence.

Ý chí là hữu (Cetanā bhavo) là ý chí được đề cập ở cuối phần tạo tác được nói đến trong hai cách giải thích nghĩa; còn trong cách giải thích thứ ba, ý chí tương ưng với tạo tác là hữu.

Iti ime pañca dhammā purimakammabhavasmiṃ idha paṭisandhiyā paccayāti ime yathāvuttā mohādayo pañca dhammā atītakammabhavasiddhā etarahi paṭisandhiyā paccayabhūtāti attho.

Thus these five dhammas are conditions for rebirth here in the previous kammic existence (bhava): This means that these five dhammas, such as delusion and so forth, as stated, established in the past kammic existence, are now conditions for rebirth.

Như vậy, năm pháp này là nhân duyên của tái sanh ở đây trong nghiệp hữu quá khứ có nghĩa là năm pháp như đã nói, tức vô minh, v.v… được thành tựu trong nghiệp hữu quá khứ, là nhân duyên của tái sanh hiện tại.

385

Idha paṭisandhiviññāṇanti yaṃ bhavantarapaṭisandhānavasena uppannattā paṭisandhīti vuccati, taṃ viññāṇaṃ.

Rebirth-linking consciousness (paṭisandhiviññāṇa) here: That consciousness (viññāṇa) which is called 'rebirth' because it arises by way of linking to another existence.

Thức tái sanh ở đây (Idha paṭisandhiviññāṇaṃ) là thức được gọi là tái sanh (paṭisandhi) vì nó khởi lên theo cách thức nối tiếp các kiếp sống.

Okkanti nāmarūpanti yā gabbhe rūpārūpadhammānaṃ okkanti āgantvā pavisantī viya, idaṃ nāmarūpaṃ.

Descent of mind-and-matter (okkanti nāmarūpa): This refers to mind-and-matter, which is like the descent, the coming and entering, of mind-and-matter into the womb.

Danh sắc thâm nhập (Okkanti nāmarūpaṃ) là sự thâm nhập của các pháp sắc và vô sắc vào trong bào thai, như thể chúng đến và đi vào.

Pasādo āyatananti idaṃ cakkhādipañcāyatanavasena vuttaṃ.

Sensitivity is sense-base (pasādo āyatana): This is stated in terms of the five sense-bases, such as the eye.

Tịnh sắc là xứ (Pasādo āyatanaṃ) được nói đến theo nghĩa năm xứ như nhãn, v.v…

Phuṭṭho phassoti yo ārammaṇaṃ phuṭṭho phusanto uppanno, ayaṃ phasso.

Touched is contact (phuṭṭho phasso): That contact (phassa) which, having touched or come into contact with the object, has arisen—this is contact.

Xúc chạm là xúc (Phuṭṭho phasso) là xúc khởi lên khi chạm vào đối tượng.

Vedayitaṃ vedanāti yaṃ paṭisandhiviññāṇena vā saḷāyatanapaccayena vā phassena sahuppannaṃ vipākavedayitaṃ, sā vedanā.

Felt is feeling (vedayitaṃ vedanā): That resultant feeling (vipākavedayita) which arises together with rebirth-linking consciousness or with contact conditioned by the six sense-bases—that is feeling (vedanā).

Cảm thọ là thọ (Vedayitaṃ vedanā) là cảm thọ quả dị thục khởi lên đồng thời với thức tái sanh hoặc với xúc do sáu xứ làm nhân duyên.

Iti ime…pe… paccayāti ime viññāṇādayo pañca koṭṭhāsikā dhammā purimabhave katassa kammassa kammavaṭṭassa paccayā, paccayabhāvato taṃ paṭicca idha etarahi upapattibhavasmiṃ upapattibhavabhāvena vā hontīti attho.

Thus these… etc.… are conditions: This means that these five constituent dhammas, such as consciousness, are conditions for the action, the cycle of kamma, performed in the previous existence; by virtue of being conditions, they arise here, in this present existence, as the state of rebirth.

Như vậy, năm… v.v… là nhân duyên có nghĩa là năm phần pháp như thức, v.v… này là nhân duyên của nghiệp đã tạo trong kiếp trước, tức là nhân duyên của vòng nghiệp (kammavaṭṭa); do là nhân duyên, chúng nương vào đó mà hiện hữu ở đây, trong kiếp tái sanh, hoặc là sự hiện hữu của kiếp tái sanh.

386

Idha paripakkattā āyatanānaṃ mohoti paripakkāyatanassa kammakaraṇakāle asammohaṃ dasseti.

Delusion (moho) here, due to the ripeness of the sense-bases: This indicates non-delusion at the time of performing kamma for a ripened sense-base.

Vô minh ở đây do các xứ đã trưởng thành (Idha paripakkattā āyatanānaṃ moho) cho thấy sự không vô minh vào lúc tạo nghiệp của các xứ đã trưởng thành.

Daharassa hi cittappavatti bhavaṅgabahulā yebhuyyena bhavantarajanakakammāyūhanasamatthā na hotīti.

For the mental progression of a young person, which is abundant in bhavaṅga, is generally not capable of accumulating kamma productive of future existence.

Vì sự vận hành của tâm của một người trẻ tuổi thường thiên về hữu phần (bhavaṅga), nên không đủ khả năng tạo nghiệp sinh ra kiếp sống khác.

Kammakaraṇakāleti ca iminā sabbo kammassa paccayabhūto sammoho gahito, na sampayuttova.

And by this expression, at the time of performing kamma, all delusion that is a condition for kamma is taken, not merely that which is associated.

Và bằng cách nói vào lúc tạo nghiệp, tất cả vô minh là nhân duyên của nghiệp đều được bao gồm, không chỉ vô minh tương ưng.

Sesaṃ vuttanayameva.

The rest is as explained.

Phần còn lại cũng theo cách đã nói.

387

Padayojanāyāti ‘‘tasmā’’tiādīnaṃ padānaṃ sambandhena saha.

In the word-construction (padayojanā): Together with the connection of words such as "therefore."

Về cách sắp xếp từ (Padayojanāyā) là cùng với sự liên kết của các từ như “tasmā” (do đó), v.v…

Atthanigamananti imasmiṃ aṭṭhamavāre desanatthanigamanaṃ.

Conclusion of meaning (atthanigamana): This is the conclusion of the meaning of the teaching in this eighth section.

Kết luận ý nghĩa (Atthanigamanaṃ) là kết luận ý nghĩa bài giảng trong lần thứ tám này.

Nandīti evaṃ vuttānaṃ sabbataṇhānanti ‘‘nandī dukkhassa mūla’’nti evaṃ nandanatthasāmaññato ekavacanena vuttānaṃ sabbataṇhānaṃ santānārammaṇasampayuttadhammappavattiākārādibhedena anekabhedānaṃ sabbāsaṃ taṇhānaṃ.

Nandī, all cravings mentioned thus: As in "delight (nandī) is the root of suffering," all cravings, spoken of in the singular for their common meaning of delighting, and which are manifold due to differences in their stream, object, associated dhammas, mode of arising, and so forth—all those cravings.

Hoan hỷ là tất cả các ái dục đã nói như vậy (Nandīti evaṃ vuttānaṃ sabbataṇhānaṃ) có nghĩa là tất cả các ái dục được nói bằng số ít theo nghĩa chung của sự hoan hỷ như “hoan hỷ là cội rễ của khổ đau” (nandī dukkhassa mūlaṃ), tức là tất cả các ái dục với nhiều sai biệt về sự vận hành của các pháp tương ưng với dòng tâm và đối tượng, v.v…

Khayavevacanānevāti samucchedapahānavevacanāneva.

Are indeed synonyms for cessation (khayavevacanāneva): Indeed, they are synonyms for eradication by cutting off.

Chỉ là các từ đồng nghĩa với sự đoạn diệt (Khayavevacanānevā) chỉ là các từ đồng nghĩa với sự đoạn trừ hoàn toàn.

‘‘Accantakkhayā’’ti hi vuttaṃ.

For it is said, "absolute cessation."

Vì đã nói “sự đoạn diệt tuyệt đối”.

Catumaggakiccasādhāraṇametanti catunnaṃ ariyamaggānaṃ pahānakiccassa sādhāraṇaṃ sāmaññato gahaṇaṃ etaṃ khayādivacananti attho.

This is common to the task of the four paths: This means that these terms such as cessation are common to the task of abandoning for the four Noble Paths, taken in general.

Điều này là chung cho công việc của bốn Đạo (Catumaggakiccasādhāraṇametaṃ) có nghĩa là sự chấp nhận chung này của các từ như “đoạn diệt” (khaya), v.v… là chung cho công việc đoạn trừ của bốn Thánh Đạo.

Tesaṃ pana maggānaṃ kamena pavattanaṃ kiccakameneva dassetuṃ ‘‘virāgā’’tiādi vuttanti dassento ‘‘tato…pe… yojetabba’’nti āha.

And to show the sequential progression of those paths as their respective tasks, it is said, " from dispassion (virāgā)" and so forth, indicating " Therefore...etc.... should be joined."

Để cho thấy sự vận hành tuần tự của các Đạo đó theo đúng công việc của chúng, đã nói “do ly tham” (virāgā), v.v… và giải thích rằng “do đó… v.v… cần được liên kết”.

Tathā satipi khayādisaddānaṃ pahānapariyāyabhāve pahātabbāya pana visayabhedabhinnāya taṇhāya anavasesato pahīnabhāvadīpanatthaṃ khayādipariyāyantaraggahaṇaṃ katanti dassento ‘‘yāhī’’tiādimāha.

Even though the words such as 'cessation' are synonyms for abandonment, to show that craving, which is to be abandoned and is differentiated by various objects, has been abandoned without remainder, other synonyms for cessation are taken, indicating " by which" and so forth.

Mặc dù các từ như “đoạn diệt” (khaya), v.v… là các từ đồng nghĩa với sự đoạn trừ, nhưng để làm rõ sự đoạn trừ hoàn toàn của ái dục cần được đoạn trừ, vốn có sự khác biệt về đối tượng, đã sử dụng các từ đồng nghĩa khác như “đoạn diệt”, v.v… và giải thích bằng cách nói “yāhī” (bằng những gì), v.v…

Yathāvuttasañjananādihetubhūtāya taṇhāya pahīnattā tappahānadīpanaṃ katvā vuccamānaṃ khayādivacanaṃ na kathañci dhammataṃ vilometīti vuttaṃ ‘‘na kiñci virujjhatī’’ti.

Since craving, which is the cause of generation and so forth as stated, has been abandoned, the words such as cessation, spoken after demonstrating its abandonment, do not in any way contradict the truth; hence it is said, " nothing contradicts."

Vì ái dục là nguyên nhân của sự sanh khởi như đã nói đã được đoạn trừ, nên lời nói về sự đoạn diệt, v.v… được nói sau khi làm rõ sự đoạn trừ đó, không hề mâu thuẫn với bản chất của pháp; đó là ý nghĩa của câu “không có gì mâu thuẫn” (na kiñci virujjhatīti).

388

Uttaravirahitanti attānaṃ uttarituṃ samatthattā uttarena adhikena virahitaṃ.

Without a superior (uttaravirahita): That which is without a superior, without anything greater, because it is capable of surpassing itself.

Không có gì vượt trội hơn (Uttaravirahitaṃ) là không có gì vượt trội hơn, vì không có khả năng vượt qua chính nó.

Ayañcassa uttaravirahatā attano seṭṭhabhāvenāti āha ‘‘sabbaseṭṭha’’nti.

And this "without a superior" is due to its supreme nature, hence it says " supreme in every way."

Và sự không có gì vượt trội hơn này là do sự tối thượng của nó; đó là lý do tại sao nói “tối thượng nhất” (sabbaseṭṭhaṃ).

Yathā sammā-saṃ-saddā ‘‘aviparītaṃ, sāma’’nti imesaṃ padānaṃ atthaṃ vadanti, evaṃ pāsaṃsasobhanatthepīti āha ‘‘sammā sāmañca bodhiṃ pasatthaṃ sundarañca bodhi’’nti.

Just as the word sammā-saṃ denotes the meaning of the words "unperverted" and "alone," so too in the sense of praiseworthy and beautiful, it says " the fully and perfectly praised and beautiful enlightenment."

Cũng như các từ “sammā” và “saṃ” nói lên ý nghĩa của các từ “không sai lệch” và “đúng đắn”, chúng cũng có nghĩa là đáng khen ngợi và tốt đẹp; đó là lý do tại sao nói “Giác ngộ đúng đắn và tốt đẹp, đáng khen ngợi” (sammā sāmañca bodhiṃ pasatthaṃ sundarañca bodhiṃ).

Bujjhi ettha paṭivijjhi cattāri ariyasaccāni, sabbampi vā neyyanti rukkho bodhi, bujjhati etenāti pana maggo bodhi, tathā sabbaññutaññāṇaṃ, nibbānaṃ pana bujjhitabbato bodhīti ayamettha sādhanavibhāgo daṭṭhabbo.

That by which one awakens here, penetrates the four Noble Truths, or all that is to be known, is the tree bodhi; that by which one awakens is the path bodhi; similarly, omniscient knowledge. Nibbāna, however, is bodhi because it is to be awakened to—this distinction in derivation should be noted here.

Đã giác ngộ, đã thấu hiểu Tứ Thánh Đế ở đây, hoặc tất cả những gì cần được biết, thì cây đó là bodhi (cây giác ngộ); còn con đường mà nhờ đó người ta giác ngộ là bodhi (đạo giác ngộ), cũng như Tuệ Toàn Tri (sabbaññutaññāṇaṃ); còn Niết Bàn là bodhi vì nó cần được giác ngộ; đây là sự phân chia về cách hình thành từ cần được xem xét ở đây.

Paṇṇattiyampi attheva bodhi-saddo ‘‘bodhirājakumāro’’tiādīsu (ma. ni. 2.324; cūḷava. 268).

The word bodhi is also used in a descriptive sense, as in "Bodhirājakumāra" and so forth.

Trong các khái niệm, từ “bodhi” cũng tồn tại trong các trường hợp như “bodhirājakumāro” (hoàng tử Bodhi), v.v… (Ma. Ni. 2.324; Cūḷava. 268).

Apareti sārasamāsācariyā.

Others: The Sārasamāsa teachers.

Những người khác (Apare) là các vị thầy của Sarasamāsa.

Ettha ca saupasaggassa bodhi-saddassa atthuddhāre anupasaggānaṃ udāharaṇe kāraṇaṃ heṭṭhā vuttameva.

And the reason for exemplifying words without a prefix in the exposition of the meaning of the word bodhi with a prefix has already been stated below.

Và lý do cho việc đưa ra ví dụ về các từ không có tiền tố trong việc giải thích ý nghĩa của từ “bodhi” có tiền tố đã được nói ở dưới.

389

Lokuttarabhāvato vā tatthāpi heṭṭhimamaggānaṃ viya tatuttarimaggābhāvato ca ‘‘siyā nu kho anuttarā bodhī’’ti āsaṅkaṃ sandhāya taṃ vidhamituṃ ‘‘sāvakāna’’ntiādi vuttaṃ.

Or, due to its supramundane nature, and also because there is no path superior to it, just as there are no paths superior to the lower paths, referring to the doubt "Is there not an unsurpassed enlightenment?" to dispel that, " for disciples" and so forth is stated.

Hoặc do bản chất siêu thế, và cũng do không có đạo nào cao hơn các đạo thấp hơn ở đó, nên để xua tan nghi ngờ “liệu có phải là Vô Thượng Giác ngộ (anuttarā bodhī) không?”, đã nói “của các Thanh văn” (sāvakānaṃ), v.v…

Abhinīhārasampattiyā phalavisesabhūtehi ñāṇavisesehi ekaccehi sakalehi saddhiṃ samijjhamāno maggo ariyānaṃ taṃ taṃ ñāṇavisesādiṃ dento viya hotīti tassa asabbaguṇadāyakattaṃ vuttaṃ.

The path, which is perfected through special knowledges, being specific results of the perfection of aspiration, complete with some and all of these special knowledges, is said to be like bestowing those respective special knowledges and so forth upon the noble ones, indicating that it does not bestow all qualities.

Đạo, vốn thành tựu cùng với các loại trí đặc biệt là quả của sự thành tựu nguyện ước, dường như ban phát các loại trí đặc biệt đó cho các bậc Thánh; do đó, nó được nói là ban phát tất cả các phẩm chất.

Tena anaññasādhāraṇābhinīhārasampadāsiddhassa niratisaya-guṇānubandhassa vasena arahattamaggo anuttarā bodhi nāma hotīti dasseti.

Thereby it shows that the Arahantship-path, perfected through unique aspiration and accompanied by incomparable qualities, is called unsurpassed enlightenment (anuttarā bodhi).

Điều này cho thấy rằng Đạo A-la-hán, được thành tựu nhờ sự thành tựu nguyện ước không thể chia sẻ với ai khác và được gắn liền với các phẩm chất vô song, được gọi là Vô Thượng Giác ngộ (anuttarā bodhi).

Sāvakapāramiñāṇaṃ aññehi sāvakehi asādhāraṇaṃ mahāsāvakānaṃyeva āveṇikaṃ ñāṇaṃ.

The disciple's perfection-knowledge is a unique knowledge, not shared by other disciples, belonging only to the great disciples.

Trí Ba-la-mật của Thanh văn là trí độc đáo của các Đại Thanh văn, không thể chia sẻ với các Thanh văn khác.

Paccekaṃ saccāni buddhavantoti paccekabuddhā.

Those who awaken to the truths individually are Paccekabuddhas.

Tự mình giác ngộ các sự thật, nên là Bích Chi Phật (Paccekaṃ saccāni buddhavantoti paccekabuddhā).

Nanu ca sabbepi ariyā paccekameva saccāni paṭivijjhanti dhammassa paccattaṃ vedanīyabhāvatoti?

But do not all Noble Ones awaken to the truths individually, since the Dhamma is to be experienced by oneself?

Chẳng phải tất cả các bậc Thánh đều tự mình thấu hiểu các sự thật, vì pháp là điều cần được tự mình cảm nhận sao?

Saccaṃ, nayidamīdisaṃ paṭivedhaṃ sandhāya vuttaṃ, yathā pana sāvakā aññasannissayena saccāni paṭivijjhanti paratoghosena vinā tesaṃ dassanamaggassa anuppajjanato, yathā ca sammāsambuddho aññesaṃ nissayabhāvena saccāni abhisambujjhanti, na evamete, ete pana aparaneyyā hutvā apariṇāyakabhāvena saccāni paṭivijjhanti.

True, but this statement does not refer to such a penetration. For just as disciples penetrate the truths by relying on others, since for them the path of insight does not arise without the voice of another; and just as a Perfectly Self-Awakened One fully awakens to the truths by being a reliance for others—these Paccekabuddhas are not like that. They, however, penetrate the truths without needing to be led by others and without being leaders for others.

Đúng vậy, nhưng điều này không được nói đến theo nghĩa thấu hiểu như vậy; mà là, trong khi các Thanh văn thấu hiểu các sự thật nhờ sự nương tựa vào người khác, vì Đạo Kiến (dassanamagga) của họ không thể khởi lên nếu không có lời giáo huấn từ người khác; và trong khi Đức Chánh Đẳng Giác tự mình giác ngộ các sự thật bằng cách trở thành chỗ nương tựa cho người khác, thì các vị Bích Chi Phật này không như vậy. Các vị này tự mình thấu hiểu các sự thật mà không cần người khác hướng dẫn và không cần trở thành người lãnh đạo.

Tena vuttaṃ ‘‘paccekaṃ saccāni buddhavantoti paccekabuddhā’’ti.

Hence it is said, " Those who awaken to the truths individually are Paccekabuddhas."

Do đó đã nói “Tự mình giác ngộ các sự thật, nên là Bích Chi Phật”.

390

Itīti karīyati uccārīyatīti itikāro, iti-saddo.

"Iti" is uttered, expressed, hence itikāro, the word iti.

Iti (như vậy) được thực hiện, được phát âm, nên là itikāro (từ iti), tức là từ “iti”.

Kāraṇattho aniyamarūpenāti adhippāyo, tasmāti vuttaṃ hoti.

The causal meaning is in an unrestricted form—this is the intention, so it means "therefore."

Nghĩa là nguyên nhân (Kāraṇattho) theo một hình thức không cố định; đó là ý nghĩa, do đó đã nói.

Tenāha ‘‘yasmā cā’’ti.

Therefore it says, " And because."

Vì vậy đã nói “yasmā cā” (và vì).

Pubbe pana iti-saddaṃ pakāratthaṃ katvā ‘‘evaṃ jānitvā’’ti vuttaṃ, idhāpi taṃ pakāratthameva katvā atho yujjati.

Previously, the word iti was given the meaning of "thus," stating "knowing thus"; here too, it can be given the meaning of "thus," and then the meaning fits.

Trước đây, từ “iti” được dùng với nghĩa cách thức, và đã nói “biết như vậy”; ở đây cũng có thể dùng với nghĩa cách thức.

Kathaṃ?

How?

Như thế nào?

Viditvāti hi padaṃ hetuatthe daṭṭhabbaṃ ‘‘paññāya cassa disvā’’ti (ma. ni. 1.271), ‘‘ghataṃ pivitvā balaṃ hotī’’ti ca evamādīsu viya, tasmā pakāratthepi iti-sadde paṭiccasamuppādassa viditattāti ayaṃ attho labbhateva.

Indeed, the word "viditvā" (having known/understood) should be understood in the sense of cause, as in "having seen it with wisdom" and "having drunk ghee, one becomes strong," and similar examples. Therefore, even when the word "iti" is in the sense of manner, the meaning "because of having known Dependent Origination" is certainly obtained.

Từ Viditvā (đã biết) nên được hiểu theo nghĩa nguyên nhân, như trong ‘‘đã thấy bằng trí tuệ’’ và ‘‘đã uống bơ lỏng thì có sức mạnh’’, v.v. Do đó, ngay cả với từ iti theo nghĩa cách thức, ý nghĩa ‘‘vì đã biết Duyên khởi’’ vẫn được hiểu.

Paṭiccasamuppādaṃ viditvāti etthāpi hetuatthe viditvā-sadde yathāvuttā atthayojanā yujjateva.

Here too, regarding "having known Dependent Origination," the explanation of meaning as stated is indeed appropriate for the word "viditvā" in the causal sense.

Ở đây, trong cụm từ Paṭiccasamuppādaṃ viditvā (đã biết Duyên khởi), từ viditvā theo nghĩa nguyên nhân, cách giải thích ý nghĩa như đã nói trên hoàn toàn phù hợp.

Ettha ca paṭhamavikappe paṭiccasamupādassa viditatthaṃ maññanābhāvassa kāraṇaṃ vatvā taṇhāmūlakassa paṭiccasamuppādassa dassitattā ettha taṇhāppahānaṃ sammāsambodhiyā adhigamanakāraṇaṃ uddhatanti dassitaṃ, tasmā ‘‘pathaviṃ na maññatī’’tiādi nigamanaṃ daṭṭhabbaṃ.

And here, in the first alternative, having stated the reason for the absence of conceiving to be the knowledge of Dependent Origination, and Dependent Origination being shown as rooted in craving, it is indicated that the abandonment of craving is the cause for the attainment of perfect enlightenment. Therefore, the conclusion "he does not conceive earth" and so forth should be understood.

Và ở đây, trong trường hợp thứ nhất, khi nói rằng việc biết Duyên khởi là nguyên nhân của sự không chấp ngã (maññanā), và Duyên khởi được trình bày là có gốc rễ từ tham ái (taṇhā), thì ở đây đã chỉ ra rằng sự đoạn trừ tham ái là nguyên nhân để thành tựu Chánh đẳng giác (sammāsambodhi). Do đó, cần hiểu kết luận bắt đầu bằng ‘‘pathaviṃ na maññatī’’ (không chấp ngã vào đất, v.v.).

Dutiyavikappe pana paṭiccasamuppādavedanaṃ taṇhāppahānassa kāraṇaṃ vuttaṃ, taṃ abhisambodhiyā abhisambodhimaññanābhāvassāti ayamattho dassitoti ayametesaṃ dvinnaṃ atthavikappānaṃ viseso, tasmā ‘‘nandī dukkhassa mūla’’nti vuttaṃ.

In the second alternative, however, the understanding of Dependent Origination is stated as the cause for the abandonment of craving, and that this is the cause for perfect enlightenment and the absence of conceiving perfect enlightenment. This is the distinction between these two interpretations of meaning. Therefore, it is said, "delight is the root of suffering."

Trong trường hợp thứ hai, sự hiểu biết Duyên khởi được nói là nguyên nhân của sự đoạn trừ tham ái, và điều đó được chỉ ra là nguyên nhân của sự thành tựu Chánh đẳng giác và sự không chấp ngã vào Chánh đẳng giác. Đây là sự khác biệt giữa hai cách giải thích ý nghĩa này. Do đó, đã nói rằng ‘‘hoan hỷ là gốc rễ của khổ đau’’.

391

Taṃ kuto labbhatīti codanaṃ sandhāyāha ‘‘yattha yattha hī’’tiādi.

Addressing the question "From where is that obtained?", it says "wherever..." and so forth.

Để giải đáp câu hỏi ‘‘Điều đó lấy từ đâu?’’, Đức Phật đã nói ‘‘yattha yattha hī’’ (nơi nào, nơi nào, v.v.).

Sāsanayutti ayaṃ sāsanepi evaṃ sambandho dissatīti katvā.

"Sāsanayutti" (scriptural appropriateness) means that such a connection is seen even in the Dispensation.

Sāsanayutti (sự phù hợp của giáo pháp): vì sự liên kết như vậy được thấy trong giáo pháp.

Lokepi hi yaṃ-taṃ-saddānaṃ abyabhicārisambandhatā siddhā.

For in the world too, the unfailing connection of the words "yaṃ" (what) and "taṃ" (that) is established.

Ngay cả trong thế gian, sự liên kết không sai lệch của các từ yaṃ (cái gì) và taṃ (cái đó) cũng được chứng minh.

392

Evaṃ abhisambuddhoti vadāmīti abhisambuddhabhāvassa gahitattā, asabbaññunā evaṃ desetuṃ asakkuṇeyyattā ca ‘‘sabbaññutaññāṇaṃ dassento’’tiādimāha.

"Thus I declare him fully enlightened" (evaṃ abhisambuddhoti vadāmī) is stated because of the assertion of his fully enlightened state, and because it would be impossible for anyone not omniscient to teach in this way, hence the statement "showing omniscient knowledge" and so forth.

Vì đã thành tựu Chánh đẳng giác và vì một vị không phải Toàn tri không thể thuyết giảng như vậy, nên Đức Phật đã nói ‘‘sabbaññutaññāṇaṃ dassento’’ (chỉ bày trí tuệ Toàn tri, v.v.).

393

Vicitranayadesanāvilāsayuttanti puthujjanavārādivibhāgabhinnehi vicittehi tanti nayehi, lakkhaṇakammataṇhāmaññanādivibhāgabhinnehi vicittehi atthanayehi, abhinandanapaccayākārādivisesāpadesasiddhena desanāvilāsena ca yuttaṃ.

"Adorned with various methods of teaching and charm of exposition" (vicitranayadesanāvilāsayuttaṃ) means adorned with various methods of teaching based on different divisions such as the path of ordinary people, with various analytical methods of meaning based on different divisions such as characteristics, functions, craving, and conceit, and with the charm of exposition accomplished by means of special descriptions such as delight and causality.

Vicitranayadesanāvilāsayuttaṃ (được kết hợp với phong cách thuyết giảng đa dạng): được kết hợp với các phương pháp giáo lý đa dạng, khác biệt bởi sự phân chia thành các trường hợp phàm phu, v.v.; với các phương pháp ý nghĩa đa dạng, khác biệt bởi sự phân chia thành đặc tính, nghiệp, tham ái, chấp ngã, v.v.; và với phong cách thuyết giảng được chứng minh bằng sự trình bày đặc biệt về nhân duyên hoan hỷ, v.v.

Yathā te na jānanti, tathā desesīti imināpi bhagavato desanāvilāsaṃyeva vibhāveti.

By "he taught in a way they did not know," the charm of the Buddha's exposition is also elucidated.

Với câu ‘‘Ngài đã thuyết giảng theo cách mà họ không biết’’, điều này cũng làm rõ phong cách thuyết giảng của Đức Thế Tôn.

Taṃyeva kira pathavinti ettha pathavīgahaṇaṃ upalakkhaṇamattaṃ āpādivasenapi, tathā ‘‘kīdisā nu kho idha pathavī adhippetā, kasmā ca bhūtarūpāniyeva gahitāni, na sesarūpānī’’tiādināpi tesaṃ saṃsayuppatti niddhāretabbā.

