Saraṇagamanassa visayappabhedaphalasaṃkilesabhedānaṃ viya, kattu ca vibhāvanā tattha kosallāya hoti yevāti saha kattunā taṃ vidhiṃ dassetuṃ ‘‘idāni tesu saraṇagamanesu kosallatthaṃ…pe… veditabbo’’ti vuttaṃ.
Just as the exposition of the divisions of object, differentiation, fruit, and defilement of taking refuge, so too is the exposition of the agent conducive to skill therein. Therefore, to show that method together with the agent, it was said: ‘‘Now, for skill in those acts of taking refuge… should be understood’’.
Để có sự khéo léo trong việc quy y Tam Bảo, việc giải thích về người thực hành cũng cần thiết, giống như việc giải thích về các loại đối tượng, sự khác biệt về quả báo và sự ô nhiễm. Do đó, đã nói “idāni tesu saraṇagamanesu kosallatthaṃ…pe… veditabbo” (bây giờ, để có sự khéo léo trong các sự quy y Tam Bảo ấy… v.v… cần phải hiểu) để chỉ ra phương pháp đó cùng với người thực hành.
‘‘Yo ca saraṇaṃ gacchatī’’ti iminā hi kattāraṃ vibhāveti tena vinā saraṇagamanasseva asambhavato, ‘‘saraṇagamana’’nti iminā ca saraṇagamanameva, ‘‘saraṇa’’ntiādīhi pana yathākkamaṃ visayādayo.
For by ‘‘He who takes refuge (Yo ca saraṇaṃ gacchati)’’ the agent is expounded, as taking refuge is impossible without him; by ‘‘taking refuge (saraṇagamana)’’ taking refuge itself; and by ‘‘refuge (saraṇa)’’ and so on, the objects and so forth, in order.
Thật vậy, bằng câu “Yo ca saraṇaṃ gacchatī” (Và ai quy y), người thực hành được giải thích, vì không có người thực hành thì sự quy y không thể xảy ra. Bằng câu “saraṇagamana” (sự quy y), chính sự quy y được giải thích. Còn bằng các từ như “saraṇa”, v.v., thì các đối tượng, v.v., được giải thích theo thứ tự.
Kasmā panettha vodānaṃ na gahitaṃ, nanu vodānavibhāvanāpi tattha kosallāya hotīti?
Why is purification not included here? Is not the exposition of purification also conducive to skill therein?
Tại sao ở đây không đề cập đến sự thanh tịnh (vodāna)? Chẳng phải việc giải thích sự thanh tịnh cũng cần thiết để có sự khéo léo trong đó sao?
Saccametaṃ, taṃ pana saṃkilesaggahaṇeneva atthato vibhāvitaṃ hotīti na gahitaṃ.
This is true, but it is implicitly expounded by the inclusion of defilement, and therefore it is not included.
Điều này đúng, nhưng sự thanh tịnh đó đã được giải thích về mặt ý nghĩa thông qua việc đề cập đến sự ô nhiễm, nên nó không được đề cập riêng.
Yāni hi nesaṃ saṃkilesakāraṇāni aññāṇādīni, tesaṃ sabbena sabbaṃ anuppannānaṃ anuppādanena, uppannānañca pahānena vodānaṃ hotīti.
For purification occurs by preventing the arising of defiling causes such as ignorance, which have not yet arisen, and by abandoning those that have arisen.
Thật vậy, những nguyên nhân gây ô nhiễm như sự vô minh, v.v., nếu chưa phát sinh thì không cho chúng phát sinh, và nếu đã phát sinh thì loại bỏ chúng, đó chính là sự thanh tịnh.
Atthatoti saraṇasaddatthato, ‘‘saraṇatthato’’tipi pāṭho, ayamevattho.
By meaning (Atthato) means by the meaning of the word 'saraṇa'. The reading 'saraṇatthatotipi' also exists, and this is the same meaning.
Atthato có nghĩa là theo ý nghĩa của từ saraṇa. Cũng có bản đọc là “saraṇatthato”, ý nghĩa vẫn như vậy.
Hiṃsatthassa sarasaddassa vasenetaṃ siddhanti dassento dhātvatthavasena ‘‘hiṃsatīti saraṇa’’nti vatvā taṃ pana hiṃsanaṃ kesaṃ, kathaṃ, kassa vāti codanaṃ sodheti ‘‘saraṇagatāna’’ntiādinā.
Showing that this (word saraṇa) is established by virtue of the word sara which has the meaning of 'harming' (hiṃsā), and having said, by virtue of the meaning of the root, that "it harms, therefore it is saraṇa", he then clarifies the questions: "Whose harming is that harming? How? And whose?" with the phrase "of those who have gone for refuge" and so on.
Để chỉ ra rằng điều này được chứng minh dựa trên ý nghĩa của động từ gốc sar (làm hại), khi nói “hiṃsatīti saraṇaṃ” (cái gì làm hại thì là saraṇa) theo ý nghĩa của động từ gốc, sau đó giải đáp câu hỏi: sự làm hại đó là của ai, như thế nào, và của cái gì, bằng cách nói “saraṇagatānaṃ”, v.v.
Kesanti hi saraṇagatānaṃ.
"Whose?" means of those who have gone for refuge.
Ở đây, kesaṃ (của ai) có nghĩa là của những người đã quy y.
Kathanti teneva saraṇagamanena.
"How?" means by that very going for refuge.
Kathaṃ (như thế nào) có nghĩa là bằng chính sự quy y đó.
Kassāti bhayādīnanti yathākkamaṃ sodhanā.
"Whose?" means of fears and so on, this is the clarification in due order.
Kassā (của cái gì) có nghĩa là của sự sợ hãi, v.v., được giải đáp theo thứ tự.