Here, in "that very earth" (taṃyeva kira pathavi), the mention of earth is merely illustrative, and applies also in terms of water, and so forth. Similarly, their arising of doubt should be determined by questions like "What kind of earth is intended here? And why are only the primary elements (bhūtarūpa) taken, and not the remaining material forms?"

Trong cụm từ Taṃyeva kira pathavi (chính đất đó), việc lấy đất chỉ là một sự tượng trưng, cũng có thể là nước, v.v. Tương tự, sự nghi ngờ của họ cũng có thể được xác định bởi câu hỏi ‘‘Thật sự đất ở đây được ám chỉ là gì, và tại sao chỉ các sắc đại hiển hiện được lấy, mà không phải các sắc còn lại?’’, v.v.

Atha vā kathaṃ nāmidanti ettha iti-saddo pakārattho.

Alternatively, in "how is this" (kathaṃ nāmidaṃ), the word "iti" means "in such a manner."

Hoặc là, trong cụm từ kathaṃ nāmidaṃ (điều này như thế nào), từ iti có nghĩa là cách thức.

Tena imasmiṃ sutte sabbāyapi tesaṃ saṃsayuppattiyā pariggahitattā daṭṭhabbā.

By this, it should be understood that the entire arising of their doubt in this discourse is encompassed.

Với điều đó, cần hiểu rằng tất cả sự nghi ngờ của họ trong bài kinh này đều được bao hàm.

Antanti mariyādaṃ, desanāya antaṃ paricchedanti attho, yo anusandhīti vuccati.

"Antaṃ" (end) means boundary, meaning the limit or demarcation of the teaching, which is called "anusandhi" (connection/sequence).

Antaṃ (cùng tột) có nghĩa là giới hạn, tức là sự phân định, sự kết thúc của bài thuyết giảng, điều mà người ta gọi là sự liên kết (anusandhi).

Koṭinti pariyantaṃ, desanāya pariyosānanti attho.

"Koṭi" (tip) means the extreme end, meaning the conclusion of the teaching.

Koṭiṃ (đỉnh điểm) có nghĩa là điểm cuối, tức là sự chấm dứt của bài thuyết giảng.

Ubhayena sutte ajjhāsayānusandhi yathānusandhīti vadati.

By both, it speaks of the underlying intention and the sequence of the discourse as appropriate to its sequence.

Bằng cả hai, bài kinh nói về sự liên kết giữa ý định và sự liên kết theo đúng sự liên kết.

394

Antarākathāti kammaṭṭhānamanasikārauddesaparipucchādīnaṃ antarā aññā ekā tathā.

"Antarākathā" (an intervening talk) is another such talk occurring between attention to meditation subjects, recitation, questioning, and so forth.

Antarākathā (câu chuyện giữa chừng): là một câu chuyện khác giữa các việc như tác ý đề mục thiền định, trình bày, hỏi đáp, v.v.

Vippakathāti aniṭṭhitā sikhaṃ appattā.

"Vippakathā" (an unfinished talk) means one that is not completed or has not reached its peak.

Vippakathā (câu chuyện chưa hoàn tất): là chưa hoàn tất, chưa đạt đến đỉnh điểm.

Kaṅkhaṇānurūpenāti tasmiṃ khaṇe dhammasabhāyaṃ sannipatitānaṃ bhikkhūnaṃ ajjhāsayānurūpena.

"According to their doubt" (kaṅkhaṇānurūpena) means according to the underlying intentions of the bhikkhus gathered in the Dhamma assembly at that moment.

Kaṅkhaṇānurūpenā (phù hợp với sự nghi ngờ): phù hợp với khuynh hướng của các tỳ khưu đang tụ họp trong pháp đường vào lúc đó.

Idanti idāni vuccamānaṃ mūlapariyāyajātakaṃ.

"Idaṃ" (this) refers to the Mūlapariyāya Jātaka that is now being spoken of.

Idaṃ (điều này): là Mūlapariyāyajātaka (Chuyện tiền thân về các yếu tố gốc rễ) đang được nói đến bây giờ.

395

Disāpāmokkhoti paṇḍitabhāvena sabbadisāsu pamukhabhūto.

"Disāpāmokkho" (foremost in all directions) means prominent in all directions due to his wisdom.

Disāpāmokkho (nổi bật khắp các phương): là người nổi bật khắp các phương nhờ sự thông thái.

Brāhmaṇoti brahmaṃ aṇatīti brāhmaṇo, mante sajjhāyatīti attho.

"Brāhmaṇo" (brahmin) means one who "aṇati" (proclaims) "brahma" (sacred knowledge), meaning one who recites the Vedas.

Brāhmaṇo (Bà-la-môn): là brāhmaṇo vì brahmaṃ aṇati (hít thở Phạm thiên), tức là người tụng đọc các thánh ca (mantra).

Tiṇṇaṃ vedānanti iruveda-yajuveda-sāmavedānaṃ.

"Of the three Vedas" (tiṇṇaṃ vedānaṃ) refers to the Ṛgveda, Yajurveda, and Sāmaveda.

Tiṇṇaṃ vedānaṃ (của ba bộ Veda): của Rig Veda, Yajur Veda, Sāma Veda.

Pāragūti atthaso byañjanaso ca pāraṃ pariyantaṃ gato.

"Pāragū" (gone to the far shore) means one who has reached the end both in terms of meaning and letters.

Pāragūti (đã đạt đến bờ bên kia): đã đạt đến bờ bên kia, tức là sự kết thúc, cả về nghĩa lẫn văn tự.

Saha nighaṇḍunā ca keṭubhena cāti sanighaṇḍukeṭubhā, tesaṃ.

"Sanighaṇḍukeṭubhā" means together with the nighaṇḍu and keṭubha, meaning of those.

Sanighaṇḍukeṭubhā (cùng với từ điển và nghi thức): của những điều đó.

Nighaṇḍūti rukkhādīnaṃ vevacanappakāsakaṃ satthaṃ.

"Nighaṇḍū" is the scripture that explains synonyms for trees and so forth.

Nighaṇḍū (từ điển): là một bộ kinh điển giải thích các từ đồng nghĩa của cây cối, v.v.

Keṭubhanti kiriyākappavikappo, kavīnaṃ upakārāvahaṃ satthaṃ.

"Keṭubha" refers to the analysis of grammatical actions and formations, a scripture helpful to poets.

Keṭubhaṃ (nghi thức): là sự lựa chọn hành động và nghi lễ, một bộ kinh điển có lợi cho các nhà thơ.

Saha akkharappabhedenāti sākkharappabhedā, tesaṃ, sikkhāniruttisahitānanti attho.

"Sākkharappabhedā" means together with the analysis of letters, meaning together with phonetics and etymology, of those.

Sākkharappabhedā (cùng với sự phân tích chữ cái): của những điều đó, tức là cùng với sikkhā (ngữ âm học) và nirutti (ngữ pháp).

Itihāsapañcamānanti āthabbaṇavedaṃ catutthaṃ katvā ‘‘itiha asa, itiha asā’’ti īdisavacanapaṭisaṃyutto purāṇakathāsaṅkhāto itihāso pañcamo etesanti itihāsapañcamā, tesaṃ.

"Itihāsapañcamānaṃ" means those for whom the Itihāsa (history), consisting of ancient tales connected with phrases like "it was thus, it was thus," is the fifth, making the Atharvaveda the fourth; of those.

Itihāsapañcamānaṃ (cùng với itihāsa là thứ năm): là những điều mà Atharva Veda là thứ tư, và itihāsa (lịch sử), tức là những câu chuyện cổ xưa liên quan đến các lời nói như ‘‘đã từng là như vậy, đã từng là như vậy’’, là thứ năm.

Padaṃ tadavasesañca byākaraṇaṃ kāyati ajjheti vedeti cāti padako, veyyākaraṇo.

"Padako" (grammarian) means one who studies, explains, and knows the words and the remaining grammar.

Padako (người phân tích từ): là người nghiên cứu, giảng giải các từ và ngữ pháp còn lại, tức là nhà ngữ pháp.

Lokāyataṃ vuccati vitaṇḍasatthaṃ.

"Lokāyataṃ" is called the sophisticated reasoning (vitaṇḍasatthaṃ).

Lokāyataṃ (Thế tục luận) được gọi là khoa học ngụy biện.

Mahāpurisānaṃ buddhādīnaṃ lakkhaṇadīpanagantho mahāpurisalakkhaṇaṃ.

"Mahāpurisalakkhaṇaṃ" (marks of a great man) is the text that describes the characteristics of great men like the Buddhas.

Mahāpurisalakkhaṇaṃ (Đại nhân tướng): là bộ kinh điển mô tả các đặc điểm của các bậc đại nhân như chư Phật.

Tesu anūno paripūrakārīti anavayo.

"Anavayo" (perfect) means one who is complete and perfect in them.

Anavayo (không thiếu sót): là người không thiếu sót, hoàn thành đầy đủ trong những điều đó.

396

Manteti vede.

"Mante" means the Vedas.

Mante (các thánh ca): là các kinh Veda.

Yadipi vedo ‘‘manto, brahmaṃ, kappo’’ti tividho, manto eva pana mūlavedo, tadatthavivaraṇaṃ brahmaṃ, tattha vuttanayena yaññakiriyāvidhānaṃ kappo.

Although the Veda is threefold as "manta," "brahma," and "kappo," the "manta" is indeed the root Veda, "brahma" is its explanation of meaning, and "kappo" is the prescribed ritual of sacrifice as stated therein.

Mặc dù Veda có ba loại: manto (thánh ca), brahmaṃ (thần chú), kappo (nghi lễ), nhưng manto là Veda gốc, brahmaṃ là sự giải thích ý nghĩa của nó, và kappo là các quy định về nghi lễ hy sinh được nói đến trong đó.

Tena vuttaṃ ‘‘manteti vede’’ti.

Therefore, it is said "mante means the Vedas."

Do đó, đã nói ‘‘manteti vede’’ (các thánh ca là Veda).

Paṇḍitāti paññāvanto.

"Paṇḍitā" (wise) means those possessing wisdom.

Paṇḍitā (những người trí tuệ): là những người có trí tuệ.

Tathā hi te puthupaññātāya bahuṃ sahassadvisahassādiparimāṇaṃ ganthaṃ pākaṭaṃ katvā gaṇhanti uggaṇhanti, javanapaññatāya lahuṃ sīghaṃ gaṇhanti, tikkhapaññatāya suṭṭhu avirajjhantā upadhārenti, satinepakkasampattiyā gahitañca nesaṃ na vinassati na sammussatīti.

For indeed, being widely wise, they take up and learn "much" (bahuṃ) scripture, amounting to one or two thousand units, by making it manifest; being swift in wisdom, they take it up "quickly" (lahuṃ); being sharp in wisdom, they "retain it well" (suṭṭhu), without forgetting; and by virtue of their mindfulness and sagacity, "what they have grasped does not perish" (gahitañca nesaṃ na vinassati) or fade away.

Thật vậy, nhờ trí tuệ rộng lớn, họ gaṇhanti (nắm giữ), tức là học thuộc lòng, bahuṃ (nhiều) kinh điển với số lượng hàng ngàn, hai ngàn, v.v., bằng cách làm cho chúng hiển nhiên. Nhờ trí tuệ nhanh nhạy, họ lahuṃ (nhanh chóng) gaṇhanti (nắm giữ). Nhờ trí tuệ sắc bén, họ suṭṭhu (tốt đẹp), không sai sót, upadhārenti (ghi nhớ). Và nhờ sự thành tựu của niệm và sự khéo léo, gahitañca nesaṃ na vinassati (những gì họ đã nắm giữ không bị mất đi), không bị lãng quên.

Sabbampi sippanti aṭṭhārasavijjāṭṭhānādibhedaṃ sikkhitabbaṭṭhena sippanti saṅkhyaṃ gataṃ sabbaṃ bāhirakasatthaṃ mokkhāvahasammatampi na mokkhaṃ āvahatīti āha ‘‘diṭṭhadhammasamparāyahita’’nti.

"All crafts" (sabbampi sippaṃ), referring to all external sciences classified as crafts because they are to be learned, such as the eighteen branches of knowledge, even those considered conducive to liberation, do not lead to liberation. Therefore, it is said "for benefit in this life and the next" (diṭṭhadhammasamparāyahitaṃ).

Sabbampi sippaṃ (tất cả các nghề): tất cả các khoa học thế tục được gọi là sippa (nghề) vì chúng cần được học, bao gồm mười tám ngành học, v.v., ngay cả những điều được cho là dẫn đến giải thoát cũng không dẫn đến giải thoát. Do đó, Đức Phật đã nói ‘‘diṭṭhadhammasamparāyahita’’ (có lợi trong hiện tại và tương lai).

Sampiṇḍitā hutvāti yathā mittā, tathā piṇḍitavasena sannipatitā hutvā.

"Sampiṇḍitā hutvā" (having become united) means having gathered together as friends, united.

Sampiṇḍitā hutvā (đã tụ họp lại): đã tụ họp lại như những người bạn, tức là đã tập hợp lại.

‘‘Evaṃ gayhamāne ādinā virujjheyya, evaṃ antenā’’ti cintentā ñātuṃ icchitassa atthassa pubbenāparaṃ aviruddhaṃ nicchayaṃ gahetuṃ asakkontā na ādiṃ, na antaṃ addasaṃsu.

Thinking, "If understood this way, it would contradict the beginning; if understood that way, it would contradict the end," and being unable to grasp a consistent conclusion for the meaning they wished to know, "they did not see the beginning" (na ādiṃ) nor the end.

Họ không thấy na ādiṃ (không thấy phần đầu), không thấy phần cuối, vì họ không thể đưa ra quyết định không mâu thuẫn giữa phần trước và phần sau của ý nghĩa mà họ muốn biết, trong khi suy nghĩ ‘‘nếu được hiểu như vậy, nó sẽ mâu thuẫn với phần đầu, nếu được hiểu như vậy, nó sẽ mâu thuẫn với phần cuối’’.

397

Lomasānīti lomavantāni, ghanakesamassuvānīti attho.

"Lomasānī" (hairy) means possessing hair, meaning with thick hair and beards.

Lomasānī (có lông): có lông, tức là có râu tóc dày đặc.

Kesāpi hi lomaggahaṇena gayhanti yathā ‘‘lomanakhaṃ phusitvā suddhi kātabbā’’ti.

Hair (kesā) is also included by the term "loma" (body hair), as in "purity should be made by touching hair and nails."

Thật vậy, tóc cũng được bao gồm trong việc lấy lông, như trong ‘‘sau khi chạm vào lông và móng, phải thực hiện sự thanh tịnh’’.

Kaṇṇaṃ viyāti kaṇṇaṃ, paññā, tāya sutvā kātabbakiccasādhanato vuttaṃ ‘‘kaṇṇavāti paññavā’’ti.

"Kaṇṇaṃ" (ear) is like the ear, meaning wisdom; because it accomplishes what needs to be done by hearing through it, it is said "kaṇṇavā means possessing wisdom."

Kaṇṇaṃ (tai) như tai, tức là trí tuệ. Đã nói ‘‘kaṇṇavāti paññavā’’ (người có tai là người có trí tuệ) vì nhờ trí tuệ mà các việc cần làm sau khi nghe được thực hiện.

398

Yasmā sattānaṃ gacchante gacchante kāle āyuvaṇṇādiparikkhayo hoti, tasmā taṃ kālena kataṃ viya katvā vuttaṃ ‘‘nesaṃ āyu…pe… khādatīti vuccatī’’ti.

Since the lifespan and beauty of beings diminish as time passes, it is spoken of as if done by time itself when it says, "their lifespan... and so on... is said to consume."

Vì khi thời gian trôi qua, tuổi thọ, sắc đẹp, v.v., của chúng sinh bị suy giảm, nên điều đó được nói như thể đã được thời gian thực hiện: ‘‘nesaṃ āyu…pe… khādatīti vuccatī’’ (tuổi thọ của họ… v.v… được nói là ăn mòn).

399

Abhiññāyāti kusalādibhedaṃ khandhādibhedañca desetabbaṃ dhammaṃ, veneyyānañca āsayānusayacariyāvimuttiādibhedaṃ, tassa ca nesaṃ desetabbappakāraṃ yāthāvato abhijānitvā.

"Abhiññāyā" (having directly known) means having truly known the Dhamma to be taught, with its divisions into wholesome and unwholesome, and into aggregates and so forth, and having truly known the dispositions, latent tendencies, conduct, and liberation of those to be trained, and the manner of teaching it to them.

Abhiññāyā (sau khi liễu tri): sau khi liễu tri một cách chân thật pháp cần thuyết giảng, bao gồm các loại thiện và bất thiện, các loại uẩn, v.v., và các loại khuynh hướng, tùy miên, hành vi, giải thoát, v.v., của những người có thể giác ngộ, và cách thức thuyết giảng cho họ.

Dhammaṃ desemīti diṭṭhadhammikasamparāyikanibbānahitāvahaṃ saddhammaṃ kathayāmi.

"Dhammaṃ desemī" (I teach the Dhamma) means I explain the true Dhamma that leads to welfare in this life, the next life, and to Nibbāna.

Dhammaṃ desemī (tôi thuyết giảng pháp): tôi thuyết giảng Chánh pháp mang lại lợi ích trong hiện tại, tương lai và Niết Bàn.

No anabhiññāyāti yathā bāhirakā asammāsambuddhattā vuttavidhiṃ ajānantāyaṃ kiñci takkapariyāhataṃ vīmaṃsānucaritaṃ sayaṃpaṭibhānaṃ kathenti, evaṃ na desemīti attho.

"No anabhiññāyā" (not without direct knowledge) means I do not teach as external teachers do, who, being not perfectly enlightened, teach something conceived by speculation, examined by inquiry, or spontaneously composed, out of ignorance of the aforementioned method.

No anabhiññāyā (không phải không liễu tri): có nghĩa là tôi không thuyết giảng như những người ngoại đạo, vì không phải là Chánh đẳng giác, không biết phương pháp đã nói ở trên, họ thuyết giảng một cách suy đoán, dò xét, tự sáng tạo ra một điều gì đó.

Sanidānanti sakāraṇaṃ, veneyyānaṃ ajjhāsayavasena vā pucchāya vā aṭṭhuppattiyā vā sanimittaṃ hetuudāharaṇasahitañcāti attho.

Sanidāna means with a cause, or with an origin due to the inclinations of the trainees, or due to a question, or due to a specific occasion, accompanied by reasons and examples.

Sanidāna có nghĩa là có nguyên nhân, có lý do; hoặc có dấu hiệu do khuynh hướng của những người cần được giáo hóa, hoặc do câu hỏi, hoặc do sự việc phát sinh; có nghĩa là kèm theo lý do và ví dụ.

Sappāṭihāriyanti sanissaraṇaṃ sappaṭiharaṇaṃ, paccanīkapaṭiharaṇena sappāṭihāriyameva katvā desemīti attho.

Sappāṭihāriya means with an escape, with a repelling, the meaning being: "I teach it, making it indeed a marvel by repelling adversaries."

Sappāṭihāriya có nghĩa là có sự xuất ly, có sự đẩy lùi; có nghĩa là tôi thuyết giảng bằng cách đẩy lùi các đối thủ, khiến nó trở nên có phép lạ.

Apare pana ‘‘yathārahaṃ iddhiādesanānusāsanipāṭihāriyasahita’’nti vadanti, anusāsanipāṭihāriyahitā pana desanā natthīti.

Others, however, say, "accompanied by appropriate psychic power, mind-reading, and instructional marvels," but there is no teaching that is devoid of the instructional marvel.

Những người khác thì nói rằng “kèm theo thần thông, sự chỉ dẫn và sự giáo huấn một cách thích đáng”, nhưng không có bài thuyết giảng nào kèm theo phép lạ giáo huấn.

Hitūpadesanā ovādo, sā eva anusāsanī.

Wholesome instruction is ovāda; that same is anusāsanī.

Sự khuyên răn hữu ích là ovāda, chính nó là anusāsanī.

Anotiṇṇavatthuvisayo vā ovādo, otiṇṇavatthuvisayā anusāsanī.

Or, instruction concerning an unentered subject is ovāda; instruction concerning an entered subject is anusāsanī.

Hoặc ovāda là đối tượng chưa đi sâu vào chi tiết, anusāsanī là đối tượng đã đi sâu vào chi tiết.

Paṭhamūpadeso vā ovādo, itarā anusāsanī.

Or, initial instruction is ovāda; the other is anusāsanī.

Hoặc lời khuyên đầu tiên là ovāda, còn lại là anusāsanī.

Alañca panāti yuttameva.

Alañca pana means it is proper.

Alañca pana có nghĩa là thích hợp.

Niṭṭhamagamāsīti atthasiddhiṃ gatā.

Niṭṭhamagamāsī means it reached completion.

Niṭṭhamagamāsī có nghĩa là đạt được sự thành tựu mục đích.

400

Tathāgatavāraaṭṭhamanayavaṇṇanā niṭṭhitā.

The explanation of the eighth method in the Tathāgata section is concluded.

Phần giải thích về tám phương pháp của Như Lai đã hoàn tất.

401

Ayaṃ tāvettha aṭṭhakathāya līnatthavaṇṇanā.

This is the explanation of the profound meanings from the Commentary here.

Đây là phần giải thích ý nghĩa ẩn của Chú giải ở đây.

402

Nettinayavaṇṇanā

Explanation of the Netti Method

Giải thích về phương pháp Netti

403

Idāni (dī. ni. ṭī. 1.149; saṃ. ni. ṭī. 1.1.nettinayavaṇṇanā; a. ni. ṭī. nettinayavaṇṇanā) pakaraṇanayena pāḷiyā atthavaṇṇanaṃ karissāma.

Now, we shall explain the meaning of the Pāli text according to the method of the treatise.

Bây giờ, chúng tôi sẽ thực hiện việc giải thích ý nghĩa của Pāḷi theo phương pháp của bộ luận (Netti).

Sā panāyaṃ atthavaṇṇanā yasmā desanāya samuṭṭhānapayojanabhājanesu piṇḍatthesu ca niddhāritesu sutarā hoti suviññeyyā ca, tasmā suttadesanāya samuṭṭhānādīni paṭhamaṃ niddhārayissāma.

Since this explanation of meaning becomes more readily comprehensible and easily understood when the origin, purpose, and aggregate meanings of the teaching are determined, we shall first determine the origin and so forth of the discourse.

Vì sự giải thích ý nghĩa này sẽ dễ hiểu hơn nhiều khi đã xác định được sự phát sinh, mục đích và các ý nghĩa tổng quát trong các phần của bài thuyết giảng, nên trước tiên chúng tôi sẽ xác định sự phát sinh và các yếu tố khác của bài thuyết giảng.

Tattha samuṭṭhānaṃ tāva pariyattiṃ nissāya mānuppādo, payojanaṃmānamaddanaṃ.

Among these, origin is the arising of conceit based on learning; purpose is the subduing of conceit.

Trong đó, samuṭṭhāna (sự phát sinh) là sự phát khởi của kiêu mạn dựa vào sự học hỏi; payojana (mục đích) là sự dập tắt kiêu mạn.

Vuttañhi aṭṭhakathāyaṃ ‘‘sutapariyattiṃ…pe… ārabhī’’ti.

For it is said in the Commentary: "Regarding the learning... began."

Trong Chú giải có nói: “Đức Thế Tôn đã bắt đầu… do sự học hỏi…”.

Apica veneyyānaṃ pathavīādibhūtādibhedabhinne sakkāye puthujjanassa sekkhādiariyassa ca saddhiṃ hetunā maññanāmaññanavasena pavattivibhāgānavabodho samuṭṭhānaṃ, yathāvuttavibhāgāvabodho payojanaṃ, veneyyānañhi vuttappakāre visaye yathāvuttānaṃ puggalānaṃ saddhiṃ hetunā maññanāmaññanavasena pavattivibhāgāvabodho payojanaṃ.

Furthermore, origin is the non-comprehension of the distinction in the course of action (maññanā-maññanāvasena) with its causes, regarding conceit and non-conceit, among ordinary individuals and noble disciples such as trainees, concerning the aggregate of existence (sakkāya) differentiated by elements such as earth and so forth; purpose is the comprehension of the aforementioned distinction, for indeed, the comprehension of the distinction in the course of action regarding conceit and non-conceit, with its causes, among individuals as mentioned in the specified domain, is the purpose.

Hơn nữa, samuṭṭhāna là sự không nhận thức được sự phân chia hoạt động dựa trên sự kiêu mạn và không kiêu mạn, cùng với nguyên nhân, trong sắc thân được phân loại thành các yếu tố như đất và các đại chủng khác, của phàm nhân và của bậc Thánh như bậc hữu học; payojana là sự nhận thức được sự phân chia hoạt động như đã nói. Đối với những người cần được giáo hóa, sự nhận thức được sự phân chia hoạt động dựa trên sự kiêu mạn và không kiêu mạn, cùng với nguyên nhân, của những người như đã nói trong đối tượng như đã trình bày là payojana.

404

Apica samuṭṭhānaṃ nāma desanānidānaṃ.

Furthermore, origin means the cause of the teaching.

Hơn nữa, samuṭṭhāna là nguyên nhân của bài thuyết giảng.

Taṃ sādhāraṇaṃ asādhāraṇanti duvidhaṃ.

That is twofold: common and uncommon.

Nó có hai loại: chung và không chung.

Tattha sādhāraṇampi ajjhattikabāhirabhedato duvidhaṃ.

Among these, the common is also twofold due to the distinction of internal and external.

Trong đó, loại chung cũng có hai loại do sự phân biệt nội tại và bên ngoài.

Tattha sādhāraṇaṃ ajjhattikasamuṭṭhānaṃ nāma lokanāthassa mahākaruṇā.

Among these, the common internal origin is the Great Compassion of the Protector of the World.

Trong đó, samuṭṭhāna nội tại chung là đại bi của Đấng Cứu Thế.

Tāya hi samussāhitassa bhagavato veneyyānaṃ dhammadesanāya cittaṃ udapādi.

Indeed, spurred by that, a thought arose in the Blessed One to teach the Dhamma to trainees.

Chính nhờ đại bi đó mà tâm của Đức Thế Tôn đã phát khởi để thuyết giảng Dhamma cho những người cần được giáo hóa.

Taṃ sandhāya vuttaṃ ‘‘sattesu ca kāruññataṃ paṭicca buddhacakkhunā lokaṃ volokesī’’tiādi (ma. ni. 1.283; saṃ. ni. 1.172; mahāva. 9).

With reference to this, it is said: "Out of compassion for beings, he surveyed the world with his Buddha-eye," and so forth.

Liên quan đến điều đó, có lời nói: “Vì lòng từ bi đối với chúng sinh, Ngài đã quán sát thế gian bằng Phật nhãn” và vân vân.

Ettha ca hetāvatthāyapi mahākaruṇāya saṅgaho daṭṭhabbo yāvadeva saṃsāramahoghato saddhammadesanāhatthadānehi sattasantāraṇatthaṃ taduppattito.

And here, the inclusion of Great Compassion in the causal state should be understood, that is, for the purpose of helping beings cross the great flood of saṃsāra by offering the hand of the teaching of the good Dhamma, from the arising of that.

Ở đây, cần phải hiểu rằng đại bi cũng được bao gồm trong trạng thái nhân, cho đến khi nó phát sinh để cứu độ chúng sinh khỏi biển lớn luân hồi bằng cách ban tặng cánh tay giáo pháp.

Yathā ca mahākaruṇā, evaṃ sabbaññutaññāṇaṃ dasabalañāṇādīni ca desanāya abbhantarasamuṭṭhānabhāve vattabbāni.

Just as Great Compassion, so too Omniscience, the ten powers, and other knowledges should be stated as internal origins of the teaching.

Cũng như đại bi, trí tuệ Toàn Tri, trí tuệ Thập Lực và các trí tuệ khác cũng phải được nói là những samuṭṭhāna nội tại của bài thuyết giảng.

Sabbampi hi ñeyyadhammaṃ, tesaṃ desetabbappakāraṃ, sattānañca āsayānusayādiṃ yāthāvato jānanto bhagavā ṭhānāṭṭhānādīsu kosallena veneyyajjhāsayānurūpaṃ vicittanayadesanaṃ pavattesīti.

For the Blessed One, knowing all knowable phenomena, the manner of teaching them, and the inclinations and underlying tendencies of beings as they truly are, skillfully engaged in diverse methods of teaching in accordance with the inclinations of trainees, with expertise in what is appropriate and inappropriate, and so forth.