Tattha saraṇagatānanti ‘‘saraṇa’’nti gatānaṃ.
Therein, "of those who have gone for refuge" means of those who have gone, thinking "refuge".
Trong đó, saraṇagatānaṃ có nghĩa là của những người đã đi đến “nơi nương tựa”.
Saraṇagamanenāti ‘‘saraṇa’’nti gamanena kusaladhammena.
"By going for refuge" means by the wholesome Dhamma of going, thinking "refuge".
Saraṇagamanenā có nghĩa là bằng Pháp thiện (kusaladhamma), tức là bằng sự đi đến “nơi nương tựa”.
Bhayanti vaṭṭabhayaṃ.
"Fear" means the fear of saṃsāra.
Bhayaṃ có nghĩa là sự sợ hãi luân hồi (vaṭṭabhayaṃ).
Santāsanti cittutrāsaṃ teneva cetasikadukkhassa saṅgahitattā.
"Terror" means mental agitation, because mental suffering is included by that very word santāsa.
Santāsaṃ có nghĩa là sự hoảng sợ của tâm (cittutrāsaṃ), vì khổ tâm đã được bao hàm trong đó.
Dukkhanti kāyikadukkhaggahaṇaṃ.
"Suffering" means the apprehension of bodily suffering.
Dukkhaṃ là sự nắm giữ khổ thân.
Duggatiparikilesanti duggatipariyāpannaṃ sabbampi dukkhaṃ ‘‘duggatiyaṃ parikilissanaṃ saṃvibādhanaṃ, samupatāpanaṃ vā’’ti katvā, tayidaṃ sabbaṃ parato phalakathāyaṃ āvi bhavissati.
"Misery of the lower realms" means all suffering included in the lower realms, by making it "suffering, affliction, or intense torment in the lower realms"; all of this will become evident later in the discussion of results.
Duggatiparikilesaṃ có nghĩa là tất cả khổ đau thuộc về cõi ác, được xem là “sự đau khổ, sự áp bức, hoặc sự thiêu đốt trong cõi ác”, tất cả điều này sẽ được làm rõ trong phần giải thích về quả báo sau này.
Hiṃsanañcettha vināsanameva, na pana sattahiṃsanamivāti dasseti ‘‘hanati vināsetī’’ti iminā.
And here, hiṃsana means destruction itself, not harming of beings, as he shows with "it kills, it destroys".
Và ở đây, sự làm hại (hiṃsana) chỉ là sự hủy diệt, không phải là sự làm hại chúng sinh, được chỉ ra bằng câu “hanati vināsetī” (nó hủy diệt, nó phá hoại).
Etanti saraṇapadaṃ.
"This" means the word saraṇa.
Etaṃ (điều này) là từ saraṇa.
Adhivacananti nāmaṃ, pasiddhavacanaṃ vā, yathābhuccaṃ vā guṇaṃ adhikicca pavattavacanaṃ.
"Appellation" means a name, or a well-known word, or a word that functions with reference to a true quality.
Adhivacanaṃ có nghĩa là tên gọi, hoặc từ ngữ phổ biến, hoặc từ ngữ được dùng để chỉ một phẩm chất đúng như thật.
Tenāha ‘‘ratanattayassevā’’ti.
Therefore, he says "of the Triple Gem itself".
Vì vậy, đã nói “ratanattayassevā” (chỉ của Tam Bảo).
Evaṃ hiṃsanatthavasena avisesato saraṇasaddatthaṃ dassetvā idāni tadatthavaseneva visesato dassetuṃ ‘‘atha vā’’tiādi vuttaṃ.
Having thus shown the meaning of the word saraṇa in an undifferentiated way by virtue of the meaning of 'harming', now, in order to show it specifically by virtue of that very meaning, the phrase "or alternatively" and so on was stated.
Sau khi giải thích ý nghĩa của từ saraṇa một cách chung chung theo nghĩa làm hại, bây giờ để giải thích chi tiết theo ý nghĩa đó, đã nói “atha vā” (hoặc là), v.v.
Ratanattayassa paccekaṃ hiṃsanakāraṇadassanameva hi purimanayato imassa visesoti.
Indeed, the difference of this method from the previous one is simply the showing of the reason for the individual removal of fear by the Triple Gem.
Việc chỉ rõ nguyên nhân hủy diệt riêng biệt của Tam Bảo chính là điểm đặc biệt của cách giải thích này so với cách trước.
Tattha hite pavattanenāti ‘‘sampannasīlā bhikkhave viharathā’’tiādinā (ma. ni. 1.64, 69) atthe sattānaṃ niyojanena.
Here, by engaging them in what is beneficial means by enjoining beings in what is wholesome, as in “‘Bhikkhus, dwell endowed with sīla’” and so on.
Trong đó, bằng cách khuyến khích điều lợi ích có nghĩa là bằng cách khuyên nhủ chúng sinh vào điều lợi ích, như trong câu ‘Này các Tỳ-khưu, hãy sống với giới hạnh đầy đủ’ và những câu tương tự.
Ahitā ca nivattanenāti ‘‘pāṇātipātassa kho pāpako vipāko, pāpakaṃ abhisamparāya’’ntiādinā ādīnavadassanādimukhena anatthato ca sattānaṃ nivattanena.
And by turning them away from what is unwholesome means by turning beings away from what is unbeneficial, by showing the danger thereof, as in “‘Indeed, evil is the result of killing living beings, evil the destination hereafter’” and so on.
Và bằng cách ngăn chặn điều bất lợi có nghĩa là bằng cách ngăn chặn chúng sinh khỏi điều bất lợi, bằng cách chỉ ra những hiểm họa như ‘Sát sinh có quả báo xấu, có hậu quả xấu ở đời sau’ và những điều tương tự.