Vì Đức Thế Tôn, khi biết rõ tất cả các pháp cần được biết, cách thức thuyết giảng chúng, và khuynh hướng, tùy miên của chúng sinh, đã thuyết giảng những bài thuyết giảng với nhiều phương pháp khác nhau phù hợp với khuynh hướng của những người cần được giáo hóa, với sự khéo léo trong các trường hợp đúng và không đúng.

Bāhiraṃ pana sādhāraṇaṃ samuṭṭhānaṃ dasasahassabrahmaparivāritassa sahampatimahābrahmuno ajjhesanaṃ.

The external common origin, however, is the request of Sahampati Great Brahmā, surrounded by ten thousand Brahmās.

Còn samuṭṭhāna bên ngoài chung là lời thỉnh cầu của Đại Phạm Thiên Sahampati, được bao quanh bởi mười ngàn chư Phạm Thiên.

Tadajjhesanuttarakālañhi dhammagambhīratāpaccavekkhaṇājanitaṃ appossukkataṃ paṭippassambhetvā dhammassāmī dhammadesanāya ussāhajāto ahosi.

Indeed, after that request, the Master of Dhamma, having allayed the disinclination arising from his contemplation of the profoundness of the Dhamma, became eager to teach the Dhamma.

Sau lời thỉnh cầu đó, Đức Pháp Chủ đã dẹp bỏ sự ít quan tâm phát sinh từ việc quán xét sự thâm sâu của Dhamma, và trở nên hăng hái thuyết giảng Dhamma.

Asādhāraṇampi ambhantarabāhirabhedato duvidhameva.

The uncommon is also twofold, due to the distinction of internal and external.

Loại không chung cũng có hai loại: nội tại và bên ngoài.

Tattha abbhantaraṃ yāya mahākaruṇāya yena ca desanāñāṇena idaṃ suttaṃ pavattitaṃ, tadubhayaṃ veditabbaṃ.

Among these, the internal should be understood as both the Great Compassion and the knowledge of teaching by which this Sutta was brought forth.

Trong đó, nội tại là đại bi và trí tuệ thuyết giảng mà nhờ đó bài kinh này được thuyết giảng, cả hai điều đó cần được biết.

Bāhiraṃ pana pañcasatānaṃ brāhmaṇajātikānaṃ bhikkhūnaṃ pariyattiṃ nissāya mānuppādanaṃ, vuttameva taṃ aṭṭhakathāyaṃ.

The external, however, is the arising of conceit in five hundred Brahmin-born bhikkhus based on learning; this has been stated in the Commentary.

Còn bên ngoài là sự phát khởi kiêu mạn dựa vào sự học hỏi của năm trăm Tỳ khưu gốc Bà la môn, điều đó đã được nói trong Chú giải.

405

Payojanampi sādhāraṇaṃ asādhāraṇanti duvidhaṃ.

Purpose is also twofold: common and uncommon.

Payojana cũng có hai loại: chung và không chung.

Tattha sādhāraṇaṃ anukkamena yāva anupādāparinibbānaṃ vimuttirasattā bhagavato desanāya.

Among these, the common purpose of the Blessed One's teaching is the taste of liberation, leading gradually to Nibbāna without clinging.

Trong đó, chung là mục đích của bài thuyết giảng của Đức Thế Tôn, đó là hương vị giải thoát cho đến Niết Bàn không chấp thủ, theo thứ tự.

Tenevāha ‘‘etadatthā tathā, etadatthā mantanā’’tiādi (pari. 366).

Therefore, he said: "This is the purpose of the Tathāgata, this is his counsel," and so forth.

Vì thế Ngài nói: “Vì mục đích này là như vậy, vì mục đích này là sự suy tư” và vân vân.

Eteneva ca saṃsāracakkanivatti saddhammacakkappavatti sassatādimicchāvādanirākaraṇaṃ sammāvādapurekkhāro akusalamūlasamūhananaṃ kusalamūlasaṃropanaṃ apāyadvārapidahanaṃ saggamokkhadvāravivaraṇaṃ pariyuṭṭhānavūpasamanaṃ anusayasamugghātanaṃ ‘‘mutto mocessāmī’’ti (udā. aṭṭha. 18; itivu. aṭṭha. 38) purimapaṭiññāavisaṃvādanaṃ tappaṭipakkhamāramanorathavisaṃvādanaṃ titthiyadhammanimmathanaṃ buddhadhammapatiṭṭhāpananti evamādīnampi payojanānaṃ saṅgaho daṭṭhabbo.

By this, the cessation of the cycle of saṃsāra, the setting in motion of the wheel of the good Dhamma, the refutation of wrong views such as eternalism, the promotion of right view, the uprooting of unwholesome roots, the cultivation of wholesome roots, the closing of the doors to lower realms, the opening of the doors to heaven and liberation, the appeasement of defilements, the eradication of underlying tendencies, the fulfilling of the former promise "I, who am liberated, shall liberate others," the frustration of the desires of Māra, the crushing of sectarian doctrines, and the establishment of the Buddha's teaching—the inclusion of these and similar purposes should be understood.

Cũng bằng cách này, cần phải hiểu rằng các mục đích như sự chấm dứt bánh xe luân hồi, sự vận hành bánh xe Chánh Pháp, sự loại bỏ các tà kiến như thường kiến, sự đề cao Chánh kiến, sự nhổ tận gốc các căn bất thiện, sự gieo trồng các căn thiện, sự đóng cửa các đường ác, sự mở cửa thiên giới và giải thoát, sự làm dịu các phiền não, sự diệt trừ các tùy miên, sự không trái lời hứa trước “đã giải thoát sẽ giải thoát” (Udāna Aṭṭhakathā 18; Itivuttaka Aṭṭhakathā 38), sự làm trái ý muốn của Māra đối địch, sự nghiền nát giáo pháp của các ngoại đạo, sự thiết lập Phật Pháp, v.v., cũng được bao gồm.

Asādhāraṇaṃ pana tesaṃ bhikkhūnaṃ mānamaddanaṃ.

The uncommon purpose, however, is the subduing of conceit in those bhikkhus.

Còn không chung là sự dập tắt kiêu mạn của các Tỳ khưu đó.

Vuttañcetaṃ aṭṭhakathāyaṃ (ma. ni. aṭṭha. 1.1) ‘‘desanākusalo bhagavā mānabhañjanatthaṃ ‘sabbadhammamūlapariyāya’nti desanaṃ ārabhī’’ti.

And this is stated in the Commentary: "The Blessed One, skilled in teaching, began the discourse 'The Root of All Phenomena' for the purpose of breaking conceit."

Điều này đã được nói trong Chú giải (Majjhima Nikāya Aṭṭhakathā 1.1): “Đức Thế Tôn, bậc thiện xảo trong thuyết giảng, đã bắt đầu bài thuyết giảng ‘Sabbadhammamūlapariyāya’ để phá vỡ kiêu mạn”.

Ubhayampetaṃ bāhiyameva.

Both of these are external.

Cả hai điều này đều là bên ngoài.

Sace pana veneyyasantānagatampi desanābalasiddhisaṅkhātaṃ payojanaṃ adhippāyasamijjhanabhāvato yathādhippetatthasiddhiyā yathākāruṇikassa bhagavatopi payojanamevāti gaṇheyya, iminā pariyāyenassa abbhantaratāpi veditabbā.

However, if one were to consider that the purpose, which is the attainment of the power of teaching in the mental continuum of the trainees, is also a purpose for the compassionate Blessed One because it signifies the fulfillment of his intention and the achievement of the intended goal, then by this reasoning, its internal nature should also be understood.

Tuy nhiên, nếu người ta chấp nhận rằng mục đích liên quan đến dòng tâm thức của những người cần được giáo hóa, tức là sự thành tựu nhờ sức mạnh của bài thuyết giảng, cũng là mục đích của Đức Thế Tôn, bậc từ bi, vì sự thành tựu ý nghĩa như mong muốn, thì theo cách này, tính nội tại của nó cũng cần được biết.

406

Apica veneyyānaṃ pathavīādibhūtādivibhāgabhinne sakkāye puthujjanassa sekkhādiariyassa ca saddhiṃ hetunā maññanāmaññanavasena pavattivibhāgānavabodho samuṭṭhānaṃ, imassa suttassa yathāvuttavibhāgāvabodho payojananti vuttovāyamattho.

Furthermore, the non-comprehension of the distinction in the course of action (maññanā-maññanāvasena) with its causes, regarding conceit and non-conceit, among ordinary individuals and noble disciples such as trainees, concerning the aggregate of existence (sakkāya) differentiated by elements such as earth and so forth, is the origin; the comprehension of the aforementioned distinction of this Sutta is the purpose – this meaning has already been stated.

Hơn nữa, ý nghĩa này đã được nói: sự không nhận thức được sự phân chia hoạt động dựa trên sự kiêu mạn và không kiêu mạn, cùng với nguyên nhân, trong sắc thân được phân loại thành các yếu tố như đất và các đại chủng khác, của phàm nhân và của bậc Thánh như bậc hữu học là samuṭṭhāna; sự nhận thức được sự phân chia hoạt động như đã nói của bài kinh này là payojana.

Veneyyānañhi vuttappakāre visaye yathāvuttānaṃ puggalānaṃ saddhiṃ hetunā maññanāmaññanānaṃ vasena pavattivibhāgāvabodho imaṃ desanaṃ payojeti ‘‘tannipphādanaparāyaṃ desanā’’ti katvā.

For indeed, the comprehension of the distinction in the course of action regarding conceit and non-conceit, with their causes, among individuals as mentioned in the specified domain, drives this teaching, understanding that "this teaching is for accomplishing that."

Đối với những người cần được giáo hóa, sự nhận thức được sự phân chia hoạt động dựa trên sự kiêu mạn và không kiêu mạn, cùng với nguyên nhân, của những người như đã nói trong đối tượng như đã trình bày, thúc đẩy bài thuyết giảng này, coi rằng “bài thuyết giảng này nhằm mục đích thành tựu điều đó”.

Yañhi desanāya sādhetabbaṃ phalaṃ, taṃ ākaṅkhitabbattā desakaṃ desanāya payojetīti payojananti vuccati.

For the fruit to be achieved by the teaching, being desired, prompts the teacher to teach, and thus it is called a purpose.

Quả mà bài thuyết giảng cần đạt được, vì nó được mong muốn, nên nó thúc đẩy người thuyết giảng trong bài thuyết giảng, do đó nó được gọi là payojana.

Tathā veneyyānaṃ sabbaso ekadesato ca maññanānaṃ appahānaṃ, tattha ca ādīnavādassanaṃ, niraṅkusānaṃ maññanānaṃ anekākāravohārassa sakkāye pavattivisesassa ajānanaṃ, tattha ca pahīnamaññanānaṃ paṭipattiyā ajānanaṃ, taṇhāmukhena paccayākārassa ca anavabodhoti evamādīni ca payojanāni idha veditabbāni.

Similarly, the non-abandonment of conceits, either entirely or partially, in trainees, the non-seeing of danger therein, the non-recognition of the diverse expressions and specific courses of action of unbridled conceits in the aggregate of existence, the non-recognition of the practice for abandoned conceits therein, and the non-comprehension of the mode of condition through the door of craving—these and similar purposes should be understood here.

Tương tự, sự không từ bỏ hoàn toàn hoặc một phần kiêu mạn của những người cần được giáo hóa, sự không thấy được sự nguy hiểm trong đó, sự không biết được sự phân biệt đặc biệt trong hoạt động của các cách nói khác nhau của kiêu mạn không bị kiểm soát trong sắc thân, sự không biết được thực hành của những người đã từ bỏ kiêu mạn, và sự không nhận thức được hình thức nhân duyên thông qua ái dục, v.v., những mục đích như vậy cũng cần được biết ở đây.

407

Bhūmittayapariyāpannesu asaṅkhātadhammavippakatapariññādikiccasaṅkhātadhammānaṃ sammāsambuddhassa ca paṭipattiṃ ajānantā asaddhammassavanadhāraṇaparicayamanasikāraparā saddhammassavana-dhāraṇaparicayapaṭivedhavimukhā ca veneyyā imissā desanāya bhājanaṃ.

Those who are amenable to instruction, not knowing the practice of a Perfectly Self-Enlightened Buddha concerning conditioned and unconditioned phenomena and the task of perfect understanding included in the three realms, who are devoted to hearing, retaining, associating with, and reflecting on ignoble teachings, and who are averse to hearing, retaining, associating with, and realizing the Noble Teaching, are worthy recipients of this discourse.

Những người có thể được giáo hóa, không biết sự thực hành của Đức Chánh Đẳng Giác đối với các pháp vô vi và các pháp hữu vi bao gồm các hành động như sự hiểu biết toàn diện, chuyên tâm vào việc nghe, ghi nhớ, thực hành và tác ý sai pháp, và quay lưng lại với việc nghe, ghi nhớ, thực hành và thể nhập chánh pháp, là đối tượng thích hợp cho bài giảng này.

Piṇḍatthā pana ‘‘assutavā’’tiādinā ayonisomanasikārabahulīkāro akusalamūla-samāyogo olīyanātidhāvanāpariggaho upāyavinibaddhānubrūhanā micchābhinivesasamannāgamo avijjātaṇhā-parisuddhi vaṭṭattayānuparamo āsavoghayogaganthāgatitaṇhuppādupādānāviyogo cetokhila-cetovinibaddhaabhinandana-nīvaraṇasaṅgānatikkamo vivādamūlāpariccāgo anusayānupacchedo micchattānativattanaṃ taṇhāmūladhammasannissayatā akusalakammapathānuyogo sabbakilesa-pariḷāhasāraddhakāyacittatāti evamādayo dīpitā honti.

However, in brief, beginning with "the uninstructed," the prevalence of unwise attention, association with roots of unwholesomeness, depression and agitation, non-comprehension, cultivation bound by wrong means, adherence to wrong views, the defilement of ignorance and craving, the cessation of the three rounds of existence, release from the āsavas, floods, yokes, knots, attachments, and the arising of craving and clinging, transcendence of mental barrenness, mental fetters, delight, hindrances, and attachments, non-abandonment of the roots of contention, non-eradication of latent tendencies, non-transgression of wrongness, reliance on phenomena rooted in craving, engagement in unwholesome courses of action, and the feverish excitement of body and mind due to all defilements – such meanings have been expounded.

Tuy nhiên, ý nghĩa tóm tắt được giải thích là: sự tác ý không như lý nhiều lần, sự kết hợp với các căn bất thiện, sự chấp thủ buông thả và chạy theo quá mức, sự tăng trưởng bị trói buộc bởi phương tiện, sự chấp thủ sai lầm, sự thanh tịnh không có vô minh và ái, sự không chấm dứt ba vòng luân hồi, sự không tách rời khỏi các lậu hoặc (āsava), lũ lụt (ogha), kiết sử (yoga), triền cái (gantha), các đường lối (agati), sự sinh khởi của ái và thủ (upādāna), sự vượt qua các chướng ngại như chướng ngại tâm (cetokhila), sự trói buộc tâm (cetovinibaddha), sự hoan hỷ và các triền cái (nīvaraṇa), sự không từ bỏ các căn nguyên tranh chấp, sự không đoạn trừ các tùy miên (anusaya), sự không vượt qua tà kiến, sự nương tựa vào các pháp có gốc rễ từ ái, sự thực hành các nghiệp đạo bất thiện, sự phiền não và nóng bức của thân và tâm do tất cả các phiền não gây ra, v.v., bắt đầu từ ‘‘người chưa từng nghe’’.

‘‘Pathaviṃ pathavito sañjānātī’’tiādinā taṇhāvicaritaniddeso mānajappanā vipariyesābhiniveso saṃkileso sakkāyapariggaho bālalakkhaṇāpadeso vaṅkattayavibhāvanānuyogo bahukārapaṭipakkhadīpanā tividhanissayasaṃsūcanā āsavakkhayakathananti evamādayo dīpitā honti.

Beginning with "one perceives earth as earth," the description of the proliferation of craving, the conceit of "I am," perverse inclinations, defilement, the appropriation of personality (sakkāya), the characteristic indication of a fool, the explanation of the three distortions, the exposition of many opposing factors, the indication of the three kinds of reliance, and the declaration of the destruction of the āsavas – such meanings have been expounded.

Bắt đầu từ ‘‘nhận thức đất là đất’’, được giải thích là: sự chỉ rõ các vọng tưởng do ái, sự kiêu mạn, sự chấp thủ sai lầm, sự ô nhiễm, sự chấp thủ thân kiến (sakkāya), sự chỉ rõ các đặc điểm của người ngu, sự phân tích ba loại cong vẹo, sự chỉ rõ các đối tượng hữu ích, sự biểu thị ba loại nương tựa, sự nói về sự diệt trừ các lậu hoặc, v.v.

408

Soḷasahāravaṇṇanā

16. Exposition of the Āhāras

Giải thích Mười Sáu Hāra

409

1. Desanāhāravaṇṇanā

1. Exposition of Desanāhāra (Discourse Āhāra)

1. Giải thích Desanāhāra (Hāra Giáo Thuyết)

410

Tattha ye upādānakkhandhadhamme upādāya pathavīādibhūtādibhedā paññatti, te paññattipaṭipādanabhāvena jātijarāmaraṇavisesanadukkhapariyāyena ca vuttā taṇhāvajjā tebhūmakadhammā dukkhasaccaṃ.

Here, the phenomena of the three realms, excluding craving, which are conceptualized into earth and other elements based on the aggregates of clinging, and are spoken of in terms of various kinds of suffering, such as birth, aging, and death, are Dukkha Sacca (Truth of Suffering).

Trong đó, các pháp thuộc uẩn chấp thủ (upādānakkhandha) mà nương vào đó có sự chế định về đất, v.v., các yếu tố vật chất, được nói đến theo cách trình bày các chế định và theo nghĩa khổ, đặc biệt là sinh, già, chết, không kể ái, là các pháp thuộc ba cõi, chính là Khổ đế.

Maññanābhinandananandīpariyāyehi vuttā taṇhā samudayasaccaṃ.

Craving, spoken of in terms of conceiving, delighting, and finding enjoyment, is Samudaya Sacca (Truth of the Origin of Suffering).

Ái, được nói đến theo cách suy tưởng, hoan hỷ và sự thích thú, chính là Tập đế.

Ayaṃ tāva suttantanayo.

This, then, is the Suttanta method.

Đây là phương pháp của Kinh tạng.

Abhidhammanaye pana yathāvuttataṇhāya saddhiṃ ‘‘assutavā’’tiādinā dīpitā avijjādayo, maññanāpariyāyena gahitā mānadiṭṭhiyo, bhavapadena gahito kammabhavo cāti sabbepi kilesābhisaṅkhārā samudayasaccaṃ.

In the Abhidhamma method, however, together with craving as described, ignorance and others expounded beginning with "the uninstructed," conceits and wrong views taken in terms of conceiving, and kamma-bhava taken by the word "bhava" – all defilements and formations – are Samudaya Sacca.

Tuy nhiên, theo phương pháp của Luận tạng (Abhidhamma), cùng với ái đã nói, vô minh, v.v., được giải thích bắt đầu từ ‘‘người chưa từng nghe’’, các kiêu mạn và tà kiến được chấp nhận theo cách suy tưởng, và nghiệp hữu (kammabhava) được chấp nhận bằng từ ‘‘hữu’’ (bhava), tất cả các phiền não và hành (saṅkhāra) đều là Tập đế.

Ubhinnaṃ appavatti nirodhasaccaṃ.

The non-arising of both is Nirodha Sacca (Truth of Cessation).

Sự không phát sinh của cả hai là Diệt đế.

Ariyadhammaggahaṇena, pariññābhikkhusekkhābhiññāgahaṇehi, rāgādikhayavacanehi, sammāsambodhigahaṇena ca maggasaccaṃ.

Through the comprehension of Noble Dhamma, through the comprehension of perfect understanding, monks, trainees, and higher knowledge, through statements about the destruction of lust and other defilements, and through the comprehension of perfect self-enlightenment, it is Magga Sacca (Truth of the Path).

Bằng cách chấp nhận các pháp bậc Thánh, bằng cách chấp nhận sự hiểu biết toàn diện, các Tỳ-kheo hữu học (sekha) và các thắng trí, bằng các lời nói về sự diệt trừ tham, v.v., và bằng cách chấp nhận sự Chánh Đẳng Giác, đó là Đạo đế.

Keci pana taṇhākkhayādivacanehi nirodhasaccaṃ uddharanti, taṃ aṭṭhakathāya virujjhati tattha taṇhākkhayādīnaṃ maggakiccabhāvassa uddhaṭattā.

Some, however, extract the Nirodha Sacca from statements such as the destruction of craving; this contradicts the Commentary, where the destruction of craving and the like are extracted as the function of the Path.

Tuy nhiên, một số người rút ra Diệt đế từ các lời nói về sự diệt trừ ái, v.v., điều đó mâu thuẫn với Chú giải (Aṭṭhakathā) vì ở đó, sự diệt trừ ái, v.v., được rút ra là chức năng của Đạo.

411

Tattha samudayena assādo, dukkhena ādīnavo, magganirodhehi nissaraṇaṃ, tesaṃ bhikkhūnaṃ mānabhañjanaṃ phalaṃ, tathā ‘‘yathāvuttavibhāgāvabodho’’tiādinā vuttaṃ payojanañca.

Here, satisfaction (assāda) is with the origin; danger (ādīnava) is with suffering; escape (nissaraṇa) is with the path and cessation; the fruit (phala) is the breaking of the monks' conceit; and the purpose (payojana) is what is stated beginning with "the comprehension of the aforementioned distinctions."

Trong đó, sự thỏa mãn (assāda) là do Tập, sự nguy hiểm (ādīnava) là do Khổ, sự xuất ly (nissaraṇa) là do Đạo và Diệt, kết quả (phala) là sự phá vỡ kiêu mạn của các Tỳ-kheo đó, và mục đích (payojana) được nói đến bắt đầu từ ‘‘sự hiểu biết về sự phân chia đã nói’’.

Tassa nipphattikāraṇattā desanāya vicittatā catunnaṃ puggalānaṃ yāthāvato sabhāvūpadhāraṇañca upāyo, pathavīādīsu puthujjanādīnaṃ pavattidassanāpadesena pathavīādayo ekantato parijānitabbā, maññanā ca pahātabbāti ayamettha bhagavato āṇattīti.

The variety of the discourse, due to it being the cause of its accomplishment, and the discernment of the true nature of the four types of individuals, is the means (upāya). By showing the involvement of ordinary people and others with earth and so forth, it is stated that earth and the like must be completely understood, and conceiving must be abandoned—this here is the Blessed One's command (āṇatti).

Do là nguyên nhân thành tựu của điều đó, sự đa dạng của giáo lý và sự nhận thức đúng bản chất của bốn hạng người là phương tiện (upāya); bằng cách chỉ ra sự phát triển của phàm phu, v.v., trong đất, v.v., đất, v.v., phải được hiểu biết hoàn toàn, và sự suy tưởng phải được từ bỏ; đây là mệnh lệnh (āṇatti) của Đức Thế Tôn trong trường hợp này.

Ayaṃ desanāhāro.

This is the Discourse Āhāra (desanāhāra).

Đây là Desanāhāra (Hāra Giáo Thuyết).

412

2. Vicayahāravaṇṇanā

2. Exposition of Vicayahāra (Investigation Āhāra)

2. Giải thích Vicayahāra (Hāra Phân Tích)

413

Maññanānaṃ sakkāyassa avisesahetubhāvato, kassacipi tattha asesitabbato ca sabbagahaṇaṃ, sabhāvadhāraṇato nissattanijjīvato ca dhammaggahaṇaṃ, patiṭṭhābhāvato āveṇikahetubhāvato ca mūlaggahaṇaṃ, kāraṇabhāvato desanatthasambhavato ca pariyāyaggahaṇaṃ, sammukhabhāvato sampadānatthasambhavato ca ‘‘vo’’ti vacanaṃ, tathārūpaguṇayogato abhimukhīkaraṇato ca ‘‘bhikkhave’’ti ālapanaṃ.

The word "all" (sabba) is used because conceivings are the undifferentiated cause of personality and because there is nothing to be left out there for anyone. The word "dhamma" (phenomena) is used because of its inherent nature and its quality of being without a self or living entity. The word "mūla" (root) is used because of its foundational nature and its unique causal status. The word "pariyāya" (mode/description) is used because of its causal nature and the possibility of arising from the meaning of the discourse. The word "vo" (to you) is used because of direct address and the possibility of its meaning being conveyed. The address "bhikkhave" (monks) is used because of their possession of such qualities and for the purpose of addressing them directly.

Do các suy tưởng là nguyên nhân không khác biệt của thân kiến (sakkāya), và do không có gì cần phải giữ lại ở đó, nên có sự chấp nhận tất cả; do giữ lại bản chất, không có chúng sinh và không có linh hồn, nên có sự chấp nhận pháp; do là nơi nương tựa và là nguyên nhân đặc biệt, nên có sự chấp nhận căn nguyên; do là nguyên nhân và do có khả năng tạo ra ý nghĩa của giáo lý, nên có sự chấp nhận phương pháp; do là trực tiếp và do có khả năng tạo ra ý nghĩa của sự ban tặng, nên có lời ‘‘vo’’ (cho các ông); và do có phẩm chất như vậy và do sự hướng về, nên có lời gọi ‘‘này các Tỳ-kheo’’ (bhikkhave).

Desetuṃ samatthabhāvato tesaṃ satuppādanatthañca ‘‘desessāmī’’ti paṭijānanaṃ, desetabbatāya paṭiññātabhāvato, yathāpaṭiññañca desanato ‘‘ta’’nti paccāmasanaṃ, sotabbabhāvato, savanatthassa ca ekantena nipphādanato ‘‘suṇāthā’’ti vuttaṃ.

The declaration "I shall teach" is made due to the capacity to teach and for the purpose of arousing mindfulness in them. The word "taṃ" (that) refers back to what has been declared as teachable and because it is taught as declared. "Suṇātha" (listen) is said because it is to be heard and because the purpose of listening is definitely accomplished.

Do có khả năng giảng dạy và để tạo ra sự tỉnh thức cho họ, nên có lời hứa ‘‘ta sẽ giảng’’ (desessāmī); do đã được hứa sẽ giảng và do giảng theo lời hứa, nên có lời chỉ định ‘‘điều đó’’ (taṃ); do phải được nghe và do ý nghĩa của sự nghe được hoàn thành tuyệt đối, nên có lời ‘‘hãy nghe’’ (suṇātha) được nói đến.

Sakkātabbato, sakkaccakiriyāya eva ca tadatthasiddhito ‘‘sādhuka’’nti vuttaṃ.

"Sādhukaṃ" (carefully) is said because it is to be esteemed and because its purpose is achieved only through careful performance.

Do phải được tôn kính và do ý nghĩa đó chỉ được thành tựu bằng hành động tôn kính, nên có lời ‘‘cẩn thận’’ (sādhukaṃ) được nói đến.

Dhammassa manasikaraṇīyato tadadhīnattā ca sabbasampattīnaṃ ‘‘manasi karothā’’ti vuttaṃ yathāpariññātāya desanāya paribyattabhāvato vitthāratthasambhavato ca ‘‘bhāsissāmī’’ti vuttaṃ.

"Manasi karotha" (pay attention) is said because the Dhamma is to be attended to and because all attainments depend on it. "Bhāsissāmi" (I shall speak) is said because the discourse, as perfectly understood, is clear and because there is a possibility of its expansion.

Do pháp phải được tác ý và do tất cả mọi sự thành tựu đều tùy thuộc vào đó, nên có lời ‘‘hãy tác ý’’ (manasi karotha) được nói đến; do giáo lý đã được hiểu biết rõ ràng và do có khả năng tạo ra ý nghĩa rộng rãi, nên có lời ‘‘ta sẽ nói’’ (bhāsissāmī) được nói đến.

Bhagavato sadevakena lokena sirasā sampaṭicchitabbavacanattā, tassa ca yathādhippetatthasādhanato ‘‘eva’’nti vuttaṃ.

"Evaṃ" (thus) is said because the Blessed One's word is to be received with reverence by the world with its deities, and because it accomplishes the intended meaning.

Do lời của Đức Thế Tôn phải được thế gian cùng với chư thiên cung kính đón nhận bằng đầu, và do lời đó thành tựu ý nghĩa đã dự định, nên có lời ‘‘như vậy’’ (evaṃ) được nói đến.

Satthu uttamagāravaṭṭhānabhāvato, tattha ca gāravassa uḷārapuññabhāvato ‘‘bhante’’ti vuttaṃ.

"Bhante" (Venerable Sir) is said because the Teacher is the supreme object of reverence, and reverence towards him is a great merit.

Do là nơi tôn kính tối thượng của Đạo sư, và do sự tôn kính ở đó là công đức lớn lao, nên có lời ‘‘bạch Thế Tôn’’ (bhante) được nói đến.

Bhikkhūnaṃ tathākiriyāya nicchitabhāvato vacanālaṅkārato ca ‘‘kho’’ti vuttaṃ.

"Kho" (indeed/certainly) is said because of the monks' certainty in acting thus and for the sake of verbal embellishment.

Do Tỳ-kheo đã quyết định hành động như vậy và do là lời trang trọng, nên có lời ‘‘thật vậy’’ (kho) được nói đến.

Savanassa paṭijānitabbato, tathā tehi paṭipannattā ca ‘‘paccassosu’’nti vuttaṃ paccakkhabhāvato, sakalassapi ekajjhaṃ karaṇato ‘‘eta’’nti vuttaṃ.

"Paccassosuṃ" (they assented) is said because listening is to be acknowledged and because they acted accordingly. "Etaṃ" (this) is said because of its directness and because all of it is brought together.

Do sự nghe phải được hứa hẹn, và do họ đã thực hành như vậy, nên có lời ‘‘họ đã vâng lời’’ (paccassosuṃ) được nói đến; do là trực tiếp và do tất cả đều được hợp nhất lại, nên có lời ‘‘điều này’’ (etaṃ) được nói đến.

414

Vuccamānassa puggalassa lokapariyāpannattā lokādhārattā ca lokaṃ upādāya ‘‘idhā’’ti vuttaṃ.

"Idha" (here) is said in reference to the world, because the person being spoken of is included in the world and because the world is its foundation.

Do người được nói đến thuộc về thế gian và là nền tảng của thế gian, nên có lời ‘‘ở đây’’ (idha) được nói đến để chỉ thế gian.

Paṭivedhabāhusaccābhāvato pariyattibāhusaccābhāvato ca ‘‘assutavā’’ti vuttaṃ.

"Assutavā" (uninstructed) is said due to the absence of extensive penetrative knowledge and the absence of extensive scriptural knowledge.

Do thiếu sự đa văn về thể nhập và thiếu sự đa văn về học hỏi, nên có lời ‘‘người chưa từng nghe’’ (assutavā) được nói đến.

Puthūsu, puthu vā janabhāvato ‘‘puthujjano’’ti vuttaṃ.

"Puthujjano" (ordinary person) is said because of being among the multitude, or because of being a multitude of people.

Do là người trong nhiều chúng sinh, hoặc là người riêng lẻ, nên có lời ‘‘phàm phu’’ (puthujjano) được nói đến.

Anariyadhammavirahato ariyadhammasamannāgamato ca ‘‘ariyāna’’nti vuttaṃ.

"Ariyānaṃ" (of the Noble Ones) is said due to the absence of ignoble qualities and the possession of noble qualities.

Do không có pháp phi Thánh và do có sự đầy đủ pháp Thánh, nên có lời ‘‘của các bậc Thánh’’ (ariyānaṃ) được nói đến.

Ariyabhāvakarāya paṭipattiyā abhāvato, tattha kosalladamathābhāvato ‘‘ariyānaṃ adassāvī’’tiādi vuttaṃ.

"Ariyānaṃ adassāvī" (not seeing the Noble Ones) and so on, is said due to the absence of practices conducive to nobility and the absence of skill and training therein.

Do không có sự thực hành tạo nên phẩm chất Thánh, và do thiếu sự khéo léo và sự chế ngự ở đó, nên có lời ‘‘không thấy các bậc Thánh’’, v.v., được nói đến.

Asantadhammassavanato santadhammasamannāgamato sabbhi pāsaṃsiyato ca ‘‘sappurisāna’’nti vuttaṃ.

"Sappurisānaṃ" (of the good people) is said due to hearing the excellent Dhamma, possessing excellent qualities, and being praised by the good.

Do nghe pháp không chân chính, do có sự đầy đủ pháp chân chính và do được các thiện nhân khen ngợi, nên có lời ‘‘của các bậc thiện nhân’’ (sappurisānaṃ) được nói đến.

Sappurisabhāvakarāya paṭipattiyā abhāvato, tattha ca kosalladamathābhāvato ‘‘sappurisānaṃ adassāvī’’tiādi vuttaṃ.

"Sappurisānaṃ adassāvī" (not seeing the good people) and so on, is said due to the absence of practices conducive to being a good person and the absence of skill and training therein.

Do không có sự thực hành tạo nên phẩm chất thiện nhân, và do thiếu sự khéo léo và sự chế ngự ở đó, nên có lời ‘‘không thấy các bậc thiện nhân’’, v.v., được nói đến.

Pathavīvatthukānaṃ maññanānaṃ, upari vuccamānānañcamaññanānaṃ mūlakattā papañcasaṅkhānaṃ ‘‘pathaviṃ pathavito sañjānātī’’ti vuttaṃ.

"Pathaviṃ pathavito sañjānāti" (one perceives earth as earth) is said because it is the root of conceivings related to earth and of conceivings to be spoken of later, which constitute mental proliferation (papañca).

Do là căn nguyên của các suy tưởng có đối tượng là đất và các suy tưởng sẽ được nói ở trên, và do là sự phóng dật (papañca), nên có lời ‘‘nhận thức đất là đất’’ (pathaviṃ pathavito sañjānāti) được nói đến.

Andhaputhujjanassa ahaṃkāra-mamaṃkārānaṃ katthacipi appahīnattā ‘‘pathaviṃ maññatī’’tiādi vuttaṃ.

"Pathaviṃ maññati" (one conceives earth) and so on, is said because the "I-making" and "mine-making" of the blind ordinary person are nowhere abandoned.

Do người phàm phu mù quáng không bao giờ từ bỏ sự chấp ngã và chấp của tôi, nên có lời ‘‘suy tưởng về đất’’, v.v., được nói đến.

415

Pubbe aggahitattā, sāmaññato ca gayhamānattā, puggalassa pathavīādiārammaṇasabhāgatāya labbhamānattā ca ‘‘yopī’’ti vuttaṃ.

"Yopi" (even he who) is said because it was not grasped before, is generally being grasped, and because the person is obtained as having the nature of an object like earth and so on.

Do trước đây chưa từng chấp nhận, và do được chấp nhận một cách tổng quát, và do người đó được tìm thấy có bản chất là đối tượng của đất, v.v., nên có lời ‘‘người nào đó’’ (yopī) được nói đến.

‘‘Yo’’ti aniyamena gahitassa niyametabbato paṭiniddisitabbato ca; ‘‘so’’ti vuttaṃ sātisayaṃ saṃsāre bhayassa ikkhanato kilesabhedanasambhavato ca ‘‘bhikkhū’’ti vuttaṃ.

"So" (he) is said to define what was unspecifically taken by "yo" and to refer to it. "Bhikkhu" (monk) is said because of perceiving great danger in saṃsāra and the possibility of severing defilements.

Do người đã được chấp nhận một cách không xác định bằng ‘‘yo’’ (người nào) cần phải được xác định và chỉ định lại, nên có lời ‘‘so’’ (người đó) được nói đến; do nhìn thấy sự nguy hiểm đặc biệt trong vòng luân hồi và do có khả năng đoạn trừ phiền não, nên có lời ‘‘Tỳ-kheo’’ (bhikkhū) được nói đến.

Sikkhāhi samannāgamato sekkhadhammapaṭilābhato ca ‘‘sekkho’’ti vuttaṃ.

"Sekkho" (a trainee) is said due to being endowed with the trainings and having attained the qualities of a trainee.

Do có sự đầy đủ các học pháp và do đạt được các pháp hữu học (sekha), nên có lời ‘‘hữu học’’ (sekkho) được nói đến.

Manasā laddhabbassa arahattassa anadhigatattā adhigamanīyato ca ‘‘appattamānaso’’ti vuttaṃ.

"Appattamānaso" (one whose mind has not attained) is said because arahatship, which is to be attained mentally, has not yet been attained and is still to be attained.

Do quả A-la-hán phải đạt được bằng tâm chưa được thành tựu và cần phải được thành tựu, nên có lời ‘‘tâm chưa đạt’’ (appattamānaso) được nói đến.

Aparena anuttaraṇīyato, paraṃ anucchavikabhāvena uttaritvā ṭhitattā ca ‘‘anuttara’’nti vuttaṃ.

Because it cannot be surpassed by anything else, and because it stands having surpassed others in an incomparable manner, it is called "anuttara" (unsurpassable).

Do không thể bị vượt qua bởi người khác, và do đã vượt lên đứng ở trạng thái không thể sánh bằng, nên được gọi là “vô thượng” (anuttara).

Yogena bhāvanāya kāmayogādito ca khemaṃ sivaṃ anupaddavanti ‘‘yogakkhema’’nti vuttaṃ.

Because it is safe, auspicious, and free from danger by means of yoga (exertion/practice) and bhāvanā (meditation), and from the bonds of sensual desire (kāmayoga), etc., it is called "yogakkhema" (security from bondage).

Do sự tu tập (yoga), và từ các ách buộc (yoga) như dục ách, là an toàn, tốt lành, không tai họa, nên được gọi là “vô thượng an ổn” (yogakkhema).

Chandappavattiyā ussukkāpattiyā ca ‘‘patthayamāno’’ti vuttaṃ.

Because of the arising of desire and the state of being zealous, it is called "patthayamāno" (desiring).

Do sự vận hành của dục (chanda) và do sự nỗ lực (ussukka), nên được gọi là “đang mong cầu” (patthayamāno).

Tadatthassa sabbaso sabbairiyāpathavihārassa samathavipassanāvihārassa dibbavihārassa ca vasena ‘‘viharatī’’ti vuttaṃ.

In the sense of dwelling in all postures for that purpose, or dwelling in samatha-vipassanā, or divine dwelling, it is called "viharatī" (dwells).

Do ý nghĩa đó, một cách hoàn toàn, theo cách trú ngụ ở mọi oai nghi, theo cách trú ngụ của định và tuệ, và theo cách trú ngụ của Phạm trú (dibbavihāra), nên được gọi là “an trú” (viharati).

Sekkhassa sabbaso abhiññeyyabhāvañceva pariññeyyabhāvañca ñāṇena abhibhavitvā jānanato ‘‘abhijānātī’’ti vuttaṃ.

Because a Sekkha (one in training) completely knows through wisdom, having mastered what is to be known and what is to be fully understood, it is called "abhijānātī" (fully understands).

Đối với bậc Hữu học (sekha), do đã vượt qua và biết rõ bằng tuệ về tất cả các pháp cần phải thắng tri và cần phải liễu tri, nên được gọi là “thắng tri” (abhijānāti).

Sekkhassa sabbaso appahīnamaññanatāya abhāvato ‘‘mā maññī’’ti vuttaṃ.

Because for a Sekkha there is no remaining undeveloped notion of 'I am', it is called "mā maññī" (do not conceive).

Đối với bậc Hữu học, do không còn hoàn toàn cái tưởng tri chưa được đoạn trừ, nên được gọi là “chớ tưởng tri” (mā maññī).

Sesaṃ vuttanayānusārena veditabbaṃ.

The rest should be understood in accordance with the method stated.

Phần còn lại nên được hiểu theo cách đã nói.

Iminā nayena ito paraṃ sabbapadesu vinicchayo kātabbo.

By this method, a determination should be made in all subsequent passages.

Theo cách này, từ đây trở đi, ở tất cả các đoạn, cần phải thực hiện sự phân tích.

Sakkā hi aṭṭhakathaṃ tassā līnatthavaṇṇanañca anugantvā ayamattho viññūhi vibhāvetunti ativitthārabhayena na vitthārayimha.

Indeed, this meaning can be elaborated by the discerning, following the Commentary and its Sub-Commentary on hidden meanings, but for fear of excessive prolixity, we have not elaborated.

Thật vậy, do sợ quá dài, chúng tôi không giải thích rộng hơn, vì ý nghĩa này có thể được những người có trí tuệ làm sáng tỏ bằng cách dựa vào Chú giải (Aṭṭhakathā) và Bản giải thích ý nghĩa ẩn (Līnatthavaṇṇanā) của nó.

Iti anupadavicayato vicayo hāro.

Thus, from the analysis of individual words, this is the Analysis Method (Vicayahāra).

Như vậy, từ sự phân tích từng từ (anupadavicaya) là Phương pháp phân tích (Vicayahāra).

416

3. Yuttihāravaṇṇanā

3. Elucidation of the Reasoning Method

3. Giải thích Phương pháp Lý lẽ (Yuttihāravaṇṇanā)

417

Sakkāyassa sabbamaññanānaṃ mūlabhāvo yujjati parikappamattakattā lokavicittassa.

The state of being the root of all conceits of existence is reasonable for the body, as the diversity of the world is merely a conceptualization.

Việc tất cả các tưởng tri là gốc rễ của sắc thân (sakkāya) là hợp lý, vì thế giới đa dạng chỉ là sự giả định.

Byāhusaccadvayarahitassa andhaputhujjanabhāvo yujjati puthukilesābhisaṅkhārajananādisabhāvattā.

The state of being a blind ordinary person, devoid of the two truths, is reasonable, as it is characterized by generating various defilements and formations.

Việc phàm phu mù quáng thiếu hai loại nghe nhiều (bāhusacca) là hợp lý, vì bản chất của họ là tạo ra nhiều phiền não và hành.

Yathāvuttaputhujjanassa vā vuttappakārabāhusaccābhāvo yujjati tasmiṃ sati sabbhāvato.

Or, the absence of the aforementioned two truths for an ordinary person is reasonable, as in their presence (the truths) there is the state of being.

Hoặc việc phàm phu như đã nói thiếu loại nghe nhiều như đã đề cập là hợp lý, vì khi có điều đó thì có sự tồn tại.

Tattha assutavato puthujjanassa ariyānaṃ sappurisānañca adassāvitādi yujjati ariyakaradhammānaṃ ariyabhāvassa ca tena adiṭṭhattā appaṭipannattā ca tathā tassa pathaviyā ‘‘ahaṃ pathavī, mama pathavī, paro pathavī’’ti sañjānanaṃ yujjati ahaṃkāramamaṃkārānaṃ sabbena sabbaṃ appahīnattā.

In that regard, for the untaught ordinary person, not having seen the Noble Ones and good people is reasonable, because he has not seen or practiced the noble qualities and the state of being noble; likewise, his conceiving 'I am earth, earth is mine, others are earth' concerning earth is reasonable, because 'I-making' and 'mine-making' are not eradicated in any respect.

Trong đó, việc người phàm phu chưa nghe pháp không thấy các bậc Thánh và các bậc chân nhân là hợp lý, vì người đó chưa thấy và chưa thực hành các pháp của bậc Thánh và bản chất của bậc Thánh; cũng vậy, việc người đó tưởng tri về đất là “ta là đất, đất là của ta, đất là người khác” là hợp lý, vì ngã mạn và ngã sở chưa được đoạn trừ hoàn toàn.

Tathā sañjānato cassa pathaviṃ kammādikaraṇādivasena gahetvā nānappakārato maññanāpavatti yujjati saññānidānattā papañcasaṅkhānaṃ.

Similarly, for one who thus conceives, the occurrence of various notions regarding earth, taking it as a means of action, etc., is reasonable, as perceptions are the cause of conceptual proliferation.

Cũng vậy, việc người tưởng tri như vậy về đất, nắm giữ nó theo cách là nhân của nghiệp, v.v., và tưởng tri theo nhiều cách khác nhau là hợp lý, vì các pháp hý luận (papañcasaṅkhā) có căn nguyên từ tưởng tri (saññā).

Yo maññati, tassa apariññātavatthukatā yujjati pariññāya vinā maññanāpahānābhāvato.

For one who conceives, the state of the object being not fully understood is reasonable, because without full understanding, the abandonment of conceiving is impossible.

Người nào tưởng tri, việc người đó chưa liễu tri đối tượng là hợp lý, vì không có sự liễu tri thì không thể đoạn trừ tưởng tri.

‘‘Āpaṃ āpato sañjānātī’’tiādīsupi eseva nayo.

The same method applies to "He perceives water as water," and so on.

Trong các câu “tưởng tri nước là nước” v.v., cũng theo cách này.

Apariyositasikkhassa appattamānasatā yujjati katakiccatābhāvato.

For one whose training is not completed, the state of not having attained the goal is reasonable, because the task has not been accomplished.

Việc người Hữu học chưa hoàn thành sự học tập chưa đạt được tâm giải thoát là hợp lý, vì việc cần làm chưa được hoàn thành.

Sekkhassa sato yogakkhemapatthanā yujjati tadadhimuttabhāvato.

For a Sekkha who is mindful, the aspiration for security from bondage (yogakkhema) is reasonable, because he is devoted to it.

Việc bậc Hữu học có sự mong cầu vô thượng an ổn là hợp lý, vì người đó đã quyết tâm hướng đến điều đó.

Tathā tassa pathaviyā abhijānanā yujjati pariññāpahānesu mattaso kāribhāvato.

Similarly, his full understanding of earth is reasonable, because it is effective to some extent in full understanding and abandonment.

Cũng vậy, việc người đó thắng tri về đất là hợp lý, vì người đó có vai trò nhất định trong việc liễu tri và đoạn trừ.

Tato eva cassa ‘‘mā maññī’’ti vattabbatā yujjati vatthupariññāya viya maññanāpahānassapi vippakatabhāvato.

For that very reason, it is reasonable to tell him "Do not conceive," as the abandonment of conceiving is also incomplete, just like the full understanding of the object.

Cũng chính vì thế, việc người đó được bảo “chớ tưởng tri” là hợp lý, vì việc đoạn trừ tưởng tri cũng còn dang dở như việc liễu tri đối tượng.

Sekkhassa pathaviyā pariññeyyatā yujjati pariññātuṃ sakkuṇeyyattā sabbaso apariññātattā ca.

For a Sekkha, the full understanding of earth is reasonable, because it is capable of being fully understood and is not fully understood in all respects.

Việc đất cần được liễu tri đối với bậc Hữu học là hợp lý, vì nó có thể được liễu tri và vì nó chưa được liễu tri hoàn toàn.

‘‘Āpaṃ āpato’’tiādīsupi eseva nayo.

The same method applies to "water as water," and so on.

Trong các câu “nước là nước” v.v., cũng theo cách này.

Arahattādiyuttassa pathaviyādīnaṃ abhijānanā maññanābhāvo ca yujjati saṅkhātadhammattā, sabbaso kilesānaṃ pahīnattā, tato eva cassa vītarāgādibhāvo tato sammadeva ca paṭiccasamuppādassa paṭividdhatāti.

For one endowed with Arahantship, etc., the full understanding of earth, etc., and the absence of conceiving are reasonable, because these states are fully comprehended, because defilements are completely abandoned, and for that very reason, his state is free from passion, etc., and the dependent origination is perfectly penetrated.

Việc các bậc A-la-hán v.v. thắng tri về đất v.v. và không có tưởng tri là hợp lý, vì các pháp đã được nhận biết, vì tất cả phiền não đã được đoạn trừ, và chính vì thế mà người đó có trạng thái ly tham v.v., và vì người đó đã thấu triệt duyên khởi một cách đúng đắn.

Ayaṃ yuttihāro.

This is the Reasoning Method (Yuttihāra).

Đây là Phương pháp Lý lẽ (Yuttihāra).

418

4. Padaṭṭhānahāravaṇṇanā

4. Elucidation of the Proximate Cause Method

4. Giải thích Phương pháp Căn bản (Padaṭṭhānahāravaṇṇanā)

419

Kissopi maññanā sakkāyassa padaṭṭhānaṃ, maññanānaṃ ayonisomanasikāro padaṭṭhānaṃ, sutadvayaviraho andhaputhujjanabhāvassa padaṭṭhānaṃ, so ariyānaṃ adassāvitāya padaṭṭhānaṃ, sā ariyadhammassa akovidatāya padaṭṭhānaṃ, sā ariyadhamme avinītatāya padaṭṭhānaṃ.

Any conceiving is the proximate cause for existence; unwise attention is the proximate cause for conceivings; being devoid of the two truths is the proximate cause for the state of an ordinary blind person; that is the proximate cause for not having seen the Noble Ones; that is the proximate cause for not being skilled in the Noble Dhamma; that is the proximate cause for not being disciplined in the Noble Dhamma.

Mọi tưởng tri đều là căn bản của sắc thân (sakkāya); tác ý không như lý là căn bản của các tưởng tri; sự thiếu vắng hai loại nghe nhiều là căn bản của trạng thái phàm phu mù quáng; điều đó là căn bản của việc không thấy các bậc Thánh; điều đó là căn bản của việc không thông thạo pháp của bậc Thánh; điều đó là căn bản của việc không được huấn luyện trong pháp của bậc Thánh.

‘‘Sappurisānaṃ adassāvī’’ti etthāpi eseva nayo.

The same method applies to "not having seen good people."

Trong câu “không thấy các bậc chân nhân” cũng theo cách này.

Saññāvipallāso maññanānaṃ padaṭṭhānaṃ.

Perceptual perversion is the proximate cause for conceivings.

Tưởng tri sai lầm (saññāvipallāsa) là căn bản của các tưởng tri.

Saññānidānā hi papañcasaṅkhāti.

For proliferations (papañca-saṅkhā) have perception as their origin.

Vì các pháp hý luận (papañcasaṅkhā) có căn nguyên từ tưởng tri (saññā).

Maññanāsu ca taṇhāmaññanā itaramaññanānaṃ padaṭṭhānaṃ ‘‘taṇhāgatānaṃ paritassitavipphandita’’nti, (dī. ni. 1.105-109) ‘‘taṇhāpaccayā upādāna’’nti (ma. ni. 3.126; mahāva. 1) ca vacanato, taṇhāgatasseva ca ‘‘seyyohamasmi’’ntiādinā mānajappanāsabbhāvatā.

Among conceivings, craving-conceiving is the proximate cause for other conceivings, as it is said, "For those given to craving, there is trembling and agitation" and "From craving, there is clinging," and because notions of conceit like "I am superior" occur only in those given to craving.

Trong các tưởng tri, tưởng tri ái (taṇhāmaññanā) là căn bản của các tưởng tri khác, theo lời dạy “những kẻ bị ái chi phối thì dao động và lo âu” và “duyên ái mà có thủ” và do việc chỉ những kẻ bị ái chi phối mới có sự tự mãn như “ta là hơn” v.v.

Sabbāpi vā maññanā sabbāsaṃ maññanānaṃ padaṭṭhānaṃ.

Or, all conceivings are the proximate cause for all conceivings.

Hoặc tất cả các tưởng tri đều là căn bản của tất cả các tưởng tri.

‘‘Upādānapaccayā taṇhā’’ti hi vacanato diṭṭhipi taṇhāya padaṭṭhānaṃ.

Indeed, from the saying "From clinging, there is craving," views (diṭṭhi) are also the proximate cause for craving.

Vì theo lời dạy “duyên thủ mà có ái”, nên tà kiến (diṭṭhi) cũng là căn bản của ái.

‘‘Ahamasmi brahmā mahābrahmā’’ti (dī. ni. 1.42; 3.39) ādivacanato mānopi diṭṭhiyā padaṭṭhānaṃ.

From sayings like "I am Brahmā, the Great Brahmā," conceit (māna) is also the proximate cause for views.

Theo lời dạy “ta là Phạm thiên, Đại Phạm thiên” v.v., nên ngã mạn (māna) cũng là căn bản của tà kiến.

Tathā ‘‘asmīti sati itthaṃsmīti hoti, evaṃsmīti hoti, aññathāsmīti hotī’’tiādivacanato mānassapi taṇhāya padaṭṭhānatā labbhateva.

Similarly, from sayings like "When there is 'I am,' there is 'I am thus,' there is 'I am like this,' there is 'I am otherwise'," the proximate causality of conceit for craving is indeed obtained.

Cũng vậy, theo lời dạy “khi có ‘ta là’, thì có ‘ta là như thế này’, có ‘ta là như vậy’, có ‘ta là khác’”, nên ngã mạn cũng được coi là căn bản của ái.

Sekkhā dhammā sappadesato maññanāpahānassa padaṭṭhānaṃ.

Sekkha (trainee) qualities are the proximate cause for the partial abandonment of conceivings.

Các pháp Hữu học (sekkhā dhammā) là căn bản của sự đoạn trừ tưởng tri một phần.

Asekkhā nippadesato maññanāpahānassa padaṭṭhānaṃ.

Asekkhā (accomplished) qualities are the proximate cause for the complete abandonment of conceivings.

Các pháp Vô học (asekkhā dhammā) là căn bản của sự đoạn trừ tưởng tri hoàn toàn.

Kammabhavo ca jātiyā padaṭṭhānaṃ.

Kamma-existence is the proximate cause for birth.

Nghiệp hữu (kammabhava) là căn bản của sinh (jāti).

Jāti jarāmaraṇassa padaṭṭhānaṃ.

Birth is the proximate cause for old age and death.

Sinh là căn bản của già và chết.

Paccayākārassa yathābhūtāvabodho sammāsambodhiyā padaṭṭhānanti.

The true comprehension of the causal nexus is the proximate cause for Perfect Enlightenment.

Sự thấu hiểu duyên khởi như thật là căn bản của chánh đẳng giác.

Ayaṃ padaṭṭhāno hāro.

This is the Proximate Cause Method (Padaṭṭhānahāra).

Đây là Phương pháp Căn bản (Padaṭṭhānahāra).

420

5. Lakkhaṇahāravaṇṇanā

5. Elucidation of the Characteristic Method

5. Giải thích Phương pháp Đặc tính (Lakkhaṇahāravaṇṇanā)

421

‘‘Sabbadhammamūlapariyāya’’nti ettha mūlaggahaṇena mūlapariyāyaggahaṇena vā yathā taṇhāmānadiṭṭhiyo gayhanti, evaṃ dosamohādīnampi sakkāyamūladhammānaṃ saṅgaho daṭṭhabbo sakkāyassa mūlabhāvena ekalakkhaṇattā.

In "The Discourse on the Root of All Phenomena," just as craving, conceit, and views are understood by taking "root" or by taking "root discourse," so too should the inclusion of other phenomena rooted in existence, such as hatred and delusion, be seen, due to their single characteristic of being the root of existence.

Trong câu “Sabbadhammamūlapariyāya” (Bài kinh căn bản của tất cả các pháp), bằng cách nắm giữ từ “mūla” (gốc rễ) hoặc “mūlapariyāya” (bài kinh căn bản), cũng như ái, ngã mạn, tà kiến được bao gồm, thì các pháp gốc rễ của sắc thân như sân, si v.v. cũng cần được bao gồm, vì chúng có cùng đặc tính là gốc rễ của sắc thân.

‘‘Assutavā’’ti iminā yathā tassa puggalassa pariyattipaṭivedhasaddhammānaṃ abhāvo gayhati, evaṃ paṭipattisaddhammassapi abhāvo gayhati saddhammabhāvena ekalakkhaṇattā.

By "untaught," just as the absence of the Dhamma of learning and penetration is understood for that person, so too is the absence of the Dhamma of practice understood, due to their single characteristic of being the Dhamma.

Bằng từ “Assutavā” (chưa nghe pháp), cũng như sự thiếu vắng chánh pháp về học tập và thể nhập được bao gồm, thì sự thiếu vắng chánh pháp về thực hành cũng được bao gồm, vì chúng có cùng đặc tính là chánh pháp.

Ariyānaṃ adassanakāmatādilakkhaṇā.

Not seeing the Noble Ones, etc., has the characteristic of desire.

Đặc tính của việc không thấy các bậc Thánh là sự mong muốn không thấy, v.v.

‘‘Ariyadhammassa akovido’’ti iminā ariyadhammādhigamassa vibandhabhūtaṃ aññāṇaṃ.

By "not skilled in the Noble Dhamma," ignorance, which is an impediment to the attainment of the Noble Dhamma.

Bằng từ “Ariyadhammassa akovido” (không thông thạo pháp của bậc Thánh) là sự vô minh, vốn là chướng ngại cho việc chứng đắc pháp của bậc Thánh.

‘‘Ariyadhamme avinīto’’ti iminā ariyavinayābhāvo.

By "undisciplined in the Noble Dhamma," the absence of Noble Discipline.

Bằng từ “Ariyadhamme avinīto” (không được huấn luyện trong pháp của bậc Thánh) là sự thiếu vắng giới luật của bậc Thánh.

So panatthato ariyavinaye appaṭipatti eva vāti tīhipi padehi yathāvuttavisayā micchādiṭṭhi vicikicchā ca gahitāva honti.

And this, in essence, is simply non-practice of the Noble Discipline, so by these three terms, wrong view and doubt regarding the aforementioned sphere are indeed included.

Về ý nghĩa, điều đó chính là sự không thực hành giới luật của bậc Thánh; vậy thì, bằng ba từ này, tà kiến và hoài nghi (vicikicchā) trong phạm vi đã nói đều đã được bao gồm.