Bhayaṃ hiṃsatīti hitāhitesu appavattipavattihetukaṃ byasanaṃ appavattikaraṇena vināseti.
He dispels fear means by making the suffering, which is caused by not engaging in the beneficial and engaging in the unwholesome, cease to arise, thus destroying it.
Hủy diệt nỗi sợ hãi có nghĩa là hủy diệt sự khổ đau do không hành thiện và hành ác, bằng cách khiến cho chúng không xảy ra.
Bhavakantārā uttāraṇena maggasaṅkhāto dhammo, phalanibbānasaṅkhāto pana assāsadānena sattānaṃ bhayaṃ hiṃsatīti yojanā.
It should be connected as: The Dhamma, being the Path, dispels the fear of beings by making them cross over the wilderness of existence, and the Dhamma, being the Fruition and Nibbāna, dispels fear by providing relief.
Có nghĩa là, Pháp được gọi là Đạo, bằng cách đưa chúng sinh vượt qua sa mạc sinh tử, và Pháp được gọi là Quả Niết-bàn, bằng cách ban cho sự an ủi, hủy diệt nỗi sợ hãi của chúng sinh.
Kārānanti dānavasena, pūjāvasena ca upanītānaṃ sakkārānaṃ.
Kārānaṃ refers to the honors presented by way of giving and by way of veneration.
Sự tôn kính là những sự tôn kính được dâng cúng bằng cách bố thí và bằng cách cúng dường.
Anupasaggopi hi saddo saupasaggo viya atthavisesavācako ‘‘appakampi kataṃ kāraṃ, puññaṃ hoti mahapphala’’ntiādīsu viya.
Indeed, a word without a prefix, like a word with a prefix, can express a special meaning, as in “‘Even a little deed done becomes a meritorious act of great fruit’” and so on.
Thật vậy, từ ngữ không có tiền tố cũng có thể mang ý nghĩa đặc biệt như từ có tiền tố, như trong các câu ‘Dù phước nhỏ đã làm cũng có quả lớn’ và những câu tương tự.
Anuttaradakkhiṇeyyabhāvato vipulaphalapaṭilābhakaraṇena sattānaṃ bhayaṃ hiṃ satīti yojetabbaṃ.
It should be connected as: Due to being the unsurpassed field of merit (Dakkhiṇeyya), it dispels the fear of beings by causing the attainment of abundant fruit.
Nên hiểu rằng, bằng cách khiến chúng sinh đạt được quả báo to lớn do là đối tượng cúng dường vô thượng, nó hủy diệt nỗi sợ hãi của chúng sinh.
Imināpi pariyāyenāti ratanattayassa paccekaṃ hiṃsakabhāvakāraṇadassanavasena vibhajitvā vuttena imināpi kāraṇena.
By this method too means by this reason, explained by distinguishing it as the cause of the individual protecting nature of the Triple Gem.
Cũng bằng phương cách này có nghĩa là cũng bằng nguyên nhân này, được giải thích bằng cách phân tích và chỉ ra nguyên nhân của sự hủy diệt riêng biệt của Tam Bảo.
Yasmā panidaṃ saraṇapadaṃ nāthapadaṃ viya suddhanāmapadattā dhātvatthaṃ antonītaṃ katvā saṅketatthampi vadati, tasmā heṭṭhā saraṇaṃ parāyaṇanti attho vuttoti daṭṭhabbaṃ.
Since this word saraṇa, like the word nātha, being a pure noun, encompasses the meaning of the root and also expresses the conventional meaning, it should be understood that the meaning "refuge, support" was stated below.
Tuy nhiên, vì từ saraṇa này, giống như từ nātha, là một danh từ thuần túy, bao hàm ý nghĩa gốc của căn và cũng diễn đạt ý nghĩa quy ước, nên cần phải hiểu rằng ý nghĩa ‘nương tựa, nơi trú ẩn’ đã được nói ở dưới.
Evaṃ saraṇatthaṃ dassetvā idāni saraṇagamanatthaṃ dassento ‘‘tappasādā’’tiādimāha.
Having thus shown the meaning of saraṇa, now, in showing the meaning of saraṇagamana, he says “tappasādā” and so on.
Sau khi trình bày ý nghĩa của saraṇa như vậy, giờ đây, để trình bày ý nghĩa của sự quy y, Luận sư nói “tappasādā” và những câu tương tự.
Tattha ‘‘sammāsambuddho bhagavā, svākkhāto dhammo, suppaṭipanno saṅgho’’ti evamādinā tasmiṃ ratanattaye pasādo tappasādo, tadeva ratanattayaṃ garu etassāti taggaru, tassa bhāvo taggarutā, tappasādo ca taggarutā ca tappasādataggarutā, tāhi.
Therein, tappasādo is faith in that Triple Gem, as in “The Bhagavā is a Sammāsambuddha, the Dhamma is well-expounded, the Saṅgha is practicing well”; taggaru is one for whom that Triple Gem is weighty; taggarutā is the state of that; and tappasādataggarutā is by those (faith and weightiness).
Trong đó, sự thanh tịnh nơi Tam Bảo đó, như trong ‘Đức Thế Tôn là Bậc Chánh Đẳng Giác, Pháp được thuyết giảng khéo léo, Tăng chúng thực hành đúng đắn’, được gọi là tappasāda (sự thanh tịnh nơi đó). Tam Bảo đó là bậc đáng tôn kính đối với người này, nên gọi là taggaru (có sự tôn kính đó). Trạng thái của điều đó là taggarutā (sự tôn kính đó). Tappasāda và taggarutā là tappasādataggarutā (sự thanh tịnh và sự tôn kính đó), do đó.