Taggahaṇena ca sabbepi akusalā dhammā saṅgahitāva honti saṃkilesalakkhaṇena ekalakkhaṇattā.

And by their inclusion, all unwholesome states are indeed included, due to their single characteristic of defilement.

Và bằng việc bao gồm chúng, tất cả các pháp bất thiện cũng đều đã được bao gồm, vì chúng có cùng đặc tính là phiền não (saṃkilesa).

‘‘Sappurisānaṃ adassāvī’’ti etthāpi eseva nayo.

The same method applies to "not having seen good people."

Trong câu “Sappurisānaṃ adassāvī” (không thấy các bậc chân nhân) cũng theo cách này.

422

‘‘Pathaviṃ pathavito sañjānātī’’ti idaṃ diṭṭhimaññanādīnaṃ saññāya kāraṇabhāvadassanaṃ.

"He perceives earth as earth" indicates that perception is the cause of conceivings such as wrong views.

“Pathaviṃ pathavito sañjānāti” (tưởng tri đất là đất) điều này cho thấy tưởng tri (saññā) là nhân của các tưởng tri về tà kiến v.v.

Tattha yathā saññā, evaṃ vitakkaphassāvijjāayonisomanasikārādayopi tāsaṃ kāraṇanti atthato tesampettha saṅgaho vutto hoti maññanānaṃ kāraṇabhāvena ekalakkhaṇattā.

There, just as perception, so too thoughts (vitakka), contact (phassa), ignorance (avijjā), unwise attention (ayonisomanasikāra), etc., are the causes of these, meaning that they are also implicitly included here, due to their single characteristic of being the cause of conceivings.

Trong đó, cũng như tưởng tri, thì tầm (vitakka), xúc (phassa), vô minh (avijjā), tác ý không như lý (ayonisomanasikāra) v.v. cũng là nhân của chúng, vậy thì về ý nghĩa, chúng cũng được bao gồm ở đây, vì chúng có cùng đặc tính là nhân của các tưởng tri.

‘‘Maññatī’’ti iminā maññanākiccena taṇhāmānadiṭṭhiyo gahitā tāsaṃ kilesasabhāvattā.

By "conceives," craving, conceit, and views are included through the function of conceiving, because they are inherently defilements.

Bằng từ “Maññati” (tưởng tri), ái, ngã mạn, tà kiến được bao gồm bởi hành động tưởng tri, vì chúng có bản chất là phiền não.

Taggahaṇeneva vicikicchādinampi saṅgaho daṭṭhabbo kilesalakkhaṇena ekalakkhaṇattā.

And by their inclusion, the inclusion of doubt, etc., should also be seen, due to their single characteristic of defilement.

Bằng việc bao gồm chúng, hoài nghi v.v. cũng cần được bao gồm, vì chúng có cùng đặc tính là phiền não.

Tathā taṇhāya hetusabhāvattā taggahaṇeneva avasiṭṭhākusalahetūnaṃ saṅgaho daṭṭhabbo hetulakkhaṇena ekalakkhaṇattā.

Similarly, because craving is inherently a cause, by its inclusion, the inclusion of the remaining unwholesome roots should also be seen, due to their single characteristic of being a cause.

Cũng vậy, do ái có bản chất là nhân, nên bằng việc bao gồm nó, các nhân bất thiện còn lại cũng cần được bao gồm, vì chúng có cùng đặc tính là nhân.

Tathā taṇhādiṭṭhīnaṃ āsavādisabhāvattā taggahaṇeneva avasiṭṭhāsavoghayogaganthanīvaraṇādīnampi saṅgaho daṭṭhabbo āsavādisabhāvattā ekalakkhaṇattā.

Similarly, because craving and views are of the nature of āsavas, etc., by merely grasping these, the remaining āsavas, oghas, yogas, ganthas, nīvaraṇas, etc., should be understood to be included, due to their nature as āsavas, etc., and their having one characteristic.

Tương tự, vì ái dục (taṇhā) và tà kiến (diṭṭhi) có bản chất là lậu hoặc (āsava), nên chỉ cần nắm giữ chúng là có thể thấy được sự bao hàm của các lậu hoặc, bộc lưu (ogha), kiết phược (yoga), kiết sử (gantha), triền cái (nīvaraṇa) còn lại, vì chúng có bản chất là lậu hoặc và có cùng một đặc tính.

Tathā ‘‘pathaviṃ maññatī’’tiādinā pathavīādīnaṃ rūpasabhāvattā tabbisayānañca maññanānaṃ rūpavisayattā taggahaṇeneva sakalarūpakkhandhavisayāpi maññanā dassitā honti rūpavisayalakkhaṇena āsaṃ ekalakkhaṇattā.

In the same way, by means of "perceives earth" and so on, since earth, etc., are of the nature of rūpa, and the perceptions regarding them are also concerned with rūpa, by merely grasping these, perceptions concerning the entire rūpakkhandha are shown, as they share the single characteristic of being concerned with rūpa.

Tương tự, với câu ‘‘cho rằng đất là ta’’ và các câu tương tự, vì đất và các yếu tố khác có bản chất là sắc (rūpa), và các nhận thức sai lầm liên quan đến chúng có đối tượng là sắc, nên chỉ cần nắm giữ chúng là đã chỉ ra tất cả các nhận thức sai lầm có đối tượng là sắc uẩn, vì chúng có cùng một đặc tính là có đối tượng là sắc.

Evaṃ cakkhāyatanādivisayāpi maññanā niddhāretabbā.

In this manner, perceptions concerning the eye-base, etc., should also be determined.

Như vậy, các nhận thức sai lầm có đối tượng là nhãn xứ (cakkhāyatana) và các xứ khác cũng phải được xác định.

‘‘Apariññāta’’nti pariññāpaṭikkhepena tappaṭibaddhakilesānaṃ pahānapaṭikkhepoti daṭṭhabbo maggakiccabhāvena pariññāpahānānaṃ ekalakkhaṇattā.

"Not fully understood" means that by negating full understanding (pariññā), the relinquishment (pahāna) of the defilements associated with it is also negated; this should be understood because full understanding and relinquishment, as functions of the path, share one characteristic.

Với từ ‘‘chưa được biết rõ’’ (apariññāta), phải hiểu rằng việc bác bỏ sự hiểu biết (pariññā) cũng là bác bỏ sự đoạn trừ các phiền não liên kết với nó, vì sự hiểu biết và sự đoạn trừ có cùng một đặc tính là chức năng của Đạo (magga).

Iminā nayena sesesupi yathārahaṃ ekalakkhaṇā niddhāretabbāti.

In this way, in the remaining cases too, those with a single characteristic should be determined as appropriate.

Theo cách này, các đặc tính tương tự cũng phải được xác định một cách thích hợp trong các trường hợp còn lại.

Ayaṃ lakkhaṇo hāro.

This is the characteristic discourse method (lakkhaṇa hāra).

Đây là phương pháp đặc tính (lakkhaṇo hāro).

423

6. Catubyūhahāravaṇṇanā

6. Explanation of the Fourfold Discourse Method (Catubyūha Hāra)

6. Giải thích phương pháp bốn yếu tố (Catubyūhahāravaṇṇanā)

424

Pathavīādīsu vatthūsu byañjanacchāyāya atthaṃ gahetvā dhammagambhīrataṃ asallakkhetvā asaddhammassavanādinā vañcitā hutvā saddhammassavanadhāraṇaparicayamanasikāravimukhā pathavīādīsu vatthūsu puthujjanasekkhāsekkhatathāgatānaṃ paṭipattivisesaṃ ajānantā ca veneyyā imissā desanāya nidānaṃ.

The reason (nidāna) for this teaching concerns those who are amenable to instruction but, having grasped the meaning merely from the surface expression regarding things like earth, etc., without discerning the profound meaning of the Dhamma, and having been deceived by not listening to the True Dhamma, etc., are averse to listening to, retaining, familiarizing themselves with, and attending to the True Dhamma, and who do not know the distinctions in practice among ordinary people (puthujjanas), trainees (sekkhās), those beyond training (asekkhās), and Tathāgatas regarding things like earth, etc.

Những người đáng được giáo hóa (veneyya) bị lừa dối bởi việc không lắng nghe Chánh pháp, v.v., không nhận ra sự sâu sắc của giáo pháp khi chỉ nắm bắt ý nghĩa qua vẻ bề ngoài của các đối tượng như đất, v.v., và không biết sự khác biệt trong thực hành của phàm nhân (puthujjana), bậc hữu học (sekkhā), bậc vô học (asekkhā) và Như Lai (Tathāgata) đối với các đối tượng như đất, v.v., những người này là nguyên nhân (nidāna) của bài thuyết pháp này.

Te ‘‘kathaṃ nu kho yathāvuttadosavinimuttā yathāvuttañca visesaṃ jānantā sammāpaṭipattiyā ubhayahitaparāyaṇā saveyyu’’nti ayamettha bhagavato adhippāyo.

The Buddha's intention (adhippāya) here is: "How, then, might they, free from the aforementioned faults and knowing the aforementioned distinction, arrive at the ultimate benefit for both themselves and others through right practice?"

Ở đây, ý định (adhippāya) của Đức Thế Tôn là: ‘‘Làm thế nào để những người này có thể thoát khỏi những lỗi lầm đã nói trên, biết được những đặc điểm đã nói trên, và thực hành đúng đắn để đạt được lợi ích cho cả hai bên?’’

Padanibbacanaṃ niruttaṃ, taṃ ‘‘eva’’ntiādinidānapadānaṃ, ‘‘sabbadhammamūlapariyāya’’ntiādipāḷipadānañca aṭṭhakathāyaṃ, tassā līnatthavaṇṇanāyañceva vuttanayena suviññeyyattā ativitthārabhayena na vitthārayimha.

The etymology (nirutta) of words, such as the initial words like "evaṃ", and the Pāli words like "sabbadhammamūlapariyāya", is clearly comprehensible in the commentary (aṭṭhakathā) and its Līnatthavaṇṇanā, following the methods stated there, so we have not elaborated on it here for fear of excessive detail.

Giải thích từ ngữ (nirutta) là việc giải thích các từ như ‘‘eva’’ và các từ gốc khác, cũng như các từ trong kinh điển như ‘‘sabbadhammamūlapariyāya’’, v.v., đã được giải thích rõ ràng trong chú giải (aṭṭhakathā) và lý giải ý nghĩa ẩn (līnatthavaṇṇanā) theo phương pháp đã nêu, nên chúng tôi không giải thích chi tiết hơn vì sợ quá dài.

425

Padapadatthadesanānikkhepasuttasandhivasena pañcavidhā sandhi.

Connection (sandhi) is fivefold: word connection, meaning connection, exposition connection, placement connection, and Sutta connection.

Sự liên kết (sandhi) có năm loại: liên kết từ (pada-sandhi), liên kết nghĩa của từ (padattha-sandhi), liên kết giáo pháp (desanā-sandhi), liên kết tóm tắt (nikkhepa-sandhi) và liên kết kinh điển (sutta-sandhi).

Tattha padassa padantarena sambandho padasandhi, tathā padatthassa padatthantarena sambandho padatthasandhi, yo ‘‘kiriyākārakasambandho’’ti vuccati.

Among these, the connection of one word with another word is word connection (padasandhi); likewise, the connection of one word's meaning with another word's meaning is meaning connection (padatthasandhi), which is called "connection of action and agent."

Trong đó, sự kết nối của một từ với một từ khác là liên kết từ (pada-sandhi); tương tự, sự kết nối của nghĩa từ với nghĩa từ khác là liên kết nghĩa của từ (padattha-sandhi), được gọi là ‘‘sự kết nối giữa hành động và tác nhân’’.

Nānānusandhikassa suttassa taṃtaṃanusandhīhi sambandho, ekānusandhikassa pana pubbāparasambandho desanāsandhi.

The connection of a Sutta with various themes to its respective themes, and for a Sutta with a single theme, its connection of prior and subsequent parts, is exposition connection (desanāsandhi).

Sự kết nối của một bài kinh có nhiều mạch văn với các mạch văn tương ứng, còn sự kết nối trước sau của một bài kinh có một mạch văn là liên kết giáo pháp (desanā-sandhi).

Yā aṭṭhakathāyaṃ ‘‘pucchānusandhi ajjhāsayānusandhi yathānusandhī’’ti tidhā vibhattā.

This is divided into three in the commentary (aṭṭhakathā): "question-connection, intention-connection, and contextual-connection."

Điều này được chia thành ba loại trong chú giải (aṭṭhakathā): ‘‘liên kết câu hỏi (pucchānusandhi), liên kết ý định (ajjhāsayānusandhi), và liên kết theo trình tự (yathānusandhi)’’.

Ajjhāsayo cettha attajjhāsayo parajjhāsayoti dvidhā veditabbo.

Here, intention (ajjhāsaya) should be understood as twofold: one's own intention and others' intentions.

Ở đây, ý định (ajjhāsaya) phải được hiểu là hai loại: ý định của chính mình (attajjhāsaya) và ý định của người khác (parajjhāsaya).

Yaṃ panettha vattabbaṃ, taṃ heṭṭhā nidānavaṇṇanāyaṃ vuttameva.

What needs to be said about this has already been stated below in the explanation of the reason.

Những gì cần nói ở đây đã được nói trong phần giải thích nguyên nhân (nidānavaṇṇanā) ở dưới.

Nikkhepasandhi catunnaṃ suttanikkhepānaṃ vasena veditabbo.

Placement connection (nikkhepasandhi) should be understood according to the fourfold Sutta placements.

Liên kết tóm tắt (nikkhepa-sandhi) phải được hiểu theo bốn cách tóm tắt bài kinh.

Suttasandhi idha paṭhamanikkhepavaseneva veditabbo.

Sutta connection (suttasandhi) here should be understood primarily according to the first placement.

Liên kết kinh điển (sutta-sandhi) ở đây phải được hiểu chỉ theo cách tóm tắt đầu tiên.

Kasmā panettha mūlapariyāyasuttameva paṭhamaṃ nikkhittanti?

Why is only the Mūlapariyāya Sutta placed first here?

Tại sao ở đây chỉ có kinh Mūlapariyāya (Mạch văn gốc) được tóm tắt đầu tiên?

Nāyamanuyogo katthaci nappavattati, apica yasmā maññanāmūlakaṃ sakkāyaṃ, sabbamaññanā ca tattha eva anekabhedabhinnā pavattati, na tassā savisayāya lesamattampi sāraṃ atthīti pathavīādivibhāgabhinnesu maññanāsu ca sātisayaṃ nibbedhavirāgasañjananī upari sekkhāsekkhatathāgataguṇavibhāvanī ca ayaṃ desanā.

This question does not arise anywhere. Moreover, because the existent body (sakkāya) is rooted in perception, and all perceptions, in their various forms, operate therein, and there is not even a trace of essence in it with its objects, this discourse generates exceptional disenchantment and dispassion towards perceptions divided into categories like earth, etc., and illuminates the qualities of trainees, those beyond training, and Tathāgatas above.

Câu hỏi này không phải lúc nào cũng được đặt ra, nhưng vì sự hiện hữu (sakkāya) bắt nguồn từ nhận thức sai lầm (maññanā), và tất cả các nhận thức sai lầm khác nhau đều phát sinh từ đó, và không có một chút cốt lõi nào trong nhận thức sai lầm cùng với đối tượng của nó, nên bài thuyết pháp này là một bài thuyết pháp đặc biệt tạo ra sự nhàm chán và ly tham đối với các nhận thức sai lầm khác nhau theo các phần như đất, v.v., và cũng làm rõ các phẩm chất của bậc hữu học, vô học và Như Lai ở trên.

Suttantadesanā ca visesato diṭṭhiviniveṭhanakathā, tasmā sanissayassa diṭṭhiggāhassa ādito asārabhāvadīpanaṃ upari ca sabbesaṃ ariyānaṃ guṇavisesavibhāvanamidaṃ suttaṃ paṭhamaṃ nikkhittaṃ.

And Sutta teaching is specifically a discourse on extricating from wrong views. Therefore, this Sutta, which first illustrates the worthlessness of grasping to views with their underlying basis, and then reveals the special qualities of all noble ones, is placed first.

Và bài thuyết pháp này, đặc biệt là bài kinh về sự loại bỏ tà kiến, vì vậy, để chỉ ra sự vô giá trị của sự chấp thủ tà kiến từ ban đầu, và để làm rõ các phẩm chất đặc biệt của tất cả các bậc Thánh ở trên, bài kinh này được tóm tắt đầu tiên.

Kiñca sakkāye maññanāmaññanāmukhena pavattinivattīsu ādīnavānisaṃsavibhāvanato sabbesaṃ puggalānaṃ paṭipattivibhāgato ca idameva suttaṃ paṭhamaṃ nikkhittaṃ.

Furthermore, this Sutta is placed first because it illustrates the dangers and benefits in the arising and ceasing of perception within the existent body through the door of perception, and also because it distinguishes the practices of all individuals.

Hơn nữa, vì bài kinh này làm rõ những nguy hiểm và lợi ích trong sự tiếp nối và chấm dứt của nhận thức sai lầm trong sự hiện hữu (sakkāya) thông qua nhận thức sai lầm, và vì sự phân biệt các loại thực hành của tất cả các cá nhân, nên bài kinh này được tóm tắt đầu tiên.

426

Yaṃ pana ekissā desanāya desanantarena saddhiṃ saṃsandanaṃ, ayampi desanāsandhi, sā evaṃ veditabbā.

The comparison of one discourse with another discourse is also this exposition connection, and it should be understood as follows:

Còn sự đối chiếu giữa một bài thuyết pháp với một bài thuyết pháp khác, đây cũng là liên kết giáo pháp, và nó phải được hiểu như sau.

‘‘Assutavā puthujjano…pe… nibbānaṃ abhinandatī’’ti ayaṃ desanā.

"The uninstructed ordinary person… continues … delights in Nibbāna"—this discourse

Bài thuyết pháp này: ‘‘Phàm nhân không có học vấn… v.v… hoan hỷ Niết Bàn.’’

‘‘Idha, bhikkhave, assutavā puthujjano…pe… sappurisadhamme avinīto manasikaraṇīye dhamme nappajānāti, amanasikaraṇīye ca dhamme nappajānāti, so manasikaraṇīye dhamme appajānanto amanasikaraṇīye ca dhamme appajānanto ye dhammā na manasikaraṇīyā, te dhamme manasi karoti…pe… anuppanno vā kāmāsavo uppajjati, uppanno vā kāmāsavo pavaḍḍhati.

corresponds with the discourse: "Here, bhikkhus, an uninstructed ordinary person… continues … is unversed in the Dhamma of the good, does not know the things to be attended to, nor the things not to be attended to. Not knowing the things to be attended to, and not knowing the things not to be attended to, he attends to those things that should not be attended to… continues … either the unarisen sensual defilement arises, or the arisen sensual defilement grows; either the unarisen defilement of becoming arises, or the arisen defilement of becoming grows; either the unarisen defilement of ignorance arises, or the arisen defilement of ignorance grows" (M.N. 1.17).

Đối chiếu với bài thuyết pháp này: ‘‘Ở đây, này các Tỳ-kheo, phàm nhân không có học vấn… v.v… không được huấn luyện trong Chánh pháp, không hiểu rõ những pháp cần tác ý, và không hiểu rõ những pháp không cần tác ý. Vì không hiểu rõ những pháp cần tác ý và không hiểu rõ những pháp không cần tác ý, nên người ấy tác ý đến những pháp không cần tác ý… v.v… hoặc lậu hoặc dục (kāmāsava) chưa sanh thì sanh khởi, hoặc lậu hoặc dục đã sanh thì tăng trưởng.

Anuppanno vā bhavāsavo uppajjati, uppanno vā bhavāsavo pavaḍḍhati, anuppanno vā avijjāsavo uppajjati, uppanno vā avijjāsavo pavaḍḍhatī’’ti (ma. ni. 1.17) imāya desanāya saṃsandati.

This teaching correlates with: "Either an unarisen canker of existence arises, or an arisen canker of existence grows; either an unarisen canker of ignorance arises, or an arisen canker of ignorance grows."

Hoặc lậu hoặc hữu (bhavāsava) chưa sanh thì sanh khởi, hoặc lậu hoặc hữu đã sanh thì tăng trưởng, hoặc lậu hoặc vô minh (avijjāsava) chưa sanh thì sanh khởi, hoặc lậu hoặc vô minh đã sanh thì tăng trưởng’’ (Trung Bộ Kinh 1.17).

Tathā ‘‘tassetaṃ pāṭikaṅkhaṃ subhanimittaṃ manasi karissati, tassa subhanimittassa manasikārā rāgo cittaṃ anuddhaṃsessati, so sarāgo sadoso samoho sāṅgaṇo saṃkiliṭṭhacitto kālaṃ karissatī’’ti (ma. ni. 1.59) imāya desanāya saṃsandati.

Similarly, it corresponds with the discourse: "It is to be expected of him that he will attend to a beautiful image. Through his attention to a beautiful image, lust will assail his mind. With a mind full of lust, hatred, and delusion, sullied by defilements, he will make an end of his life" (M.N. 1.59).

Tương tự, đối chiếu với bài thuyết pháp này: ‘‘Người ấy có thể tác ý đến tướng khả ái, do tác ý đến tướng khả ái ấy, tham ái sẽ làm ô nhiễm tâm người ấy. Người ấy với tâm tham, sân, si, với tâm bị ô uế, sẽ mạng chung’’ (Trung Bộ Kinh 1.59).

Tathā ‘‘cakkhuñcāvuso paṭicca rūpe ca uppajjati cakkhuviññāṇaṃ, tiṇṇaṃ saṅgati phasso, phassapaccayā vedanā.

Likewise, it corresponds with the discourse: "And, friends, dependent on the eye and forms, eye-consciousness arises. The coming together of the three is contact. With contact as condition, feeling arises.

Tương tự, đối chiếu với bài thuyết pháp này: ‘‘Này chư Hiền, do duyên con mắt và các sắc trần mà nhãn thức sanh khởi; sự hòa hợp của ba thứ ấy là xúc; do duyên xúc mà thọ sanh.

Yaṃ vedeti taṃ sañjānāti, yaṃ sañjānāti taṃ vitakketi, yaṃ vitakketi taṃ papañceti, yaṃ papañceti tatonidānaṃ purisaṃ papañcasaññāsaṅkhā samudācarantī’’ti (ma. ni. 1.204) imāya desanāya saṃsandati.

What one feels, one perceives; what one perceives, one reasons about; what one reasons about, one mentally elaborates; from what one mentally elaborates, the proliferation of perceptions assail the person" (M.N. 1.204).

Cái gì người ấy thọ, cái đó người ấy tưởng; cái gì người ấy tưởng, cái đó người ấy suy tư; cái gì người ấy suy tư, cái đó người ấy hý luận; do duyên cái người ấy hý luận mà các tưởng hý luận khởi lên nơi người ấy’’ (Trung Bộ Kinh 1.204).

Tathā ‘‘idha, bhikkhave, asutavā puthujjano…pe… sappurisadhamme avinīto rūpaṃ ‘etaṃ mama, esohamasmi, eso me attā’ti samanupassati.

Furthermore, it corresponds with the discourse: "Here, bhikkhus, an uninstructed ordinary person… continues … is unversed in the Dhamma of the good. He regards form as 'this is mine, this I am, this is my self.' And feeling… continues …, perception… continues …, formations… continues …, consciousness as 'this is mine, this I am, this is my self.'

Tương tự, đối chiếu với bài thuyết pháp này: ‘‘Ở đây, này các Tỳ-kheo, phàm nhân không có học vấn… v.v… không được huấn luyện trong Chánh pháp, quán sát sắc là: ‘Cái này là của tôi, cái này là tôi, cái này là tự ngã của tôi’.

Vedanaṃ…pe…, saññaṃ…pe…, saṅkhāre…pe…, viññāṇaṃ ‘etaṃ mama, esohamasmi, eso me attā’ti samanupassati.

He perceives feeling… and so on… perception… and so on… formations… and so on… consciousness as ‘This is mine, this I am, this is my self’.

Thọ… v.v…, tưởng… v.v…, hành… v.v…, thức là: ‘Cái này là của tôi, cái này là tôi, cái này là tự ngã của tôi’.

Yampi taṃ diṭṭhaṃ…pe… yampi taṃ diṭṭhiṭṭhānaṃ, so loko so attā so pecca bhavissāmi nicco dhuvo sassato avipariṇāmadhammo sassatisamaṃ tatheva ṭhassāmīti, tampi ‘etaṃ mama, esohamasmi, eso me attā’ti samanupassatī’’ti (ma. ni. 1.241) imāya desanāya saṃsandati.

Even that which is seen… continues … even that object of view, 'this world, this self, after death I shall be permanent, stable, eternal, not subject to change, I shall remain thus for eternity,' he regards as 'this is mine, this I am, this is my self'" (M.N. 1.241).

Và cái gì đã được thấy… v.v… và cái gì là chỗ đứng của kiến chấp, rằng thế giới ấy, tự ngã ấy, sau khi chết sẽ thường còn, kiên cố, thường hằng, không biến đổi, sẽ tồn tại mãi mãi như vậy, người ấy cũng quán sát cái đó là: ‘Cái này là của tôi, cái này là tôi, cái này là tự ngã của tôi’’’ (Trung Bộ Kinh 1.241).

427

‘‘Yopi so, bhikkhave, bhikkhu…pe… nibbānaṃ mābhinandī’’ti ayaṃ desanā.

"And that bhikkhu, bhikkhus… continues … does not delight in Nibbāna"—this discourse

Bài thuyết pháp này: ‘‘Và này các Tỳ-kheo, Tỳ-kheo ấy… v.v… không hoan hỷ Niết Bàn’’.

‘‘Idha, devānaminda, bhikkhuno sutaṃ hoti ‘sabbe dhammā nālaṃ abhinivesāyā’ti, evañcetaṃ, devānaminda, bhikkhuno sutaṃ hoti ‘sabbe dhammā nālaṃ abhinivesāyā’ti, so sabbaṃ dhammaṃ abhijānāti, sabbaṃ dhammaṃ abhiññāya sabbaṃ dhammaṃ parijānāti, sabbaṃ dhammaṃ pariññāya yaṃ kiñci vedanaṃ vedeti sukhaṃ vā dukkhaṃ vā adukkhamasukhaṃ vā, so tāsu vedanāsu aniccānupassī viharati, virāgānupassī viharati, nirodhānupassī viharati, paṭinissaggānupassī viharatī’’ti (ma. ni. 1.390) imāya desanāya saṃsandati.

corresponds with the discourse: "Here, king of devas, a bhikkhu hears: 'All phenomena are not fit for clinging.' When a bhikkhu hears thus, king of devas, 'All phenomena are not fit for clinging,' he directly knows all phenomena, having directly known all phenomena, he fully understands all phenomena, having fully understood all phenomena, whatever feeling he experiences—whether pleasant, painful, or neither-painful-nor-pleasant—he dwells contemplating impermanence in those feelings, he dwells contemplating dispassion, he dwells contemplating cessation, he dwells contemplating relinquishment" (M.N. 1.390).

Đối chiếu với bài thuyết pháp này: ‘‘Ở đây, này Thiên chủ, Tỳ-kheo có nghe rằng: ‘Tất cả các pháp không đáng để chấp thủ’. Nếu Tỳ-kheo nghe rằng: ‘Tất cả các pháp không đáng để chấp thủ’ như vậy, thì vị ấy biết rõ tất cả các pháp, sau khi biết rõ tất cả các pháp, vị ấy hiểu biết tất cả các pháp, sau khi hiểu biết tất cả các pháp, bất cứ cảm thọ nào vị ấy cảm thọ, hoặc lạc thọ, hoặc khổ thọ, hoặc bất khổ bất lạc thọ, vị ấy an trú quán vô thường trong các cảm thọ ấy, an trú quán ly tham, an trú quán đoạn diệt, an trú quán xả ly’’ (Trung Bộ Kinh 1.390).

‘‘Yopi so, bhikkhave, bhikkhu arahaṃ…pe… abhisambuddhoti vadāmī’’ti ayaṃ desanā ‘‘sutavā ca kho, bhikkhave, ariyasāvako…pe… sappurisadhamme suvinīto rūpaṃ ‘netaṃ mama, nesohamasmi, na meso attā’ti samanupassati, vedanaṃ…pe…, saññaṃ…pe…, saṅkhāre…pe…, viññāṇaṃ ‘netaṃ mama, nesohamasmi, na meso attā’ti samanupassati.