Vihatakileso vidhutavicikicchāsammohāsaddhiyādipāpadhammattā, tadeva ratanattayaṃ parāyaṇaṃ parāgati tāṇaṃ leṇaṃ etassāti tapparāyaṇo, tassa bhāvo tapparāyaṇatā, sāyeva ākāro tapparāyaṇatākāro, tena pavatto tapparāyaṇatākārappavatto. Ettha ca pasādaggahaṇena lokiyaṃ saraṇagamanamāha.
Vihatakileso means one whose defilements are overcome, due to having dispelled evil phenomena such as doubt, delusion, and lack of faith. Tapparāyaṇo is one for whom that Triple Gem is the ultimate resort, the ultimate goal, the protection, the shelter; tapparāyaṇatā is the state of that; that same state is tapparāyaṇatākāro (the mode of having that as ultimate resort); tapparāyaṇatākārappavatto is what has arisen through that. And here, by the mention of pasāda, mundane saraṇagamana is indicated.
Vihatakileso (người đã diệt trừ phiền não) là do đã loại bỏ các ác pháp như hoài nghi, si mê, bất tín. Tam Bảo đó là nơi nương tựa, nơi đến, nơi che chở, nơi ẩn náu của người này, nên gọi là tapparāyaṇo (người có nơi nương tựa đó). Trạng thái của điều đó là tapparāyaṇatā (sự có nơi nương tựa đó). Chính trạng thái đó là tapparāyaṇatākāro (hình thái của sự có nơi nương tựa đó). Điều xảy ra do đó là tapparāyaṇatākārappavatto (sự xảy ra theo hình thái của sự có nơi nương tựa đó). Ở đây, bằng cách dùng từ pasāda (thanh tịnh), Luận sư nói về sự quy y thế gian.
Tañhi saddhāpadhānaṃ, na ñāṇapadhānaṃ, garutāgahaṇena pana lokuttaraṃ.
For that is predominant in faith, not predominant in wisdom; but by the mention of garutā, supramundane saraṇagamana is indicated.
Vì điều đó lấy niềm tin làm chủ đạo, không lấy trí tuệ làm chủ đạo, còn bằng cách dùng từ garutā (sự tôn kính), Luận sư nói về sự quy y siêu thế.
Ariyā hi ratanattayaṃ guṇābhiññatāya pāsāṇacchattaṃ viya garuṃ katvā passanti, tasmā tappasādena tadaṅgappahānavasena vihatakileso, taggarutāya ca agāravakaraṇahetūnaṃ samucchedavasenāti yojetabbaṃ.
For the Noble Ones perceive the Triple Gem as weighty, like a stone umbrella, through their special knowledge of its qualities. Therefore, it should be connected as: one whose defilements are overcome through faith in it (tappasādena) by way of temporary abandonment (tadaṅgappahāna), and by way of weightiness (taggarutāya) through the cutting off of causes for disrespect.
Thật vậy, các bậc Thánh thấy Tam Bảo là đáng tôn kính như chiếc dù đá, do sự hiểu biết đặc biệt về các đức tính. Do đó, cần phải hiểu rằng, do sự thanh tịnh đó, phiền não được diệt trừ bằng cách đoạn trừ từng phần (tadaṅgappahāna), và do sự tôn kính đó, các nguyên nhân của sự bất kính được đoạn trừ hoàn toàn (samucchedappahāna).
Tapparāyaṇatā panettha taggatikatāti tāya catubbidhampi vakkhamānaṃ saraṇagamanaṃ gahitanti daṭṭhabbaṃ.
Here, tapparāyaṇatā means the state of being devoted to that, and it should be understood that by this, all four kinds of saraṇagamana to be explained are included.
Ở đây, tapparāyaṇatā có nghĩa là taggatikatā (sự hướng đến đó). Do đó, cần phải hiểu rằng cả bốn loại quy y sẽ được nói đến đều được bao gồm.
Avisesena vā pasādagarutā jotitāti pasādaggahaṇena anaveccappasādassa lokiyassa, aveccappasādassa ca lokuttarassa gahaṇaṃ, tathā garutāgahaṇena lokiyassa garukaraṇassa, lokuttarassa cāti ubhayenapi padena ubhayampi lokiyalokuttarasaraṇagamanaṃ yojetabbaṃ.
Or, it can be understood that the qualities of faith and reverence are signified indiscriminately. By the mention of pasāda, both mundane saraṇagamana (unwavering faith) and supramundane saraṇagamana (unwavering faith) are included. Similarly, by the mention of garutā, both mundane reverence and supramundane reverence are included; thus, by both terms, both mundane and supramundane saraṇagamana should be connected.
Hoặc, sự thanh tịnh và sự tôn kính được làm nổi bật một cách không phân biệt. Do đó, bằng cách dùng từ pasāda, bao gồm cả sự thanh tịnh thế gian không dao động và sự thanh tịnh siêu thế không dao động. Tương tự, bằng cách dùng từ garutā, bao gồm cả sự tôn kính thế gian và sự tôn kính siêu thế. Như vậy, cả hai loại quy y thế gian và siêu thế đều được hiểu bởi cả hai từ này.
Uppajjati cittametenāti uppādo, sampayuttadhammasamūho, cittañca taṃ uppādo cāti cittuppādo. Samāhāradvandepi hi katthaci pulliṅgamicchanti saddavidū, tadākārappavattaṃ saddhāpaññādisampayuttadhammasahitaṃ cittaṃ saraṇagamanaṃ nāma ‘‘saraṇanti gacchati etenāti katvā’’ti vuttaṃ hoti.
That by which consciousness arises is uppādo, which is the aggregate of conascent phenomena. Cittuppādo is both consciousness and its arising. Indeed, grammarians sometimes desire a masculine gender even in a samāhāra dvanda compound. Thus, the consciousness accompanied by faith, wisdom, and other conascent phenomena, arising in that manner, is called saraṇagamana, meaning "because one goes as a refuge by means of it."
Cái mà tâm sinh khởi bởi nó được gọi là uppādo (sự sinh khởi), tức là tập hợp các pháp đồng sinh. Tâm và sự sinh khởi đó là cittuppādo (sự sinh khởi của tâm). Ngay cả trong hợp chất samāhāradvanda, các nhà ngữ pháp đôi khi cũng muốn dùng giống đực. Tâm cùng với các pháp đồng sinh như tín, tuệ, v.v., phát sinh theo hình thái đó, được gọi là saraṇagamana (sự quy y), được nói là ‘vì nó đi đến nơi nương tựa’.
‘‘Taṃsamaṅgī’’tiādi kattuvibhāvanā.
“Taṃsamaṅgī” and so on is an explanation of the agent.
“Taṃsamaṅgī” và những câu tương tự là sự giải thích về chủ thể.
Tena yathāvuttacittuppādena samaṅgīti taṃsamaṅgī. Tenāha ‘‘vuttappakārena cittuppādenā’’ti.
Taṃsamaṅgī means endowed with that consciousness (cittuppāda) described. Thus, he said, “by the consciousness of the described kind.”
Người đầy đủ với cittuppāda (tâm sinh khởi) đã nói trên là taṃsamaṅgī (người đầy đủ với điều đó). Do đó, Luận sư nói “vuttappakārena cittuppādenā” (bằng sự sinh khởi của tâm theo cách đã nói).
Upetīti bhajati sevati payirupāsati, jānāti vā, bujjhatīti attho.
Upeti means he resorts to, associates with, attends upon, or knows, understands.
Upetī có nghĩa là nương tựa, phụng sự, kính trọng, hoặc hiểu biết, giác ngộ.
Lokuttaraṃ saraṇagamanaṃ kesanti āha ‘‘diṭṭhasaccāna’’nti, aṭṭhannaṃ ariyapuggalānanti attho.
To whom does supramundane saraṇagamana belong? He says “to those who have seen the Truths”, meaning to the eight Noble Ones.
Luận sư nói “diṭṭhasaccānaṃ” (của những người đã thấy sự thật) để chỉ rõ sự quy y siêu thế là của ai, có nghĩa là của tám hạng Thánh nhân.
Kadā taṃ ijjhatīti āha ‘‘maggakkhaṇe’’ti, ‘‘ijjhatī’’ti padena cetassa sambandho.
When does it come to fruition? He says “at the moment of the Path,” and the word “comes to fruition” is connected to this.
Khi nào điều đó thành tựu? Luận sư nói “maggakkhaṇe” (vào khoảnh khắc Đạo). Từ này được liên kết với từ “ijjhati” (thành tựu).
Maggakkhaṇe ijjhamāneneva hi catusaccādhigamena phalaṭṭhānampi saraṇagamakatā sijjhati lokuttarasaraṇagamanassa bhedābhāvato, tesañca ekasantānattā.
Indeed, by the realization of the Four Noble Truths, which comes to fruition at the moment of the Path, the state of saraṇagamana of those on the Fruition (Phalaṭṭhāna) also comes to fruition, because there is no distinction in supramundane saraṇagamana and because they belong to the same continuum.
Thật vậy, chỉ bằng sự chứng đắc Tứ Diệu Đế thành tựu vào khoảnh khắc Đạo, sự quy y của các bậc Quả cũng thành tựu, vì sự quy y siêu thế không có sự khác biệt, và vì chúng có cùng một dòng tâm thức.
Kathaṃ taṃ ijjhatīti āha ‘‘saraṇagamanupakkilesasamucchedenā’’tiādi, upapakkilesasamucchedato, ārammaṇato, kiccato ca sakalepi ratanattaye ijjhatīti vuttaṃ hoti.
How does it come to fruition? He says “by the complete eradication of the defilements of saraṇagamana” and so on. It means that it comes to fruition in the entire Triple Gem by the eradication of defilements, by the object, and by its function.
Làm thế nào điều đó thành tựu? Luận sư nói “saraṇagamanupakkilesasamucchedenā” (bằng sự diệt trừ hoàn toàn các cấu uế của sự quy y) và những câu tương tự. Có nghĩa là, điều đó thành tựu trong toàn bộ Tam Bảo bằng sự diệt trừ hoàn toàn các cấu uế, bằng đối tượng, và bằng chức năng.
Saraṇagamanupakkilesasamucchedenāti cettha pahānābhisamayaṃ sandhāya vuttaṃ, ārammaṇatoti sacchikiriyābhisamayaṃ.
Here, by the complete eradication of the defilements of saraṇagamana is said with reference to the comprehension of abandonment (pahānābhisamaya). By the object (ārammaṇato) is said with reference to the comprehension of realization (sacchikiriyābhisamaya).
Ở đây, saraṇagamanupakkilesasamucchedenā được nói đến để chỉ sự chứng ngộ đoạn trừ (pahānābhisamaya), còn ārammaṇato để chỉ sự chứng ngộ thực chứng (sacchikiriyābhisamaya).
Nibbānārammaṇaṃ hutvā ārammaṇato ijjhatīti hi yojetabbaṃ, tvā-saddo ca hetutthavācako yathā ‘‘sakko hutvā nibbattī’’ti (dha. pa. aṭṭha. 1.2.29).