"Bhikkhus, whatever bhikkhu is an Arahant...pe... I declare him to be fully enlightened." This teaching "Bhikkhus, the well-instructed noble disciple...pe... well-trained in the Dhamma of the virtuous, regards form as 'This is not mine, I am not this, this is not my self,' regards feeling...pe..., perception...pe..., formations...pe..., consciousness as 'This is not mine, I am not this, this is not my self.'"

“Này các Tỳ-khưu, vị Tỳ-khưu A-la-hán ấy… (vân vân)… Ta nói là bậc Chánh Đẳng Giác” – lời dạy này tương ứng với lời dạy: “Này các Tỳ-khưu, vị Thánh đệ tử có nghe… (vân vân)… được huấn luyện kỹ lưỡng trong Chánh pháp của bậc Chân nhân, quán sát sắc: ‘Cái này không phải của tôi, tôi không phải là cái này, cái này không phải tự ngã của tôi’; quán sát thọ… (vân vân)…; quán sát tưởng… (vân vân)…; quán sát hành… (vân vân)…; quán sát thức: ‘Cái này không phải của tôi, tôi không phải là cái này, cái này không phải tự ngã của tôi’.”

Yampi taṃ diṭṭhaṃ sutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tampi ‘netaṃ mama, nesohamasmi, na meso attā’ti samanupassati.

"Whatever is seen, heard, cognized, attained, sought, pondered by the mind, that too he regards as 'This is not mine, I am not this, this is not my self.'"

Những gì được thấy, được nghe, được biết, được đạt đến, được tìm cầu, được tư duy bằng ý, vị ấy cũng quán sát: ‘Cái này không phải của tôi, tôi không phải là cái này, cái này không phải tự ngã của tôi’.

Yampi taṃ diṭṭhiṭṭhānaṃ, so loko so attā so pecca bhavissāmi ‘nicco dhuvo sassato api pariṇāmadhammo sassatisamaṃ tatheva ṭhassāmī’ti, tampi ‘netaṃ mama, nesohamasmi, na meso attā’ti samanupassati.

"Whatever view-point there is, 'This is the world, this is the self, after death I shall be permanent, stable, eternal, not subject to change, I shall remain the same for eternity,' that too he regards as 'This is not mine, I am not this, this is not my self.'"

Những gì là quan điểm: ‘Đó là thế giới, đó là tự ngã, sau khi chết tôi sẽ tồn tại vĩnh cửu, kiên cố, thường hằng, không biến đổi, tôi sẽ tồn tại mãi mãi như vậy’, vị ấy cũng quán sát: ‘Cái này không phải của tôi, tôi không phải là cái này, cái này không phải tự ngã của tôi’.

So evaṃ samanupassanto na paritassatī’’ti (ma. ni. 1.241) evamādidesanāhi saṃsandatīti, ayaṃ catubyūho hāro.

"He, thus seeing, does not tremble" — this teaching is in harmony with such teachings. This is the Scheme of Four Divisions.

Quán sát như vậy, vị ấy không kinh hoàng” (Ma. Ni. 1.241). Do đó, lời dạy này tương ứng. Đây là phương pháp bốn loại.

428

7. Āvattahāravaṇṇanā

7. Explanation of the Scheme of Turning

7. Giải thích phương pháp xoay chuyển

429

‘‘Assutavā puthujjano’’ti iminā yonisomanasikārapaṭikkhepamukhena ayonisomanasikārapariggaho dīpito.

By "The uninstructed ordinary person," the rejection of proper attention (yonisomanasikāra) and the embracing of improper attention (ayonisomanasikāra) is shown.

Với câu “Phàm phu không có nghe”, việc bác bỏ tác ý như lý (yonisomanasikāra) đã được chỉ rõ, và việc nắm giữ tác ý phi như lý (ayoniso manasikāra) đã được trình bày.

‘‘Ariyānaṃ adassāvī’’tiādinā sappurisūpanissayādipaṭikkhepamukhena asappurisūpanissayādipariggaho dīpito.

By "Not seeing the Noble Ones," etc., the rejection of reliance on the virtuous (sappurisūpanissaya), etc., and the embracing of reliance on the unvirtuous (asappurisūpanissaya), etc., is shown.

Với câu “Không thấy các bậc Thánh” (Ariyānaṃ adassāvī) v.v., việc bác bỏ sự nương tựa vào bậc chân nhân v.v. đã được chỉ rõ, và việc nắm giữ sự nương tựa vào phi chân nhân v.v. đã được trình bày.

Tesu purimanayena āsayavipatti kittitā, dutiyena payogavipatti.

Among these, by the former method, perversion of intention is praised; by the latter, perversion of application.

Trong số đó, sự bại hoại về ý định (āsayavipatti) được ca ngợi theo cách trước, và sự bại hoại về hành vi (payogavipatti) theo cách thứ hai.

Purimena cassa kilesavaṭṭaṃ, tañca yato vipākavaṭṭanti sakalaṃ saṃsāracakkamāvattati.

By the former, his round of defilements, and since that is the round of results, the entire cycle of saṃsāra turns.

Với cách trước, vòng luân hồi phiền não (kilesavaṭṭa) của người ấy, và từ đó, vòng luân hồi quả báo (vipākavaṭṭa) – toàn bộ bánh xe luân hồi – xoay chuyển.

‘‘Pathaviṃ maññatī’’tiādinā tattha tisso maññanā vuttā.

By "He conceives earth," etc., three modes of conceiving are stated there.

Với câu “Cho rằng đất” (Pathaviṃ maññatī) v.v., ba loại tưởng tri (maññanā) đã được nói đến ở đó.

Tāsu taṇhāmaññanā ‘‘etaṃ mamā’’ti taṇhāggāho, mānamaññanā ‘‘esohamasmī’’ti mānaggāho, diṭṭhimaññanā ‘‘eso me attā’’ti diṭṭhiggāho.

Among these, the conceiving of craving is the grasping of craving, "This is mine"; the conceiving of conceit is the grasping of conceit, "I am this"; the conceiving of views is the grasping of views, "This is my self."

Trong số đó, tưởng tri ái (taṇhāmaññanā) là sự chấp thủ ái (taṇhāggāho) “cái này là của tôi”; tưởng tri mạn (mānamaññanā) là sự chấp thủ mạn (mānaggāho) “tôi là cái này”; tưởng tri kiến (diṭṭhimaññanā) là sự chấp thủ kiến (diṭṭhiggāho) “cái này là tự ngã của tôi”.

Tattha taṇhāggāhena ‘‘taṇhaṃ paṭiccapariyesanā’’tiādikā (dī. ni. 2.103; dī. ni. 3.359; a. ni. 3.23; vibha. 963) nava taṇhāmūlakā dhammā āvattanti.

Among these, by the grasping of craving, the nine Dhammas rooted in craving, such as "Craving as a condition for seeking," turn.

Ở đó, với sự chấp thủ ái, chín pháp có gốc từ ái, như “do ái nên có tìm cầu” (Dī. Ni. 2.103; Dī. Ni. 3.359; A. Ni. 3.23; Vibha. 963) v.v., xoay chuyển.

Mānaggāhena ‘‘seyyohamasmī’’tiādikā nava mānavidhā āvattanti.

By the grasping of conceit, the nine modes of conceit, such as "I am superior," turn.

Với sự chấp thủ mạn, chín loại mạn, như “tôi hơn” (seyyohamasmī) v.v., xoay chuyển.

Diṭṭhiggāhena ‘‘rūpaṃ attato samanupassatī’’tiādikā (saṃ. ni. 4.345) vīsativatthukā sakkāyadiṭṭhi āvattati.

By the grasping of views, the twenty-fold view of self (sakkāyadiṭṭhi), such as "He regards form as self," turns.

Với sự chấp thủ kiến, tà kiến về năm uẩn (sakkāyadiṭṭhi) với hai mươi căn bản, như “quán sắc là tự ngã” (rūpaṃ attato samanupassatī) v.v. (Saṃ. Ni. 4.345), xoay chuyển.

Tīsu ca gāhesu yāya saññāya taṇhāggāhassa vikkhambhanā, sā dukkhasaññā dukkhānupassanā.

Among the three graspings, the perception by which the grasping of craving is inhibited is the perception of suffering, the contemplation of suffering.

Trong ba sự chấp thủ đó, tưởng tri nào là sự trấn áp sự chấp thủ ái, đó là tưởng tri khổ (dukkhasaññā), quán khổ (dukkhānupassanā).

Yāya saññāya mānaggāhassa vikkhambhanā, sā aniccasaññā aniccānupassanā.

The perception by which the grasping of conceit is inhibited is the perception of impermanence, the contemplation of impermanence.

Tưởng tri nào là sự trấn áp sự chấp thủ mạn, đó là tưởng tri vô thường (aniccasaññā), quán vô thường (aniccānupassanā).

Yāya pana saññāya diṭṭhiggāhassa vikkhambhanā, sā anattasaññā anattānupassanā.

The perception by which the grasping of views is inhibited is the perception of not-self, the contemplation of not-self.

Còn tưởng tri nào là sự trấn áp sự chấp thủ kiến, đó là tưởng tri vô ngã (anattasaññā), quán vô ngã (anattānupassanā).

Tattha paṭhamaggāhavisabhāgato appaṇihitavimokkhamukhaṃ āvattati, dutiyaggāhavisabhāgato animittavimokkhamukhaṃ āvattati, tatiyaggāhavisabhāgato suññatavimokkhamukhaṃ āvattati.

Among these, from the opposite of the first grasping, the liberation of the aimless (appaṇihitavimokkhamukha) turns; from the opposite of the second grasping, the liberation of the signless (animittavimokkhamukha) turns; from the opposite of the third grasping, the liberation of emptiness (suññatavimokkhamukha) turns.

Ở đó, từ sự đối lập với sự chấp thủ thứ nhất, cửa giải thoát vô nguyện (appaṇihitavimokkhamukhaṃ) xoay chuyển; từ sự đối lập với sự chấp thủ thứ hai, cửa giải thoát vô tướng (animittavimokkhamukhaṃ) xoay chuyển; từ sự đối lập với sự chấp thủ thứ ba, cửa giải thoát không (suññatavimokkhamukhaṃ) xoay chuyển.

430

Sekkhaggahaṇena ariyāya sammādiṭṭhiyā saṅgaho, tato ca paratoghosayonisomanasikārā dīpitā honti.

By the mention of the trainee (sekkhaggahaṇa), noble right view is encompassed, and from that, the external voice (paratoghosā) and proper attention (yonisomanasikāra) are shown.

Với việc nắm giữ bậc Hữu học (sekkhaggahaṇena), sự tập hợp của chánh kiến Thánh (ariyāya sammādiṭṭhiyā) được bao gồm, và từ đó, tác ý từ bên ngoài (paratoghosayonisomanasikārā) được chỉ rõ.

Paratoghosena ca sutavā ariyasāvakoti āvattati, yonisomanasikārena nava yonisomanasikāramūlakā dhammā āvattanti, catubbidhañca sampatticakkaṃ.

By the external voice, "the well-instructed noble disciple" turns; by proper attention, the nine Dhammas rooted in proper attention turn, and the four-fold wheel of accomplishment.

Với tác ý từ bên ngoài, Thánh đệ tử có nghe (sutavā ariyasāvako) xoay chuyển; với tác ý như lý, chín pháp có gốc từ tác ý như lý xoay chuyển, và bánh xe thành tựu bốn loại.

‘‘Mā maññī’’ti maññanānaṃ vippakatappahānatāgahaṇena ekaccāsavaparikkhayo dīpito hoti, tena ca saddhāvimuttadiṭṭhippattakāyasakkhibhāvā āvattanti.

By "Do not conceive," with the inclusion of the abandonment of the defiled conceptions, the destruction of some cankers is shown, and by that, the faith-liberated, the view-attained, and those who are body-witnesses turn.

Với câu “Đừng cho rằng” (Mā maññīti), việc nắm giữ sự đoạn trừ các tưởng tri đã được thực hành được chỉ rõ, và do đó, các vị giải thoát nhờ đức tin (saddhāvimutta), đạt đến kiến (diṭṭhippatta), chứng thân (kāyasakkhibhāva) xoay chuyển.

‘‘Arahaṃ khīṇāsavo’’tiādinā asekkhā sīlakkhandhādayo dassitā honti, sīlakkhandhādipāripūriyā ca dasa nāthakaraṇā dhammā āvattanti.

By "Arahant, with defilements destroyed," etc., the supramundane (asekkha) aggregates of morality, etc., are demonstrated, and with the completion of the aggregates of morality, etc., the ten Dhamma factors that provide protection turn.

Với câu “A-la-hán, lậu tận” (Arahaṃ khīṇāsavo) v.v., các uẩn giới đức (sīlakkhandha) v.v. của bậc Vô học (asekkha) đã được trình bày, và với sự viên mãn của các uẩn giới đức v.v., mười pháp làm nơi nương tựa (nāthakaraṇā dhammā) xoay chuyển.

‘‘Na maññatī’’ti maññanāpaṭikkhepena pañcasu upādānakkhandhesu ‘‘netaṃ mama, nesohamasmi, na meso attā’’ti sammāpaṭipatti dassitā, tāya ca sātisayā nikantipariyādānamānasamugghāṭanadiṭṭhiugghāṭanāni pakāsitānīti appaṇihitānimitta-suññatavimokkhā āvattanti.

By "Does not conceive," through the rejection of conceiving, the right practice regarding the five aggregates of clinging, "This is not mine, I am not this, this is not my self," is shown; and by that, the removal of attachment, the eradication of conceit, and the uprooting of views are especially revealed, thus the aimless, signless, and emptiness liberations turn.

Với việc bác bỏ tưởng tri “không cho rằng” (na maññatī), sự thực hành đúng đắn “cái này không phải của tôi, tôi không phải là cái này, cái này không phải tự ngã của tôi” trong năm uẩn chấp thủ đã được trình bày, và do đó, sự đoạn trừ tham ái một cách đặc biệt, sự nhổ bật mạn, sự nhổ bật kiến đã được công bố, và các giải thoát vô nguyện, vô tướng, không xoay chuyển.

431

‘‘Tathāgato’’tiādinā sabbaññuguṇā vibhāvitāti tadavinābhāvato dasabala-catuvesārajjaasādhāraṇañāṇaāveṇikabuddhadhammā āvattanti.

By "The Tathāgata," etc., the qualities of omniscience are explained, and thus, inseparable from that, the ten powers, the four kinds of self-confidence, the exclusive knowledge, and the unique Buddha-qualities turn.

Với câu “Như Lai” (Tathāgato) v.v., các phẩm chất của bậc Toàn giác đã được trình bày, và do đó, mười lực (dasabala), bốn vô sở úy (catuvesārajja), các trí tuệ không chung (asādhāraṇañāṇa), các pháp Phật độc đáo (āveṇikabuddhadhamma) xoay chuyển.

‘‘Nandī dukkhassa mūla’’ntiādinā saddhiṃ hetunā vaṭṭavivaṭṭaṃ kathitanti pavattinivattitadubhayahetuvibhāvanena cattāri ariyasaccāni āvattanti.

By "Delight is the root of suffering," etc., the cycle of existence and the cessation of the cycle of existence are described together with their causes, and thus, by explaining both the cause of arising and the cause of cessation, the Four Noble Truths turn.

Với câu “Hỷ là cội rễ của khổ” (Nandī dukkhassa mūlaṃ) v.v., vòng luân hồi và vòng thoát ly đã được nói đến cùng với nguyên nhân, và do đó, bốn Thánh đế xoay chuyển bằng cách trình bày cả hai nguyên nhân của sự tiếp diễn và sự chấm dứt.

‘‘Taṇhānaṃ khayā’’tiādinā taṇhappahānāpadesena tadekaṭṭhabhāvato diyaḍḍhassa kilesasahassassa pahānaṃ āvattati.

By "Through the destruction of craving," etc., by means of the abandonment of craving, the abandonment of one and a half thousand defilements turns, being of the same meaning.

Với câu “Do diệt ái” (Taṇhānaṃ khayā) v.v., do sự đoạn trừ ái, sự đoạn trừ một ngàn rưỡi phiền não đã được nói đến, do chúng có cùng một ý nghĩa.

‘‘Sabbaso taṇhānaṃ khayā sammāsambodhiṃ abhisambuddho’’ti ca vuttattā ‘‘nandī dukkhassa mūla’’nti, ‘‘iti viditvā’’tiādinā vuttassa maññanābhāvahetubhūtassa paccayākāravedanassa sāvakehi asādhāraṇañāṇacārabhāvo dassito, tena catuvīsatikoṭisatasahassasamāpattisañcāri bhagavato mahāvajirañāṇaṃ āvattatīti.

And because it is said, "through the complete destruction of craving, he is fully enlightened to perfect self-awakening," the fact that the Buddha's unsurpassed knowledge of dependent origination and feeling, which is the cause of the non-existence of conceiving, as stated in "Delight is the root of suffering" and "Having thus understood," etc., is shown to be unique to the Buddha, not shared with disciples. Thus, the Buddha's great diamond-like knowledge, which traverses hundreds of thousands of crores of attainments, turns.

Và vì đã nói “do diệt hoàn toàn các ái, bậc Chánh Đẳng Giác đã chứng ngộ Chánh Đẳng Giác”, nên sự vận hành trí tuệ không chung của các đệ tử về cảm thọ nhân duyên đã được nói đến, là nguyên nhân của việc không có tưởng tri đã nói đến trong “Hỷ là cội rễ của khổ” và “biết như vậy” v.v., và do đó, đại kim cương trí của Thế Tôn, vận hành trong một trăm ngàn hai mươi bốn mươi triệu tam muội, xoay chuyển.

Ayaṃ āvatto hāro.

This is the Scheme of Turning.

Đây là phương pháp xoay chuyển.

432

8. Vibhattihāravaṇṇanā

8. Explanation of the Scheme of Division

8. Giải thích phương pháp phân loại

433

‘‘Sabbadhammamūlapariyāya’’nti ettha sabbadhammā nāma tebhūmakā dhammā sakkāyassa adhippetattā.

In "The Discourse on the Root of All Dhammas," all dhammas refer to the states pertaining to the three planes of existence, because the view of self (sakkāya) is intended.

Trong “Sabbadhammamūlapariyāyaṃ” (Bài kinh căn bản của mọi pháp), mọi pháp (sabbadhammā) ở đây có nghĩa là các pháp thuộc ba cõi (tebhūmakā dhammā) vì liên quan đến năm uẩn (sakkāya).

Tesaṃ maññanā padaṭṭhānaṃ papañcasaṅkhānimittattā lokavicittassa.

Conceiving them is the proximate cause, the sign of proliferation, the variegation of the world.

Tưởng tri về chúng là căn bản (padaṭṭhāna) của sự phóng dật (papañca) và là dấu hiệu (nimitta) của sự đa dạng của thế giới (lokavicittassa).

Tayime kusalā akusalā abyākatāti tividhā.

These are of three kinds: wholesome, unwholesome, and indeterminate.

Chúng có ba loại: thiện (kusalā), bất thiện (akusalā), và vô ký (abyākatā).

Tesu kusalānaṃ yonisomanasikārādi padaṭṭhānaṃ, akusalānaṃ ayonisomanasikārādi, abyākatānaṃ kammabhavaāvajjanabhūtarūpādi padaṭṭhānaṃ.

Among these, the proximate cause for wholesome states is proper attention (yonisomanasikāra), etc.; for unwholesome states, improper attention (ayonisomanasikāra), etc.; for indeterminate states, kamma, existence, adverting, and fundamental materiality, etc., are the proximate causes.

Trong số đó, căn bản của các pháp thiện là tác ý như lý (yonisomanasikāra) v.v.; của các pháp bất thiện là tác ý phi như lý (ayoniso manasikāra) v.v.; của các pháp vô ký là nghiệp hữu (kammabhava), sự hướng tâm (āvajjanā), sắc vật chất (bhūtarūpa) v.v.

Tattha kusalā kāmāvacarādivasena bhūmito tividhā, tathā abyākatā cittuppādasabhāvā, acittuppādasabhāvā pana kāmāvacarāva tathā akusalā.

Among these, wholesome states are of three kinds according to their plane, such as belonging to the sense-sphere, etc.; similarly, indeterminate states whose nature is consciousness-generating; those whose nature is not consciousness-generating are of the sense-sphere only, as are unwholesome states.

Ở đó, các pháp thiện có ba loại theo cõi, như cõi dục (kāmāvacarā) v.v.; các pháp vô ký có tính chất tâm sinh (cittuppādasabhāvā), còn các pháp không có tính chất tâm sinh thì chỉ thuộc cõi dục; các pháp bất thiện cũng vậy.

Pariyattipaṭipattipaṭivedhasutakiccābhāvena tividho assutavā.

The uninstructed person is of three kinds due to the absence of the tasks of study, practice, and penetration.

Người không có nghe (assutavā) có ba loại do không có việc học tập (pariyatti), thực hành (paṭipatti), và chứng ngộ (paṭivedha).

Andhakalyāṇavibhāgena duvidho puthujjano.

The ordinary person is of two kinds, by the division of the blind and the virtuous.

Phàm phu (puthujjano) có hai loại theo sự phân biệt người mù (andhakalyāṇa) và người có mắt.

Sammāsambuddhapaccekabuddhasāvakabhedena tividhā ariyā.

The Noble Ones are of three kinds, by the distinction of Perfectly Self-Enlightened Buddhas, Paccekabuddhas, and disciples.

Các bậc Thánh (ariyā) có ba loại theo sự phân biệt Chánh Đẳng Giác (sammāsambuddha), Độc Giác (paccekabuddha), và Thanh Văn (sāvaka).

Maṃsacakkhudibbacakkhupaññācakkhūhi dassanābhāvena tividho adassāvī.

Not seeing is of three kinds due to the absence of seeing with the fleshy eye, the divine eye, and the eye of wisdom.

Người không thấy (adassāvī) có ba loại do không có sự thấy bằng nhục nhãn (maṃsacakkhu), thiên nhãn (dibbacakkhu), và tuệ nhãn (paññācakkhu).

Maggaphalanibbānabhedena tividho, navavidho vā ariyadhammo.

The noble Dhamma is of three kinds according to path, fruit, and Nibbāna, or of nine kinds.

Pháp Thánh (ariyadhammo) có ba loại theo sự phân biệt Đạo (magga), Quả (phala), và Niết Bàn (nibbāna), hoặc chín loại.

Savanadhāraṇaparicayamanasikārapaṭivedhavasena pañcavidhā ariyadhammassa kovidatā.

Expertise in the noble Dhamma is of five kinds, according to hearing, memorizing, familiarity, attention, and penetration.

Sự thông hiểu Pháp Thánh (ariyadhammassa kovidatā) có năm loại theo sự nghe (savana), ghi nhớ (dhāraṇa), làm quen (paricaya), tác ý (manasikāra), và chứng ngộ (paṭivedha).

Tadabhāvato akovido.

Lack of expertise is due to the absence of these.

Không thông hiểu (akovido) do không có những điều đó.

Saṃvarapahānabhedena duvidho, dasavidho vā ariyadhammavinayo, tadabhāvato ariyadhamme avinīto.

The discipline of the noble Dhamma is of two kinds by the distinction of restraint and abandonment, or of ten kinds; lack of training in the noble Dhamma is due to the absence of these.

Giới luật Thánh (ariyadhammavinayo) có hai loại theo sự phân biệt phòng hộ (saṃvara) và đoạn trừ (pahāna), hoặc mười loại; không được huấn luyện trong Pháp Thánh (ariyadhamme avinīto) do không có những điều đó.

Ettha padaṭṭhānavibhāgo heṭṭhā dassitoyeva.

Here, the division of proximate causes has already been shown below.

Ở đây, sự phân biệt căn bản (padaṭṭhānavibhāgo) đã được trình bày ở dưới.

‘‘Sappurisānaṃ adassāvī’’tiādīsupi eseva nayo.

The same method applies to "Not seeing the virtuous," etc.

Trong “Không thấy các bậc Chân nhân” (Sappurisānaṃ adassāvī) v.v. cũng theo cách này.

‘‘Pathaviṃ maññatī’’tiādīsu maññanāvatthuvibhāgo pāḷiyaṃ āgatova, tathā ajjhattikabāhirādiko ca antaravibhāgo.

In "He conceives earth," etc., the division of the objects of conceiving is given in the Pāḷi itself, as is the internal division such as subjective and objective.

Trong “Cho rằng đất” (Pathaviṃ maññatī) v.v., sự phân biệt các đối tượng của tưởng tri (maññanāvatthuvibhāgo) đã được trình bày trong kinh điển, cũng như sự phân biệt nội tại và ngoại tại (ajjhattikabāhirādiko ca antaravibhāgo).

434

Maññanā pana taṇhāmānadiṭṭhivasena saṅkhepato tividhā, vitthārato pana taṇhāmaññanā tāva kāmataṇhādivasena aṭṭhasatavidhā, tathā ‘‘asmīti sati itthaṃsmīti hotī’’tiādinā.

Conceiving, however, is summarily of three kinds according to craving, conceit, and views; but in detail, craving-conceiving is of one hundred and eight kinds, such as based on sensual craving, etc., and also, "When there is the thought 'I am,' then there is 'I am thus.'"

Tuy nhiên, tưởng tri (maññanā) tóm tắt có ba loại theo ái, mạn, và kiến; còn chi tiết, tưởng tri ái có một trăm lẻ tám loại theo ái dục (kāmataṇhā) v.v., cũng như “khi có ‘tôi là’, thì có ‘tôi là như thế này’” (asmīti sati itthaṃsmīti hotī) v.v.

Evaṃ mānamaññanāpi.

Similarly with conceit-conceiving.

Tưởng tri mạn cũng vậy.

‘‘Asmīti sati itthaṃsmīti hotī’’tiādinā papañcattayaṃ uddiṭṭhaṃ niddiṭṭhañcāti.

Thus, by "When there is the thought 'I am,' then there is 'I am thus,'" the three-fold proliferation is both stated and explained.

Với câu “khi có ‘tôi là’, thì có ‘tôi là như thế này’” v.v., ba loại phóng dật (papañcattayaṃ) đã được nêu ra và giải thích.

Etena diṭṭhimaññanāyapi aṭṭhasatavidhatā vuttāti veditabbā.

By this, it should be understood that even in the perception of wrong views, 108 kinds are stated.

Bằng cách này, ngay cả sự nhận thức sai lầm về quan điểm cũng nên được hiểu là có 108 loại đã được nói đến.

Apica seyyassa ‘‘seyyohamasmī’’tiādinā mānamaññanāya navavidhatā tadantarabhedena anekavidhatā ca veditabbā.

Moreover, it should be understood that regarding the perception of conceit, such as "I am superior," there are nine kinds, and through its internal distinctions, there are countless kinds.

Hơn nữa, sự nhận thức sai lầm do kiêu mạn của người tự cho là cao thượng với câu nói “Tôi là người cao thượng”, v.v., nên được hiểu là có chín loại, và với các phân loại bên trong đó thì có nhiều loại.

Ayañca attho hīnattikatthavaṇṇanāya vibhāvetabbo.

And this meaning should be expounded through the description of the meaning of the three inferior ones.

Và ý nghĩa này nên được làm rõ trong phần giải thích về ý nghĩa của ba loại thấp kém.

Diṭṭhimaññanāya pana brahmajāle āgatanayena dvāsaṭṭhividhatā tadantarabhedena anekavidhatā ca veditabbā.

However, regarding the perception of wrong views, by the method given in the Brahmajāla Sutta, 62 kinds, and through its internal distinctions, countless kinds, should be understood.

Nhưng đối với sự nhận thức sai lầm về quan điểm, theo cách đã được trình bày trong kinh Brahmajāla, nên được hiểu là có 62 loại, và với các phân loại bên trong đó thì có nhiều loại.

‘‘Apariññāta’’nti ettha ñātapariññādivasena ceva rūpamukhādiabhinivesabhedādivasena ca pariññānaṃ anekavidhatā veditabbā.

In the phrase ‘‘Apariññātaṃ’’ (not fully understood), the countless kinds of full understanding should be known, both by way of understanding-full understanding and by way of the distinctions in attachment to form and other aspects.

Trong từ “apariññāta” (chưa được quán triệt) ở đây, sự quán triệt (pariññā) nên được hiểu là có nhiều loại dựa trên sự quán triệt bằng tri kiến (ñāta-pariññā), v.v., và dựa trên sự khác biệt của sự chấp thủ vào sắc, miệng, v.v.

Tathā aṭṭhamakādivasena sekkhavibhāgo paññāvimuttādivasena asekkhavibhāgo ca.

Similarly, the division of trainees (sekkhā) by way of those in the eighth stage and so on, and the division of adepts (asekhā) by way of those freed by wisdom and so on.