Indeed, it should be construed as: it comes to fruition by being Nibbāna as its object (ārammaṇa). And the particle tvā denotes the meaning of cause, just as in “‘He was reborn having been Sakka’” (Sakka hutvā nibbattī).
Thật vậy, cần phải hiểu rằng điều đó thành tựu bằng đối tượng, khi trở thành đối tượng của Niết-bàn. Và từ tvā mang ý nghĩa nguyên nhân, như trong ‘trở thành Sakka mà tái sinh’.
Apica ‘‘ārammaṇato’’ti vuttamevatthaṃ sarūpato niyameti ‘‘nibbānārammaṇaṃ hutvā’’ti iminā.
Furthermore, the meaning expressed by “ārammaṇato” is specified in its intrinsic nature by “nibbānārammaṇaṃ hutvā”.
Hơn nữa, ý nghĩa đã được nói là “ārammaṇato” (bằng đối tượng) được xác định rõ ràng về bản chất bởi “nibbānārammaṇaṃ hutvā” (trở thành đối tượng của Niết-bàn) này.
‘‘Kiccato’’ti tadavasesaṃ bhāvanābhisamayaṃ pariññābhisamayañca sandhāya vuttaṃ.
“By its function” is said with reference to the remaining comprehension of development (bhāvanābhisamaya) and the comprehension of full understanding (pariññābhisamaya).
“Kiccato” (bằng chức năng) được nói đến để chỉ sự chứng ngộ tu tập (bhāvanābhisamaya) và sự chứng ngộ hiểu biết toàn diện (pariññābhisamaya) còn lại sau đó.
‘‘Ārammaṇato nibbānārammaṇaṃ hutvā’’ti etena vā maggakkhaṇānurūpaṃ ekārammaṇataṃ dassetvā ‘‘kiccato’’ti iminā pahānato avasesaṃ kiccattayaṃ dassitanti daṭṭhabbaṃ.
Or, it should be understood that by “ārammaṇato nibbānārammaṇaṃ hutvā,” the single object corresponding to the moment of the Path is shown, and by “kiccato,” the three remaining functions (from abandonment) are shown.
Hoặc, bằng cách trình bày sự nhất quán về đối tượng phù hợp với khoảnh khắc Đạo qua “ārammaṇato nibbānārammaṇaṃ hutvā” (bằng đối tượng, khi trở thành đối tượng của Niết-bàn), và bằng “kiccato” (bằng chức năng) này, ba chức năng còn lại sau chức năng đoạn trừ (pahāna) được trình bày. Điều này cần được hiểu.
‘‘Maggakkhaṇe, nibbānārammaṇaṃ hutvā’’ti ca vuttattā atthato maggañāṇasaṅkhāto catusaccādhigamo eva lokuttarasaraṇagamananti viññāyati.
And because it is said “‘at the moment of the Path, by having Nibbāna as its object’”, it is understood that in essence, the realization of the Four Noble Truths, which is called Path-knowledge, is indeed supramundane saraṇagamana.
Và vì đã nói ‘vào khoảnh khắc Đạo, khi trở thành đối tượng của Niết-bàn’, nên theo ý nghĩa, sự chứng đắc Tứ Diệu Đế, tức là trí tuệ Đạo, chính là sự quy y siêu thế.
Tattha hi catusaccādhigamane saraṇagamanupakkilesassa pahānābhisamayavasena samucchindanaṃ bhavati, nibbānadhammo pana sacchikiriyābhisamayavasena, maggadhammo ca bhāvanābhisamayavasena paṭivijjhiyamānoyeva saraṇagamanatthaṃ sādheti, buddhaguṇā pana sāvakagocarabhūtā pariññābhisamayavasena paṭivijjhiyamānā saraṇagamanatthaṃ sādhenti, tathā ariyasaṅghaguṇā.
For in that realization of the Four Noble Truths, there is the complete eradication of the defilements of saraṇagamana by way of comprehension of abandonment. The Nibbāna-Dhamma, however, achieves the purpose of saraṇagamana only when it is penetrated by way of comprehension of realization. And the Path-Dhamma achieves the purpose of saraṇagamana only when it is penetrated by way of comprehension of development. The Buddha-qualities, which are within the scope of disciples, achieve the purpose of saraṇagamana when they are penetrated by way of comprehension of full understanding. The same applies to the qualities of the Noble Saṅgha.
Trong đó, khi chứng đắc Tứ Diệu Đế, sự đoạn trừ hoàn toàn các cấu uế của sự quy y xảy ra theo cách chứng ngộ đoạn trừ. Còn Pháp Niết-bàn thì theo cách chứng ngộ thực chứng, và Pháp Đạo thì thành tựu ý nghĩa quy y khi được thấu hiểu theo cách chứng ngộ tu tập. Còn các đức tính của Đức Phật, là đối tượng của các đệ tử, thì thành tựu ý nghĩa quy y khi được thấu hiểu theo cách chứng ngộ hiểu biết toàn diện. Tương tự là các đức tính của Thánh Tăng.
Tenāha ‘‘sakalepi ratanattaye ijjhatī’’ti.
Therefore, he said “it comes to fruition in the entire Triple Gem.”
Do đó, Luận sư nói “sakalepi ratanattaye ijjhatī” (điều đó thành tựu trong toàn bộ Tam Bảo).
Phalapariyattīnampettha vuttanayena maggānuguṇappavattiyā gahaṇaṃ, apariññeyyabhūtānañca buddhasaṅghaguṇānaṃ tagguṇasāmaññatāyāti daṭṭhabbaṃ.
Here, the Fruition-Pariyattis are also included by the method described, due to their activity conforming to the Path, and the uncomprehended qualities of the Buddha and Saṅgha are included due to their commonality with those qualities.
Ở đây, cần phải hiểu rằng các quả và học pháp (pariyatti) cũng được bao gồm theo cách đã nói, do sự vận hành phù hợp với Đạo, và các đức tính của Phật và Tăng, vốn không thể hiểu biết toàn diện, thì do sự tương đồng với các đức tính đó.
Evañhi sakalabhāvavisiṭṭhavacanaṃ upapannaṃ hotīti.
For only then does the expression "distinguished by its complete nature" become justifiable.
Vì vậy, lời nói đặc biệt về toàn bộ bản chất trở nên hợp lý.
Ijjhantañca saheva ijjhati, na lokiyaṃ viya paṭipāṭiyā asammohapaṭivedhena paṭividdhattāti gahetabbaṃ.
And its fruition occurs simultaneously; it does not occur in sequence like the mundane, because it is penetrated with non-deluded penetration.
Và sự thành tựu đó xảy ra đồng thời, không phải tuần tự như trong thế gian, vì đã được thấu hiểu bằng sự thấu hiểu không lầm lẫn. Điều này cần được hiểu.
Padīpassa viya hi ekakkhaṇeyeva maggassa catukiccasādhananti.
For just as a lamp performs its four functions in a single moment, so too does the Path perform its four functions in a single moment.
Thật vậy, giống như một ngọn đèn, Đạo thực hiện bốn chức năng trong cùng một khoảnh khắc.
Ye pana vadanti ‘‘saraṇagamanaṃ nibbānārammaṇaṃ hutvā na pavattati, maggassa adhigatattā pana adhigatameva taṃ hoti ekaccānaṃ tevijjādīnaṃ lokiyavijjādayo viyā’’ti, tesaṃ pana vacane lokiyameva saraṇagamanaṃ siyā, na lokuttaraṃ, tañca ayuttameva duvidhassāpi tassa icchitabbattā.
Moreover, as for those who say, “Refuge-taking, having Nibbāna as its object, does not occur; but rather, because the path has been attained, that refuge is indeed attained for some individuals, just as worldly knowledges, etc., are attained,” in the saying of those teachers, refuge-taking would only be mundane, not supramundane; and that is indeed inappropriate, because both kinds of it (mundane and supramundane refuge-taking) are desired.
Tuy nhiên, những ai nói rằng: “Sự quy y không diễn ra với Niết Bàn làm đối tượng, mà do Đạo đã được chứng đắc, nên sự quy y đó đã được chứng đắc đối với một số người có Tam Minh (tevijjā) v.v., giống như các thế tục minh (lokiyavijjā) v.v. đã được chứng đắc vậy”, thì trong lời nói của những vị ấy, sự quy y chỉ là thế tục (lokiya), không phải siêu thế (lokuttara), và điều đó là không hợp lý, vì cả hai loại quy y đều được mong muốn.
Tadaṅgappahānena saraṇagamanupakkilesavikkhambhanaṃ.
Tadaṅgappahāna: The overcoming of the defilements of refuge-taking by way of temporary abandonment (tadaṅgappahāna).
Sự trấn áp các ô nhiễm của quy y bằng cách đoạn trừ từng phần (tadaṅgappahāna).
Ārammaṇato buddhādiguṇārammaṇaṃ hutvāti etthāpi vuttanayena attho, saraṇagamanupakkilesavikkhambhanato, ārammaṇato ca sakalepi ratanattaye ijjhatīti vuttaṃ hoti.
The meaning of "Ārammaṇato buddhādiguṇārammaṇaṃ hutvā (as having the qualities of the Buddha, etc., as its object) in this (phrase) is also in accordance with the method stated above. It is said that it is accomplished in the entire Triple Gem by way of the overcoming of the defilements of refuge-taking, and by way of the object.
Ở đây, ý nghĩa của câu “ārammaṇato buddhādiguṇārammaṇaṃ hutvā” (do đối tượng, trở thành đối tượng của các đức Phật v.v.) cũng được hiểu theo cách đã nói, tức là do sự trấn áp các ô nhiễm của quy y và do đối tượng, sự quy y được thành tựu trong toàn bộ Tam Bảo.
Tanti lokiyasaraṇagamanaṃ.
Taṃ (That) means mundane refuge-taking.
“Taṃ” (điều đó) là sự quy y thế tục.
‘‘Sammāsambuddho bhagavā’’tiādinā saddhāpaṭilābho.
Saddhāpaṭilābho (the acquisition of faith) is by means of "The Blessed One is a Perfectly Self-Enlightened One," and so on.
“Saddhāpaṭilābho” (sự đạt được niềm tin) là từ câu “Sammāsambuddho Bhagavā” (Đức Thế Tôn là Bậc Chánh Đẳng Giác) v.v.
Saddhāmūlikāti yathāvuttasaddhāpubbaṅgamā.
Saddhāmūlikā (rooted in faith) means having the aforementioned faith as its precursor.
“Saddhāmūlikā” (có nền tảng là niềm tin) nghĩa là có niềm tin đã nói làm tiền đề.
Sahajātavasena pubbaṅgamatāyeva hi tammūlikatā saddhāvirahitassa buddhādīsu sammādassanassa asambhavato.
Indeed, being rooted in faith is nothing but having it as a precursor by way of its co-arising nature, because right view concerning the Buddha and others is impossible for one devoid of faith.
Thật vậy, việc có niềm tin làm tiền đề chính là việc có nền tảng là niềm tin, vì không thể có cái thấy đúng đắn về Đức Phật v.v. mà không có niềm tin.
Sammādiṭṭhi nāma buddhasubuddhataṃ, dhammasudhammataṃ saṅghasuppaṭipannatañca lokiyāvabodhavasena sammā ñāyena dassanato.