Tương tự, sự phân loại về Bậc Hữu Học (sekha) dựa trên Bậc Thứ Tám (aṭṭhamaka), v.v., và sự phân loại về Bậc Vô Học (asekkhā) dựa trên giải thoát bằng trí tuệ (paññāvimutta), v.v.

Ayamettha dhammavibhāgo.

This is the exposition of Dhamma here.

Đây là sự phân loại pháp (dhamma-vibhāga) ở đây.

Padaṭṭhānavibhāgo ca bhūmivibhāgo ca vuttanayānusārena veditabbāti.

And the exposition of the proximate cause and the exposition of the planes should be understood according to the stated method.

Và sự phân loại về căn cứ (padaṭṭhāna-vibhāga) và sự phân loại về cảnh giới (bhūmi-vibhāga) nên được hiểu theo cách đã nói.

Ayaṃ vibhattihāro.

This is the Vibhatti-hāra (Division Method).

Đây là phương pháp phân tích (Vibhatti-hāra).

435

9. Parivattahāravaṇṇanā

9. Description of the Parivatta-hāra

9. Giải thích phương pháp chuyển đổi (Parivatta-hāra)

436

‘‘Sabbadhammamūlapariyāya’’nti ettha ‘‘sabbadhammā’’ti pañcupādānakkhandhā gahitā, tesaṃ mūlakāraṇanti ca taṇhāmānadiṭṭhiyo.

In ‘‘Sabbadhammamūlapariyāyaṃ’’ (The Root of All Phenomena), ‘‘all phenomena’’ refers to the five clinging-aggregates, and their fundamental cause consists of craving, conceit, and wrong views.

Trong cụm từ “sabbadhammamūlapariyāya” (Bài kinh căn bản của tất cả các pháp), “sabbadhammā” (tất cả các pháp) được hiểu là năm uẩn chấp thủ (pañcupādānakkhandhā), và “mūlakāraṇa” (nguyên nhân căn bản) là tham ái (taṇhā), kiêu mạn (māna) và tà kiến (diṭṭhi).

Tathā assutavā puthujjano…pe… sappurisadhamme avinītoti.

Similarly, an uninstructed ordinary person…pe… undisciplined in the Dhamma of the good.

Tương tự, phàm phu vô văn…pe… không được huấn luyện trong Chánh Pháp của bậc chân nhân.

Yāvakīvañca pañcasu upādānakkhandhesu subhato sukhato niccato attato samanupassanavasena ‘‘etaṃ mama, esohamasmi, eso me attā’’ti taṇhāmānadiṭṭhigāhā na samucchijjanti, tāva nesaṃ pabandhūparamo supinantepi na kenaci laddhapubbo.

As long as the clingings of craving, conceit, and wrong views – in the form of regarding as beautiful, as pleasant, as permanent, and as self, by thinking ‘‘This is mine, this I am, this is my self’’ – are not eradicated in the five clinging-aggregates, their cessation of continuity has never been attained by anyone, not even in a dream.

Và chừng nào sự chấp thủ tham ái, kiêu mạn, tà kiến dưới dạng “cái này là của tôi, tôi là cái này, cái này là tự ngã của tôi” chưa bị diệt trừ trong năm uẩn chấp thủ bằng cách xem chúng là đẹp đẽ, an lạc, thường hằng, và tự ngã, thì sự chấm dứt liên tục của chúng chưa từng được ai đạt đến ngay cả trong giấc mơ.

Yadā pana nesaṃ asubhato dukkhato aniccato anattato samanupassanavasena ‘‘netaṃ mama, nesohamasmi, na meso attā’’ti pavattamānā appaṇihitānimittasuññatānupassanā ussakkitvā ariyamaggādhigamāya saṃvattanti, atha nesaṃ pabandhūparamo hoti accantaappaññattikabhāvūpagamanato.

But when the meditation on the signless, the undirected, and emptiness, arising from the perception of them as unbeautiful, as suffering, as impermanent, and as not-self – thinking ‘‘This is not mine, this I am not, this is not my self’’ – becomes strong and conducive to the attainment of the Noble Path, then their continuity ceases due to their reaching a state of absolute non-manifestation.

Nhưng khi sự quán chiếu vô nguyện (appaṇihita), vô tướng (animitta), không (suññatā) đang diễn ra dưới dạng “cái này không phải của tôi, tôi không phải cái này, cái này không phải tự ngã của tôi” bằng cách xem chúng là bất tịnh, khổ, vô thường, và vô ngã, trở nên mạnh mẽ và dẫn đến sự chứng đắc Thánh Đạo, thì khi đó sự chấm dứt liên tục của chúng xảy ra do đạt đến trạng thái hoàn toàn không còn được thiết lập (accantaappaññattikabhāvūpagamanato).

Tena vuttaṃ ‘‘sabbadhammāti pañcupādānakkhandhā gahitā, tesaṃ mūlakāraṇanti ca taṇhāmānadiṭṭhiyo’’ti.

Therefore, it is said, ‘‘ ‘All phenomena’ refers to the five clinging-aggregates, and their fundamental cause consists of craving, conceit, and wrong views.’’

Do đó, đã nói rằng “sabbadhammā (tất cả các pháp) được hiểu là năm uẩn chấp thủ, và mūlakāraṇa (nguyên nhân căn bản) là tham ái, kiêu mạn và tà kiến”.

Tathā assutavā puthujjano…pe… sappurisadhamme avinīto tīhipi maññanāhi pathaviṃ maññati yāva nibbānaṃ abhinandati, tīhipi pariññāhi tassa taṃ vatthu apariññātanti katvā.

Similarly, an uninstructed ordinary person…pe… undisciplined in the Dhamma of the good, perceives the earth and delights in Nibbāna by means of the three perceptions, having understood that object as not fully comprehended by him through the three kinds of full understanding.

Tương tự, phàm phu vô văn…pe… không được huấn luyện trong Chánh Pháp của bậc chân nhân, nhận thức về đất (pathaviṃ maññati) bằng ba loại nhận thức sai lầm (maññanā), cho đến khi hoan hỷ Niết Bàn, vì đối với người đó, đối tượng đó chưa được quán triệt bằng ba loại quán triệt (pariññā).

Yassa pana taṃ vatthu tīhi pariññāhi pariññātaṃ, na so itaro viya taṃ maññati.

But for one for whom that object is fully comprehended by the three kinds of full understanding, he does not perceive it like the other.

Nhưng đối với người mà đối tượng đó đã được quán triệt bằng ba loại quán triệt, người đó không nhận thức về nó như người kia.

Tenāha bhagavā ‘‘sutavā ca kho, bhikkhave, ariyasāvako…pe… sappurisadhamme suvinīto rūpaṃ ‘netaṃ mama, nesohamasmi, na meso attā’ti samanupassati, vedanaṃ…pe… asati na paritassatī’’ti (ma. ni. 1.241).

Therefore, the Blessed One said, ‘‘Here, bhikkhus, a well-instructed noble disciple…pe… well-disciplined in the Dhamma of the good, perceives form as ‘This is not mine, this I am not, this is not my self,’ perceives feeling…pe… does not worry about non-existence’’.

Do đó, Đức Thế Tôn đã nói: “Này các Tỳ-kheo, vị Thánh đệ tử có nghe pháp…pe… được huấn luyện tốt trong Chánh Pháp của bậc chân nhân, quán chiếu sắc ‘cái này không phải của tôi, tôi không phải cái này, cái này không phải tự ngã của tôi’, thọ…pe… không lo lắng khi không có.” (Ma. Ni. 1.241).

Sekkho pathaviṃ mā maññi, yāva nibbānaṃ mābhinandi, arahā sammāsambuddho ca pathaviṃ na maññati, yāva nibbānaṃ nābhinandati, maññanāmaññitesu vatthūsu mattaso sabbaso ca pariññābhisamayasaṃsiddhiyā pahānābhisamayanibbattito.

A trainee (sekha) should not perceive the earth, should not delight in Nibbāna; an Arahant, a Perfectly Self-Enlightened One, does not perceive the earth, does not delight in Nibbāna, because of the accomplishment of full understanding and penetrative knowledge, and the arising of abandonment-penetrative knowledge, both in part and entirely, regarding the objects of perception and non-perception.

Bậc Hữu Học (sekha) không nên nhận thức về đất, cho đến khi không hoan hỷ Niết Bàn; và Bậc A-la-hán, Bậc Chánh Đẳng Chánh Giác không nhận thức về đất, cho đến khi không hoan hỷ Niết Bàn, do sự thành tựu quán triệt và chứng ngộ hoàn toàn hoặc một phần đối với các đối tượng được nhận thức và không được nhận thức, và do sự phát sinh của sự chứng ngộ đoạn trừ.

Yassa pana tesu vatthūsu sabbaso mattaso vā pariññā eva natthi, kuto pahānaṃ, so yathāparikappaṃ niraṅkusāhi maññanāhi ‘‘etaṃ mamā’’tiādinā maññateva.

However, for one who has no full understanding at all, either in part or entirely, regarding these objects, how can there be abandonment? Such a person, according to his own preconception, perceives recklessly with perceptions like ‘‘This is mine’’ and so on.

Nhưng đối với người mà không có sự quán triệt hoàn toàn hoặc một phần đối với các đối tượng đó, thì làm sao có sự đoạn trừ? Người đó vẫn nhận thức theo sự suy tưởng của mình bằng các nhận thức sai lầm vô hạn như “cái này là của tôi”, v.v.

Tenāha bhagavā ‘‘idha, bhikkhave, assutavā puthujjano…pe… sappurisadhamme avinīto rūpaṃ ‘etaṃ mama, esohamasmi, eso me attā’ti samanupassati, vedanaṃ…pe…, sañña…pe…’’ntiādi (ma. ni. 1.241).

Therefore, the Blessed One said, ‘‘Here, bhikkhus, an uninstructed ordinary person…pe… undisciplined in the Dhamma of the good, perceives form as ‘This is mine, this I am, this is my self,’ perceives feeling…pe…, perception…pe…’’ and so on.

Do đó, Đức Thế Tôn đã nói: “Ở đây, này các Tỳ-kheo, phàm phu vô văn…pe… không được huấn luyện trong Chánh Pháp của bậc chân nhân, quán chiếu sắc ‘cái này là của tôi, tôi là cái này, cái này là tự ngã của tôi’, thọ…pe…, tưởng…pe…” v.v. (Ma. Ni. 1.241).

Ayaṃ parivatto hāro.

This is the Parivatta-hāra (Transformation Method).

Đây là phương pháp chuyển đổi (Parivatta-hāra).

437

10. Vevacanahāravaṇṇanā

10. Description of the Vevacana-hāra

10. Giải thích phương pháp đồng nghĩa (Vevacana-hāra)

438

‘‘Sabbadhammā sakaladhammā anavasesadhammā’’ti pariyāyavacanaṃ, ‘‘mūlapariyāyaṃ mūlakāraṇaṃ asādhāraṇahetu’’nti pariyāyavacanaṃ, ‘‘mūlapariyāyanti vā mūladesanaṃ kāraṇatathana’’nti pariyāyavacanaṃ, ‘‘vo tumhākaṃ tumha’’nti pariyāyavacanaṃ, ‘‘bhikkhave, samaṇā tapassino’’ti pariyāyavacanaṃ, ‘‘desessāmī kathessāmī paññapessāmī’’ti pariyāyavacanaṃ, ‘‘suṇātha sotaṃ odahatha sotadvārānusārena upadhārethā’’ti pariyāyavacanaṃ, ‘‘sādhukaṃ sammā sakkacca’’nti pariyāyavacanaṃ, ‘‘manasi karotha citte ṭhapetha samannāharathā’’ti pariyāyavacanaṃ, ‘‘bhāsissāmi byattaṃ kathessāmi vibhajissāmī’’ti pariyāyavacanaṃ, ‘‘evaṃ, bhante, sādhu suṭṭhu bhante’’ti pariyāyavacanaṃ, ‘‘paccassosuṃ sampaṭicchiṃsu sampaṭiggahesu’’nti pariyāyavacanaṃ.

‘‘Sabbadhammā’’ (all phenomena) is a synonymous term for ‘‘sakaladhammā’’ (all phenomena, entire phenomena) and ‘‘anavasesadhammā’’ (phenomena without remainder); ‘‘mūlapariyāyaṃ’’ (the root reason) is a synonymous term for ‘‘mūlakāraṇaṃ’’ (the fundamental cause) and ‘‘asādhāraṇahetu’’ (the non-common cause); or ‘‘mūlapariyāyanti’’ (root-exposition) is a synonymous term for ‘‘mūladesanaṃ’’ (root-teaching) and ‘‘kāraṇatathanaṃ’’ (the nature of the cause); ‘‘vo’’ (to you) is a synonymous term for ‘‘tumhākaṃ’’ (to you) and ‘‘tumha’’ (your); ‘‘bhikkhave’’ (monks) is a synonymous term for ‘‘samaṇā’’ (ascetics) and ‘‘tapassino’’ (those practicing austerities); ‘‘desessāmī’’ (I will teach) is a synonymous term for ‘‘kathessāmī’’ (I will speak) and ‘‘paññapessāmī’’ (I will make known); ‘‘suṇātha’’ (listen) is a synonymous term for ‘‘sotaṃ odahatha’’ (lend ear) and ‘‘sotadvārānusārena upadhārethā’’ (consider according to the ear-door); ‘‘sādhukaṃ’’ (well) is a synonymous term for ‘‘sammā’’ (rightly) and ‘‘sakkaccaṃ’’ (respectfully); ‘‘manasi karotha’’ (pay attention) is a synonymous term for ‘‘citte ṭhapetha’’ (put in mind) and ‘‘samannāharathā’’ (direct your attention); ‘‘bhāsissāmi’’ (I will speak) is a synonymous term for ‘‘byattaṃ kathessāmi’’ (I will speak clearly) and ‘‘vibhajissāmī’’ (I will distinguish); ‘‘evaṃ, bhante, sādhu suṭṭhu bhante’’ (Yes, Venerable Sir, good, very good, Venerable Sir) is a synonymous term; ‘‘paccassosuṃ’’ (they listened) is a synonymous term for ‘‘sampaṭicchiṃsu’’ (they accepted) and ‘‘sampaṭiggahesuṃ’’ (they received).

“Sabbadhammā” (tất cả các pháp), “sakaladhammā” (toàn bộ các pháp), “anavasesadhammā” (các pháp không còn sót lại) là các từ đồng nghĩa; “mūlapariyāyaṃ” (căn bản của bài kinh), “mūlakāraṇaṃ” (nguyên nhân căn bản), “asādhāraṇahetu” (nguyên nhân không phổ biến) là các từ đồng nghĩa; hoặc “mūlapariyāyaṃ” (căn bản của bài kinh), “mūladesanaṃ” (lời dạy căn bản), “kāraṇatathanaṃ” (sự thật về nguyên nhân) là các từ đồng nghĩa; “vo” (của các bạn), “tumhākaṃ” (của các bạn), “tumha” (của bạn) là các từ đồng nghĩa; “bhikkhave” (này các Tỳ-kheo), “samaṇā” (các Sa-môn), “tapassino” (các khổ hạnh sĩ) là các từ đồng nghĩa; “desessāmī” (ta sẽ thuyết), “kathessāmī” (ta sẽ nói), “paññapessāmī” (ta sẽ trình bày) là các từ đồng nghĩa; “suṇātha” (hãy lắng nghe), “sotaṃ odahatha” (hãy chú tâm lắng nghe), “sotadvārānusārena upadhārethā” (hãy ghi nhớ theo cửa tai) là các từ đồng nghĩa; “sādhukaṃ” (khéo léo), “sammā” (đúng đắn), “sakkacca” (cẩn trọng) là các từ đồng nghĩa; “manasi karotha” (hãy chú ý), “citte ṭhapetha” (hãy ghi nhớ trong tâm), “samannāharathā” (hãy tập trung) là các từ đồng nghĩa; “bhāsissāmi” (ta sẽ nói), “byattaṃ kathessāmi” (ta sẽ nói rõ ràng), “vibhajissāmī” (ta sẽ phân tích) là các từ đồng nghĩa; “evaṃ, bhante” (vâng, bạch Thế Tôn), “sādhu” (tốt lành), “suṭṭhu bhante” (rất tốt, bạch Thế Tôn) là các từ đồng nghĩa; “paccassosuṃ” (họ đã lắng nghe), “sampaṭicchiṃsu” (họ đã chấp nhận), “sampaṭiggahesuṃ” (họ đã đón nhận) là các từ đồng nghĩa.

Iminā nayena sabbapadesu vevacanaṃ vattabbanti.

By this method, synonyms should be used in all passages.

Theo cách này, các từ đồng nghĩa nên được áp dụng cho tất cả các từ.

Ayaṃ vevacano hāro.

This is the Vevacana-hāra (Synonymy Method).

Đây là phương pháp đồng nghĩa (Vevacana-hāra).

439

11. Paññattihāravaṇṇanā

11. Description of the Paññatti-hāra

11. Giải thích phương pháp khái niệm (Paññatti-hāra)

440

‘‘Sabbadhammamūlapariyāya’’nti ettha sabbadhammā nāma sakkāyadhammā, te khandhavasena pañcadhā paññattā, āyatanavasena dvādasadhā, dhātuvasena aṭṭhārasadhā paññattā.

In ‘‘Sabbadhammamūlapariyāyaṃ’’ (The Root of All Phenomena), ‘‘all phenomena’’ refers to the phenomena of personality (sakkāya-dhamma); these are designated in five ways as aggregates, in twelve ways as sense-bases, and in eighteen ways as elements.

Trong cụm từ “sabbadhammamūlapariyāya” (Bài kinh căn bản của tất cả các pháp), “sabbadhammā” (tất cả các pháp) là các pháp thuộc về thân kiến (sakkāyadhammā), chúng được khái niệm thành năm loại theo uẩn, mười hai loại theo xứ, mười tám loại theo giới.

‘‘Mūla’’nti vā ‘‘mūlapariyāya’’nti vā maññanā vuttā, tā taṇhāmānadiṭṭhivasena tidhā antarabhedena anekadhā ca paññattā.

‘‘Mūla’’ (root) or ‘‘mūlapariyāya’’ (root-reasoning) refers to perception (maññanā), and these are designated in three ways as craving, conceit, and wrong views, and in countless ways through their internal distinctions.

Hoặc “mūla” (căn bản) hoặc “mūlapariyāya” (căn bản của bài kinh) được nói đến là sự nhận thức sai lầm (maññanā), chúng được khái niệm thành ba loại theo tham ái, kiêu mạn, tà kiến, và nhiều loại theo các phân loại bên trong.

Atha vā ‘‘sabbadhammā’’ti tebhūmakadhammānaṃ saṅgahapaññatti, ‘‘mūlapariyāya’’nti tesaṃ pabhavapaññatti, ‘‘vo’’ti sampadānapaññati, ‘‘desessāmi bhāsissāmī’’ti paṭiññāpaññatti, ‘‘suṇātha sādhukaṃ manasi karothā’’ti ca āṇāpanapaññatti, ‘‘assutavā’’ti paṭivedhavimukhatāpaññatti ceva pariyattivimukhatāpaññatti ca, ‘‘puthujjano’’ti anariyapaññatti, sā ariyadhammapaṭikkhepapaññatti ceva ariyadhammavirahapaññatti ca, ‘‘ariyāna’’nti asamapaññatti ceva samapaññatti ca.

Alternatively, ‘‘sabbadhammā’’ (all phenomena) is a designation of comprehension for phenomena of the three planes; ‘‘mūlapariyāya’’ (root-reasoning) is a designation of their origin; ‘‘vo’’ (to you) is a designation of the recipient; ‘‘desessāmi bhāsissāmī’’ (I will teach, I will speak) is a designation of declaration; ‘‘suṇātha sādhukaṃ manasi karothā’’ (listen well, pay attention) is a designation of command; ‘‘assutavā’’ (uninstructed) is a designation of non-penetration and also a designation of non-study; ‘‘puthujjano’’ (ordinary person) is a designation of non-noble, which is both a designation of rejection of noble Dhamma and a designation of absence of noble Dhamma; ‘‘ariyānaṃ’’ (of the noble ones) is both a designation of non-equality and a designation of equality.

Hoặc “sabbadhammā” là khái niệm tập hợp của các pháp thuộc ba cõi; “mūlapariyāya” là khái niệm nguồn gốc của chúng; “vo” là khái niệm sở hữu cách; “desessāmi” (ta sẽ thuyết), “bhāsissāmi” (ta sẽ nói) là khái niệm hứa hẹn; “suṇātha” (hãy lắng nghe), “sādhukaṃ manasi karothā” (hãy chú ý kỹ) là khái niệm mệnh lệnh; “assutavā” (vô văn) là khái niệm không thấu triệt và khái niệm không học hỏi; “puthujjano” (phàm phu) là khái niệm không phải bậc Thánh, đó là khái niệm phủ nhận Thánh Pháp và khái niệm thiếu vắng Thánh Pháp; “ariyānaṃ” (của các bậc Thánh) là khái niệm không tương đồng và khái niệm tương đồng.

Tattha asamapaññatti tathāgatapaññatti, samapaññatti paccekabuddhānañceva ubhatobhāgavimuttādīnañca vasena aṭṭhavidhā veditabbā.

Among these, the designation of non-equality is the designation of the Tathāgata; the designation of equality should be understood as eightfold by way of Paccekabuddhas and those liberated in both ways, and so on.

Trong đó, khái niệm không tương đồng là khái niệm của Đức Như Lai, khái niệm tương đồng nên được hiểu là có tám loại dựa trên các vị Phật Độc Giác (paccekabuddha) và các vị giải thoát cả hai phần (ubhatobhāgavimutta), v.v.

‘‘Ariyānaṃ adassāvī’’tiādi dassanabhāvanāpaṭikkhepapaññatti, ‘‘pathaviṃ maññatī’’tiādi pañcannaṃ upādānakkhandhānaṃ dvādasannaṃ āyatanānaṃ aṭṭhārasannaṃ dhātūnaṃ sammasanupagānaṃ indriyānaṃ nikkhepapaññatti ceva pabhavapaññatti ca, tathā vipallāsānaṃ kiccapaññatti pariyuṭṭhānaṃ dassanapaññatti kilesānaṃ phalapaññatti abhisaṅkhārānaṃ virūhanapaññatti taṇhāya assādanapaññatti diṭṭhiyā vipphandanapaññatti, ‘‘sekkhā’’ti saddhānusārīsaddhāvimuttadiṭṭhippattakāyasakkhīnaṃ dassanapaññatti ceva bhāvanāpaññatti ca ‘‘appattamānaso’’ti sekkhadhammānaṃ ṭhitipaññatti, ‘‘anuttaraṃ yogakkhemaṃ patthayamāno’’ti paññāya abhinibbidāpaññatti, ‘‘abhijānātī’’ti abhiññeyyadhammānaṃ abhiññāpaññatti, dukkhassa pariññāpaññatti, samudayassa pahānapaññatti, nirodhassa sacchikiriyāpaññatti, maggassa bhāvanāpaññatti, ‘‘mā maññī’’ti maññanānaṃ paṭikkhepapaññatti, samudayassa pahānapaññatti.

The phrase ‘‘Ariyānaṃ adassāvī’’ (not having seen the noble ones), and so on, is a designation for the rejection of perception and development. The phrase ‘‘pathaviṃ maññati’’ (perceives earth), and so on, is a designation for the arrangement and arising of the five upādānakkhandhā (clinging-aggregates), the twelve āyatanā (sense bases), the eighteen dhātus (elements), and the indriyas (faculties) that are suitable for contemplation. Likewise, it is a designation for the function of perversions, a designation for the manifestation of defilements, a designation for the result of volitional formations, a designation for the growth of craving, a designation for the agitation of views. The word ‘‘sekkhā’’ (trainees) is a designation for the perception and development of faith-followers, faith-liberated ones, those attained-to-view, and bodily-witnesses. The phrase ‘‘appattamānaso’’ (with unreached mind) is a designation for the standing of the qualities of a trainee. The phrase ‘‘anuttaraṃ yogakkhemaṃ patthayamāno’’ (aspiring for the unsurpassed security from bondage) is a designation for the disenchantment of wisdom. The word ‘‘abhijānāti’’ (understands profoundly) is a designation for the profound knowledge of things to be profoundly known, a designation for the full understanding of suffering, a designation for the abandonment of the origin, a designation for the realization of cessation, a designation for the development of the path. The phrase ‘‘mā maññī’’ (do not perceive) is a designation for the rejection of perceptions, a designation for the abandonment of the origin.

Sự chế định về việc bác bỏ sự thấy và sự tu tập là “không thấy bậc Thánh” và vân vân. Sự chế định về sự đặt để và sự chế định về sự phát sinh của năm uẩn chấp thủ, mười hai xứ, mười tám giới, các căn có thể quán xét là “cho rằng đất” và vân vân. Cũng vậy, sự chế định về chức năng của các sự điên đảo, sự chế định về sự thấy của các triền cái (pariyuṭṭhāna), sự chế định về quả của các phiền não, sự chế định về sự tăng trưởng của các hành (abhisaṅkhāra), sự chế định về sự hưởng thụ của ái, sự chế định về sự dao động của tà kiến. Sự chế định về sự thấy và sự tu tập của những người tùy tín, tín giải thoát, đạt kiến, thân chứng là “Bậc Hữu học” (sekkhā). Sự chế định về sự an trú của các pháp hữu học là “tâm chưa đạt đến” (appattamānaso). Sự chế định về sự nhàm chán bằng tuệ là “mong cầu sự an ổn vô thượng khỏi các ách” (anuttaraṃ yogakkhemaṃ patthayamāno). Sự chế định về thắng tri của các pháp cần thắng tri là “thắng tri” (abhijānāti). Sự chế định về sự liễu tri khổ, sự chế định về sự đoạn trừ tập khởi, sự chế định về sự chứng ngộ diệt, sự chế định về sự tu tập đạo. Sự chế định về sự bác bỏ các sự cho rằng là “chớ cho rằng” (mā maññī). Sự chế định về sự đoạn trừ tập khởi.

Iminā nayena sesapadesupi vitthāretabbaṃ.

In this way, it should be elaborated in the remaining passages.

Theo cách này, cần phải mở rộng ở các phần còn lại.

Ayaṃ paññatti hāro.

This is the Paññatti Hāra (Designation Method).

Đây là phương pháp chế định (paññatti hāra).

441

12. Otaraṇahāravaṇṇanā

12. Explanation of the Otaraṇa Hāra

12. Giải thích phương pháp đi vào (Otaraṇahāravaṇṇanā)

442

‘‘Sabbadhammamūlapariyāya’’nti ettha sabbadhammā nāma lokiyā pañcakkhandhā dvādasāyatanāni aṭṭhārasa dhātuyo dve saccāni ekūnavisati indriyāni dvādasapadiko paccayākāroti, ayaṃ sabbadhammaggahaṇena khandhādimukhena desanāya otaraṇaṃ.

Here, in ‘‘Sabbadhammamūlapariyāyaṃ’’ (the Root Discourse of All Phenomena), ‘all phenomena’ means the mundane five aggregates, the twelve sense bases, the eighteen elements, the two truths, the nineteen faculties, and the twelve-linked dependent origination. This is the descent into the teaching by way of the aggregates and so forth, through the apprehension of all phenomena.

Trong câu “Sabbadhammamūlapariyāyaṃ” (Bài kinh căn bản của tất cả các pháp) ở đây, tất cả các pháp (sabbadhammā) là năm uẩn thế gian, mười hai xứ, mười tám giới, hai chân đế, mười chín căn, mười hai chi duyên khởi. Đây là sự đi vào bài giảng bằng cách nắm bắt tất cả các pháp thông qua các uẩn và vân vân.

‘‘Mūla’’nti vā ‘‘mūlapariyāya’’nti vā maññanā vuttā, tā atthato taṇhā māno diṭṭhi cāti tesaṃ saṅkhārakkhandhasaṅgahoti ayaṃ khandhamukhena otaraṇaṃ.

‘Mūla’ (root) or ‘mūlapariyāya’ (root discourse) refers to perceptions which, in essence, are craving, conceit, and views; these are encompassed by the aggregate of volitional formations. This is the descent by way of the aggregates.

Hoặc “mūla” (căn bản) hoặc “mūlapariyāya” (bài kinh căn bản) đã được nói đến là sự cho rằng (maññanā), về nghĩa đó là ái, mạn, kiến; đó là sự thâu tóm vào hành uẩn. Đây là sự đi vào thông qua uẩn.

Tathā ‘‘dhammāyatanadhammadhātūhi saṅgaho’’ti ayaṃ āyatanamukhena dhātumukhena ca otaraṇaṃ.

Likewise, ‘‘dhammāyatanadhammadhātūhi saṅgaho’’ (encompassed by the mind-object sense base and mind-object element) is the descent by way of the sense bases and elements.

Cũng vậy, “sự thâu tóm bởi pháp xứ và pháp giới” (dhammāyatanadhammadhātūhi saṅgaho) là sự đi vào thông qua xứ và thông qua giới.

‘‘Assutavā’’ti iminā sutassa vibandhabhūtā avijjādayo gahitā, ‘‘puthujjano’’ti iminā yesaṃ kilesābhisaṅkhārānaṃ jananādinā puthujjanoti vuccati, te kilesābhisaṅkhārādayo gahitā, ‘‘ariyānaṃ adassāvī’’tiādinā yesaṃ kilesadhammānaṃ vasena ariyānaṃ adassāviādibhāvo hoti, te diṭṭhimānāvijjādayo gahitāti sabbehi tehi saṅkhārakkhandhasaṅgahoti pubbe vuttanayeneva otaraṇaṃ veditabbaṃ.

By ‘‘Assutavā’’ (uninstructed), ignorance and other impediments to hearing are taken. By ‘‘puthujjano’’ (ordinary person), the defilements and volitional formations and so forth, due to whose generation one is called an ordinary person, are taken. By ‘‘ariyānaṃ adassāvī’’ (not having seen the noble ones), and so on, views, conceit, ignorance, and so forth, due to which one is in the state of not having seen the noble ones and so forth, are taken. Thus, it should be understood that all these are encompassed by the aggregate of volitional formations, and the descent is in the manner explained previously.

Bằng câu “Assutavā” (kẻ phàm phu không nghe), vô minh và vân vân, là những thứ trói buộc sự nghe, đã được nắm bắt. Bằng câu “puthujjano” (kẻ phàm phu), các phiền não và hành và vân vân, mà do sự sinh khởi của chúng mà được gọi là kẻ phàm phu, đã được nắm bắt. Bằng câu “Ariyānaṃ adassāvī” (không thấy bậc Thánh) và vân vân, các pháp phiền não mà do chúng mà có trạng thái không thấy bậc Thánh và vân vân, tức là tà kiến, mạn, vô minh và vân vân, đã được nắm bắt. Như vậy, cần phải hiểu rằng sự đi vào thông qua tất cả những điều đó là sự thâu tóm vào hành uẩn, theo cách đã nói trước đây.

‘‘Sañjānāti maññati abhijānāti na maññatī’’ti etthāpi sañjānanamaññanāabhijānanānupassanānaṃ saṅkhārakkhandhapariyāpannattā vuttanayeneva otaraṇaṃ veditabbaṃ.

Here too, in ‘‘sañjānāti maññati abhijānāti na maññatī’’ (perceives, conceives, profoundly understands, does not conceive), since perception, conception, profound understanding, and contemplation are included in the aggregate of volitional formations, the descent should be understood in the manner explained.

Trong câu “Sañjānāti maññati abhijānāti na maññatī” (nhận biết, cho rằng, thắng tri, không cho rằng) ở đây, cũng cần phải hiểu rằng sự đi vào theo cách đã nói, vì sự nhận biết, sự cho rằng, sự thắng tri, sự quán xét là những gì thuộc về hành uẩn.

Tathā sekkhaggahaṇena sekkhā, ‘‘araha’’ntiādinā asekkhā sīlakkhandhādayo gahitāti evampi khandhamukhena otaraṇaṃ, āyatanadhātādimukhena ca otaraṇaṃ veditabbaṃ.

Similarly, by the apprehension of ‘trainees’, the trainees are taken. By ‘‘araha’’ (worthy one), and so on, the non-trainees and the aggregates of virtue and so forth are taken. In this way, the descent by way of the aggregates should be understood, and also the descent by way of the sense bases, elements, and so forth.

Cũng vậy, bằng cách nắm bắt các bậc Hữu học (sekkhaggahaṇena), các bậc Hữu học; bằng cách nắm bắt “Arahanta” (bậc Vô học) và vân vân, các bậc Vô học, các giới đức và vân vân, đã được nắm bắt. Như vậy, cũng cần phải hiểu sự đi vào thông qua uẩn, và sự đi vào thông qua xứ, giới và vân vân.

Tathā ‘‘na maññatī’’ti taṇhāgāhādipaṭikkhepena dukkhānupassanādayo gahitā, tesaṃ vasena appaṇihitavimokkhamukhādīhi otaraṇaṃ veditabbaṃ.

Similarly, by ‘‘na maññatī’’ (does not conceive), the contemplation of suffering and so forth, through the rejection of the grasp of craving and so forth, are taken. By way of these, the descent through the signless liberation and so forth should be understood.

Cũng vậy, bằng câu “na maññatī” (không cho rằng), sự quán xét khổ và vân vân, đã được nắm bắt bằng cách bác bỏ sự chấp thủ ái và vân vân. Cần phải hiểu sự đi vào thông qua chúng bằng các cửa giải thoát vô nguyện và vân vân.

‘‘Pariññāta’’nti iminā parijānanakiccena pavattamānā bodhipakkhiyadhammā gayhantīti satipaṭṭhānādimukhena otaraṇaṃ veditabbaṃ.

By ‘‘Pariññātaṃ’’ (fully understood), the factors of awakening that arise through the act of fully understanding are taken. Thus, the descent by way of the foundations of mindfulness and so forth should be understood.

Bằng câu “Pariññātaṃ” (đã liễu tri) ở đây, các pháp giác chi đang vận hành trong hành động liễu tri đã được nắm giữ. Cần phải hiểu sự đi vào thông qua các niệm xứ và vân vân.

Nandiggahaṇena bhavaggahaṇena taṇhāgahaṇena ca samudayasaccaṃ, dukkhaggahaṇena jātijarāmaraṇaggahaṇena ca dukkhasaccaṃ, ‘‘taṇhānaṃ khayā’’tiādinā nirodhasaccaṃ, abhisambodhiyā gahaṇena maggasaccaṃ gahitanti ariyasaccehi otaraṇanti.

By the apprehension of delight, the apprehension of becoming, and the apprehension of craving, the truth of origin is taken. By the apprehension of suffering and the apprehension of birth, aging, and death, the truth of suffering is taken. By ‘‘taṇhānaṃ khayā’’ (through the destruction of craving), and so on, the truth of cessation is taken. By the apprehension of supreme awakening, the truth of the path is taken. This is the descent through the Noble Truths.

Bằng cách nắm bắt sự hoan hỷ (nandiggahaṇena), sự hữu (bhavaggahaṇena), sự ái (taṇhāgahaṇena) là Khổ tập đế. Bằng cách nắm bắt khổ (dukkhaggahaṇena), sự sinh, già, chết (jātijarāmaraṇaggahaṇena) là Khổ đế. Bằng câu “taṇhānaṃ khayā” (do sự diệt tận của ái) và vân vân là Khổ diệt đế. Bằng cách nắm bắt sự giác ngộ (abhisambodhiyā gahaṇena) là Khổ đạo đế. Như vậy, sự đi vào thông qua các Thánh đế.

Ayaṃ otaraṇo hāro.

This is the Otaraṇa Hāra (Descent Method).

Đây là phương pháp đi vào (otaraṇo hāro).

443

13. Sodhanahāravaṇṇanā

13. Explanation of the Sodhana Hāra

13. Giải thích phương pháp thanh lọc (Sodhanahāravaṇṇanā)

444

‘‘Sabbadhammamūlapariyāyaṃ vo, bhikkhave…pe… idha, bhikkhave, assutavā…pe… pathaviṃ pathavito sañjānātī’’ti ārambho.

The beginning is ‘‘Sabbadhammamūlapariyāyaṃ vo, bhikkhave…pe… idha, bhikkhave, assutavā…pe… pathaviṃ pathavito sañjānātī’’ (Monks, the Root Discourse of All Phenomena…in this teaching, monks, an uninstructed…perceives earth as earth).

“Này các Tỳ khưu, bài kinh căn bản của tất cả các pháp… này các Tỳ khưu, ở đây, kẻ phàm phu không nghe… nhận biết đất là đất” là sự khởi đầu.

‘‘Pathaviṃ pathaviyā saññatvā pathaviṃ maññatī’’ti padasuddhi, no ārambhasuddhi.

‘‘Pathaviṃ pathaviyā saññatvā pathaviṃ maññatī’’ (having perceived earth from earth, he conceives earth) is purity of expression, not purity of beginning.

“Sau khi nhận biết đất là đất, cho rằng đất” là sự thanh lọc từ ngữ, không phải sự thanh lọc khởi đầu.

Tathā ‘‘pathaviyā maññati pathavito maññati pathaviṃ meti maññati pathaviṃ abhinandatī’’ti padasuddhi, no ārambhasuddhi.

Similarly, ‘‘pathaviyā maññati pathavito maññati pathaviṃ meti maññati pathaviṃ abhinandatī’’ (he conceives by earth, he conceives from earth, he conceives 'earth is mine', he delights in earth) is purity of expression, not purity of beginning.

Cũng vậy, “cho rằng từ đất, cho rằng bởi đất, cho rằng đất là của tôi, cho rằng hoan hỷ đất” là sự thanh lọc từ ngữ, không phải sự thanh lọc khởi đầu.

‘‘Taṃ kissa hetu apariññātaṃ tassāti vadāmī’’ti padasuddhi ceva ārambhasuddhi ca.

‘‘Taṃ kissa hetu apariññātaṃ tassāti vadāmī’’ (For what reason? Because it is not fully understood by him, so I say) is both purity of expression and purity of beginning.

“Vì sao vậy? Chúng tôi nói rằng điều đó chưa được liễu tri đối với người ấy” là sự thanh lọc từ ngữ và cả sự thanh lọc khởi đầu.

Sesavāresupi eseva nayoti.

The same method applies to the remaining turns.

Ở các lần khác cũng theo cách này.

Ayaṃ sodhano hāro.

This is the Sodhana Hāra (Purification Method).

Đây là phương pháp thanh lọc (sodhano hāro).

445

14. Adhiṭṭhānahāravaṇṇanā

14. Explanation of the Adhiṭṭhāna Hāra

14. Giải thích phương pháp quy định (Adhiṭṭhānahāravaṇṇanā)

446

‘‘Sabbadhammamūlapariyāya’’nti ettha sabbadhammaggahaṇaṃ sāmaññato adhiṭṭhānaṃ.

In ‘‘Sabbadhammamūlapariyāyaṃ’’ (the Root Discourse of All Phenomena), the apprehension of ‘all phenomena’ is a general determination.

Trong câu “Sabbadhammamūlapariyāyaṃ” ở đây, sự nắm bắt tất cả các pháp là sự quy định chung.

‘‘Pathaviṃ āpa’’ntiādi pana taṃ avikappetvā visesavacanaṃ.

‘‘Pathaviṃ āpa’’ (earth, water), and so on, are specific statements that do not differentiate that.

Tuy nhiên, “đất, nước” và vân vân, là lời nói đặc biệt mà không phân biệt điều đó.

Tathā ‘‘mūlapariyāya’’nti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘pathaviṃ maññati…pe… abhinandatī’’ti.

Similarly, ‘‘mūlapariyāya’’ (root discourse) is a general determination. The specific statements that do not differentiate that are ‘‘pathaviṃ maññati…pe… abhinandatī’’ (he perceives earth…delights in it).

Cũng vậy, “mūlapariyāya” (bài kinh căn bản) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “cho rằng đất… hoan hỷ” và vân vân.

‘‘Pathaviṃ maññatī’’ti ca sāmaññato adhiṭṭhānaṃ taṇhādiggāhānaṃ sādhāraṇattā maññanāya, taṃ avikappetvā visesavacanaṃ ‘‘etaṃ mama, esohamasmi, eso me attā’’ti, evaṃ suttantarapadānipi ānetvā visesavacanaṃ niddhāretabbaṃ.

And ‘‘pathaviṃ maññatī’’ (he conceives earth) is a general determination due to the commonality of perception for the grasps of craving and so on. The specific statements that do not differentiate that are ‘‘etaṃ mama, esohamasmi, eso me attā’’ (this is mine, this I am, this is my self). In this way, bringing in words from other suttas, specific statements should be determined.

Và “cho rằng đất” là sự quy định chung vì sự cho rằng là chung cho sự chấp thủ ái và vân vân. Lời nói đặc biệt mà không phân biệt điều đó là “cái này là của tôi, tôi là cái này, cái này là tự ngã của tôi”. Như vậy, cần phải xác định lời nói đặc biệt bằng cách đưa vào các từ trong kinh điển.

Sesavāresupi eseva nayo.

The same method applies to the remaining turns.

Ở các lần khác cũng theo cách này.

‘‘Sekkho’’ti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘kāyasakkhī diṭṭhippatto saddhāvimutto saddhānusārī dhammānusārī’’ti.

‘‘Sekkho’’ (trainee) is a general determination. The specific statements that do not differentiate that are ‘‘kāyasakkhī diṭṭhippatto saddhāvimutto saddhānusārī dhammānusārī’’ (a bodily-witness, one attained-to-view, one faith-liberated, a faith-follower, a Dhamma-follower).

“Sekkhā” (bậc Hữu học) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “thân chứng, đạt kiến, tín giải thoát, tùy tín, tùy pháp” (kāyasakkhī diṭṭhippatto saddhāvimutto saddhānusārī dhammānusārī).

Tathā ‘‘sekkho’’ti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘idha, bhikkhave, bhikkhu sekkhāya sammādiṭṭhiyā samannāgato hoti…pe… sekkhena sammāsamādhinā samannāgato hotī’’ti (saṃ. ni. 5.13).

Similarly, ‘‘sekkho’’ (trainee) is a general determination. The specific statements that do not differentiate that are ‘‘idha, bhikkhave, bhikkhu sekkhāya sammādiṭṭhiyā samannāgato hoti…pe… sekkhena sammāsamādhinā samannāgato hotī’’ (Here, monks, a monk is endowed with a trainee’s right view…endowed with a trainee’s right concentration).

Cũng vậy, “sekkhā” (bậc Hữu học) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “Này các Tỳ khưu, ở đây, Tỳ khưu thành tựu với chánh kiến hữu học… thành tựu với chánh định hữu học” (Saṃ. Ni. 5.13).

‘‘Araha’’nti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘ubhatobhāgavimutto paññāvimutto (pu. pa. 13.2; 15.1 mātikā), tevijjo chaḷabhiñño’’ti (pu. pa. 7.26, 27 mātikā) ca.

‘‘Araha’’ (worthy one) is a general determination. The specific statements that do not differentiate that are ‘‘ubhatobhāgavimutto paññāvimutto, tevijjo chaḷabhiñño’’ (one liberated in both ways, one liberated by wisdom, one with the three knowledges, one with the six super-knowledges).

“Araha” (bậc Vô học) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “giải thoát cả hai phần, giải thoát bằng tuệ (Pu. Pa. 13.2; 15.1 Mātikā), tam minh, lục thông” (Pu. Pa. 7.26, 27 Mātikā).

‘‘Khīṇāsavo’’ti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘kāmāsavāpi cittaṃ vimuccittha, bhavāsavāpi cittaṃ vimuccitthā’’tiādi (pārā. 14).

‘‘Khīṇāsavo’’ (one whose taints are destroyed) is a general determination. The specific statements that do not differentiate that are ‘‘kāmāsavāpi cittaṃ vimuccittha, bhavāsavāpi cittaṃ vimuccitthā’’ (the mind was liberated from the taint of sensual desire, the mind was liberated from the taint of becoming), and so on.

“Khīṇāsavo” (bậc lậu tận) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “tâm giải thoát khỏi lậu hoặc dục, tâm giải thoát khỏi lậu hoặc hữu” và vân vân (Pārā. 14).

Sesapadesupi eseva nayo.

The same method applies to the remaining passages.

Ở các phần còn lại cũng theo cách này.

‘‘Abhijānātī’’ti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘maññatī’’ti.

‘‘Abhijānātī’’ (he profoundly understands) is a general determination. The specific statement that does not differentiate that is ‘‘maññatī’’ (he conceives).

“Abhijānāti” (thắng tri) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “maññati” (cho rằng).

Maññanābhāvo hissa pahānapaṭivedhasiddho, pahānapaṭivedho ca pariññāsacchikiriyābhāvanāpaṭivedhehi na vināti sabbepi abhiññāvisesā maññanāpaṭikkhepena atthato gahitāva hontīti.

For him, the absence of conceiving is achieved through abandonment and penetration. And abandonment and penetration are not possible without full understanding, realization, and development-penetration. Thus, all specific profound knowledges are essentially taken by the rejection of conceiving.

Vì sự không cho rằng của người ấy được thành tựu bằng sự đoạn trừ và sự chứng đắc, và sự chứng đắc bằng sự đoạn trừ không thể có nếu không có sự chứng đắc bằng sự liễu tri, sự chứng ngộ, sự tu tập. Do đó, tất cả các thắng tri đặc biệt đều được nắm bắt về nghĩa bằng sự bác bỏ sự cho rằng.

Tathā ‘‘araha’’nti sāmaññato adhiṭṭhānaṃ, taṃ avikappetvā visesavacanaṃ ‘‘vītarāgattā vītadosattā vītamohattā’’ti.

Similarly, ‘‘araha’’ (worthy one) is a general determination. The specific statements that do not differentiate that are ‘‘vītarāgattā vītadosattā vītamohattā’’ (because of being free from lust, free from hatred, free from delusion).

Cũng vậy, “Araha” (bậc Vô học) là sự quy định chung, lời nói đặc biệt mà không phân biệt điều đó là “do đã ly tham, do đã ly sân, do đã ly si” (vītarāgattā vītadosattā vītamohattā).

Iminā nayena sesapadesupi sāmaññavisesaniddhāraṇā veditabbā.

In this way, the determination of the general and specific should be understood in the remaining passages.

Theo cách này, cần phải biết sự xác định chung và đặc biệt ở các phần còn lại.

Ayaṃ adhiṭṭhāno hāro.

This is the Adhiṭṭhāna Hāra (Determination Method).

Đây là phương pháp quy định (adhiṭṭhāno hāro).

447

14. Parikkhārahāravaṇṇanā

14. Explanation of the Parikkhāra Hāra

14. Giải thích phương pháp tùy tùng (Parikkhārahāravaṇṇanā)

448

‘‘Sabbadhammamūlapariyāya’’nti ettha sabbadhammā nāma pariyāpannadhammā, te kusalākusalābyākatabhedena tividhā.

In ‘‘Sabbadhammamūlapariyāyaṃ’’ (the Root Discourse of All Phenomena), ‘all phenomena’ means included phenomena, which are threefold by way of wholesome, unwholesome, and indeterminate.

Trong câu “Sabbadhammamūlapariyāyaṃ” ở đây, tất cả các pháp (sabbadhammā) là các pháp thuộc phạm vi, chúng có ba loại theo phân loại thiện, bất thiện, vô ký.

Tesu kusalānaṃ yonisomanasikāro alobhādayo ca hetū, akusalānaṃ ayonisomanasikāro lobhādayo ca hetū, abyākatesu vipākānaṃ yathāsakaṃ kammaṃ, itaresaṃ bhavaṅgamāvajjanasamannāhārādi ca hetū.

Among these, for wholesome actions, proper attention (yonisomanasikāra) and roots such as non-greed (alobha) are the causes; for unwholesome actions, improper attention (ayonisomanasikāra) and roots such as greed (lobha) are the causes; for resultant abyākata, their respective kamma; and for other abyākata, bhavaṅga, āvajjanā, samanāhāra, etc., are the causes.

Trong số đó, đối với các pháp thiện (kusala), tác ý đúng đắn (yonisomanasikāra) và các căn lành như vô tham (alobha) là nhân (hetū). Đối với các pháp bất thiện (akusala), tác ý không đúng đắn (ayonisomanasikāra) và các căn bất thiện như tham (lobha) là nhân. Đối với các pháp vô ký (abyākata) là quả dị thục (vipāka), nghiệp (kamma) tương ứng của chúng là nhân. Đối với các pháp vô ký khác, bhavaṅga (hữu phần), āvajjana (khai môn), samannāhāra (sự tập trung), v.v., là nhân.

Ettha ca sappurisūpanissayādiko paccayo hetumhi eva samavaruḷho, so tattha ādi-saddena saṅgahitoti daṭṭhabbo.

Here, a condition like the support of good people (sappurisūpanissaya) is included within the cause itself, and it should be understood as encompassed by the "etc." (ādi) word there.

Và ở đây, duyên (paccaya) như nương tựa bậc thiện trí (sappurisūpanissaya), v.v., đã được bao gồm trong nhân (hetu) rồi. Nên hiểu rằng điều đó được hàm ý bởi từ “v.v.” (ādi-saddena) ở đó.

‘‘Mūla’’nti vuttānaṃ maññanānaṃ hetubhāvo pāḷiyaṃ vutto eva.

The state of being a cause for the perceptions (maññanā) referred to as "root" is indeed stated in the Pāli text.

Nhân của các tưởng (maññanā) được gọi là “gốc rễ” (mūla) đã được đề cập trong kinh điển.

Maññanāsu pana taṇhāmaññanāya assādānupassanā hetu.

Moreover, among the perceptions (maññanā), the perception of craving (taṇhāmaññanā) has the contemplation of gratification (assādānupassanā) as its cause.

Trong các tưởng, sự quán sát vị ngọt (assādānupassanā) là nhân của tưởng ái (taṇhāmaññanā).

‘‘Saññojaniyesu dhammesu assādānupassino taṇhā pavaḍḍhatī’’ti (saṃ. ni. 2.52) hi vuttaṃ.

For it is said: "When one contemplates gratification in things that lead to fetters (saññojaniya dhamma), craving (taṇhā) grows."

Quả thật, đã nói rằng: “Với người quán sát vị ngọt trong các pháp thuộc phiền não (saññojaniya), ái (taṇhā) tăng trưởng”.

Mānamaññanāya diṭṭhivippayuttalobho hetu kevalaṃ saṃsaggavasena ‘‘ahamasmī’’ti pavattanato.

For the perception of conceit (mānamaññanā), greed disconnected from wrong view (diṭṭhivippayuttalobha) is the cause, due to its occurrence merely by way of association as "I am."

Đối với tưởng mạn (mānamaññanā), tham (lobha) không liên hệ với tà kiến (diṭṭhivippayutta) là nhân, chỉ vì nó diễn tiến theo cách “tôi là” (ahamasmīti) do sự liên kết.

Diṭṭhimaññanāya ekattanayādīnaṃ ayāthāvaggāho hetu, assutabhāvo puthujjanabhāvassa hetu, so ariyānaṃ adassanasīlatāya, sā ariyadhammassa akovidatāya, sā ariyadhamme avinītatāya hetu, sabbā cāyaṃ hetuparamparā pathavīādīsu ‘‘etaṃ mama, esohamasmi, eso me attā’’ti tissannaṃ maññanānaṃ hetu, sekkhārahādibhāvā pana mattaso sabbaso ca maññanābhāvassa hetūti.

For the perception of wrong view (diṭṭhimaññanā), the incorrect apprehension of oneness (ekattanaya) and so forth is the cause; the state of being uninstructed is the cause of being an ordinary person (puthujjana); that is due to the characteristic of not seeing the Noble Ones (ariyā); that is due to being unskilled in the Noble Dhamma; that is due to being undisciplined in the Noble Dhamma. And this entire causal sequence is the cause for the three perceptions, "This is mine, this I am, this is my self," concerning earth and so forth. However, the states of being a trainee (sekha) or an Arahant (arahant) are the causes for the absence of perception partially or completely.

Đối với tưởng kiến (diṭṭhimaññanā), sự chấp thủ không đúng đắn về tính nhất thể (ekattanayādīnaṃ ayāthāvaggāho), v.v., là nhân; trạng thái chưa từng nghe (assutabhāva) là nhân của trạng thái phàm phu (puthujjanabhāva); điều đó là nhân của việc không thấy các bậc Thánh (ariyānaṃ adassanasīlatāya); điều đó là nhân của việc không thông thạo Thánh pháp (ariyadhammassa akovidatāya); điều đó là nhân của việc không được huấn luyện trong Thánh pháp (ariyadhamme avinītatāya); và toàn bộ chuỗi nhân duyên này là nhân của ba loại tưởng: “cái này là của tôi, tôi là cái này, cái này là tự ngã của tôi” (etaṃ mama, esohamasmi, eso me attā) đối với đất, v.v. Còn trạng thái hữu học (sekkhā) và A-la-hán (araha), v.v., là nhân của việc không có tưởng ở mức độ nào đó và hoàn toàn không có tưởng.

Ayaṃ parikkhāro hāro.

This is the Parikkhāra Hāra.

Đây là Phân tích (Parikkhāra) Phương pháp (Hāra).

449

Table of Contents

1. Mūlapariyāyasuttavaṇṇanā

1. Commentary on the Mūlapariyāya Sutta

1. Giải thích kinh Mūlapariyāya

Abbhantaranidānavaṇṇanā

Commentary on the Internal Introduction

Giải thích Nidāna nội bộ

Suttanikkhepavaṇṇanā

Explanation of the Discourse Presentation

Giải thích Suttanikkhepa

Pathavīvāravaṇṇanā

Explanation of the Earth Chapter

Giải thích về địa giới

Āpovārādivaṇṇanā

Explanation of the Water Chapter, etc.

Giải thích về Thủy Đại, v.v.

Bhūtavārādivaṇṇanā

Exposition of the section on beings and so on

Giải thích về phần chúng sinh và các phần khác

Ākāsānañcāyatanavārādivaṇṇanā

Description of the Ākāsānañcāyatana section, etc.

Phần giải thích về Ākāsānañcāyatanavāra (Vô Biên Không Xứ) v.v.

Diṭṭhasutavārādivaṇṇanā

Description of the Diṭṭha, Suta sections, etc.

Phần giải thích về Diṭṭhasutavāra (Cái Thấy và Cái Nghe) v.v.

Ekattavārādivaṇṇanā

Commentary on the chapters on oneness, etc.

Giải thích các phương diện về nhất thể, v.v.

Sekkhavāradutiyanayavaṇṇanā

Commentary on the Second Exposition of the Learner's Section

Chú giải về Sekkhavāra, phương pháp thứ hai

Khīṇāsavavāratatiyādinayavaṇṇanā

Elucidation of the third and subsequent sections of the Arahant chapter

Giải thích phương pháp thứ ba v.v. của phần A-la-hán

Tathāgatavārasattamanayavaṇṇanā

Explanation of the Seventh Way of the Tathāgata’s Round

Giải thích về cách thức thứ bảy của phẩm Như Lai

Tathāgatavāraaṭṭhamanayavaṇṇanā

Commentary on the Eighth Mode of the Tathāgata Section

Giải thích phương pháp thứ tám của Tathāgata

Nettinayavaṇṇanā

Explanation of the Netti Method

Giải thích về phương pháp Netti

Soḷasahāravaṇṇanā

16. Exposition of the Āhāras

Giải thích Mười Sáu Hāra

1. Desanāhāravaṇṇanā

1. Exposition of Desanāhāra (Discourse Āhāra)

1. Giải thích Desanāhāra (Hāra Giáo Thuyết)

2. Vicayahāravaṇṇanā

2. Exposition of Vicayahāra (Investigation Āhāra)

2. Giải thích Vicayahāra (Hāra Phân Tích)

3. Yuttihāravaṇṇanā

3. Elucidation of the Reasoning Method

3. Giải thích Phương pháp Lý lẽ (Yuttihāravaṇṇanā)

4. Padaṭṭhānahāravaṇṇanā

4. Elucidation of the Proximate Cause Method

4. Giải thích Phương pháp Căn bản (Padaṭṭhānahāravaṇṇanā)

5. Lakkhaṇahāravaṇṇanā

5. Elucidation of the Characteristic Method

5. Giải thích Phương pháp Đặc tính (Lakkhaṇahāravaṇṇanā)

6. Catubyūhahāravaṇṇanā

6. Explanation of the Fourfold Discourse Method (Catubyūha Hāra)

6. Giải thích phương pháp bốn yếu tố (Catubyūhahāravaṇṇanā)

7. Āvattahāravaṇṇanā

7. Explanation of the Scheme of Turning

7. Giải thích phương pháp xoay chuyển

8. Vibhattihāravaṇṇanā

8. Explanation of the Scheme of Division

8. Giải thích phương pháp phân loại

9. Parivattahāravaṇṇanā

9. Description of the Parivatta-hāra

9. Giải thích phương pháp chuyển đổi (Parivatta-hāra)

10. Vevacanahāravaṇṇanā

10. Description of the Vevacana-hāra

10. Giải thích phương pháp đồng nghĩa (Vevacana-hāra)

11. Paññattihāravaṇṇanā

11. Description of the Paññatti-hāra

11. Giải thích phương pháp khái niệm (Paññatti-hāra)