Sammādiṭṭhi (Right View) is correctly seeing, with worldly understanding, the perfect enlightenment of the Buddha, the perfect Dhamma, and the perfect practice of the Saṅgha.
Chánh kiến (sammādiṭṭhi) là sự thấy đúng đắn, theo trí tuệ thế tục, về sự giác ngộ hoàn toàn của Đức Phật, sự hoàn hảo của Pháp và sự thực hành đúng đắn của Tăng đoàn.
‘‘Saddhāpaṭilābho’’ti iminā sammādiṭṭhivirahitāpi saddhā lokiyasaraṇagamananti dasseti, ‘‘saddhāmūlikā ca sammādiṭṭhī’’ti pana etena saddhūpanissayā yathāvuttā paññāti.
By this, "the acquisition of faith," it shows that even faith devoid of right view is mundane refuge-taking. But by "and right view rooted in faith," it is said that the aforementioned wisdom has faith as its support.
Với câu “Saddhāpaṭilābho” (sự đạt được niềm tin), cho thấy rằng ngay cả niềm tin không có chánh kiến cũng là sự quy y thế tục, còn với câu “saddhāmūlikā ca sammādiṭṭhī” (và chánh kiến có nền tảng là niềm tin) thì chỉ ra rằng trí tuệ đã nói là dựa trên niềm tin.
Lokiyampi hi saraṇagamanaṃ duvidhaṃ ñāṇasampayuttaṃ, ñāṇavippayuttañca.
Indeed, even mundane refuge-taking is of two kinds: associated with knowledge, and dissociated from knowledge.
Thật vậy, sự quy y thế tục cũng có hai loại: tương ưng với trí tuệ và không tương ưng với trí tuệ.
Tattha paṭhamena padena mātādīhi ussāhitadārakādīnaṃ viya ñāṇavippayuttaṃ saraṇagamanaṃ gahitaṃ, dutiyena pana ñāṇasampayuttaṃ.
Among these, by the first term, refuge-taking dissociated from knowledge, like that of children exhorted by their mothers and others, is taken; but by the second (term), refuge-taking associated with knowledge (is taken).
Trong đó, với từ đầu tiên, sự quy y không tương ưng với trí tuệ được nắm giữ, giống như của trẻ con được cha mẹ v.v. khuyến khích; còn với từ thứ hai, là sự quy y tương ưng với trí tuệ.
Tadubhayameva puññakiriyavatthu visesabhāvena dassetuṃ ‘‘dasasu puññakiriyavatthūsu diṭṭhijukammanti vuccatī’’ti āha.
To show both of these as a special kind of meritorious deed, it is said, "dasasu puññakiriyavatthūsu diṭṭhijukammanti vuccatī (it is called 'rectifying one's view' among the ten bases of meritorious deeds). "
Để chỉ ra cả hai điều đó như một loại đặc biệt của cơ sở tạo phước, Đức Thế Tôn đã nói: “Trong mười cơ sở tạo phước, nó được gọi là diṭṭhijukamma (làm cho kiến chấp ngay thẳng)”.
Diṭṭhi eva attano paccayehi ujuṃ karīyatīti hi atthena sammādiṭṭhiyā diṭṭhijukammabhāvo, diṭṭhi ujuṃ karīyati etenāti atthena pana saddhāyapi.
Indeed, the state of right view being diṭṭhijukamma (rectifying one's view) is by the meaning that one's view is made straight by its own conditions; and also for faith, by the meaning that view is made straight by it.
Thật vậy, chánh kiến được gọi là diṭṭhijukamma theo nghĩa là kiến chấp tự nó được làm cho ngay thẳng bằng các nhân duyên của nó; còn niềm tin cũng được gọi là diṭṭhijukamma theo nghĩa là kiến chấp được làm cho ngay thẳng bằng điều này.
Saddhāsammādiṭṭhiggahaṇena cettha tappadhānassāpi cittuppādassa gahaṇaṃ, diṭṭhijukammapadena ca yathāvuttena karaṇasādhanena, evañca katvā ‘‘tapparāyaṇatākārappavatto cittuppādo’’ti heṭṭhā vuttavacanaṃ samatthitaṃ hoti, saddhāsammādiṭṭhīnaṃ pana visuṃ gahaṇaṃ taṃsampayuttacittuppādassa tappadhānatāyāti daṭṭhabbaṃ.
Here, by the inclusion of faith and right view, the thought-moment where these are predominant is also included; and by the term diṭṭhijukamma, with the aforementioned instrumental meaning, the statement "the thought-moment occurring with the characteristic of having that as its ultimate resort," mentioned below, is established. The separate inclusion of faith and right view should be understood as due to their predominance in the thought-moment associated with them.
Việc nắm giữ niềm tin và chánh kiến ở đây cũng bao gồm sự phát khởi tâm mà điều đó là chủ yếu, và với từ diṭṭhijukamma đã nói theo nghĩa công cụ (karaṇasādhana), thì lời nói đã được nói ở dưới “sự phát khởi tâm diễn ra với sự nương tựa vào điều đó” được chứng minh, còn việc nắm giữ riêng niềm tin và chánh kiến là do sự phát khởi tâm tương ưng với chúng là chủ yếu, điều này cần được hiểu.
Tayidanti lokiyaṃ saraṇagamanameva paccāmasati lokuttarassa tathā bhedābhāvato.
Tayidaṃ (This) refers only to mundane refuge-taking, because supramundane (refuge-taking) does not have such divisions.
“Tayidaṃ” (điều này) chỉ đề cập đến sự quy y thế tục, vì quy y siêu thế không có sự phân biệt như vậy.
Tassa hi maggakkhaṇeyeva vuttanayena ijjhanato tathāvidhassa samādānassa avijjamānattā esa bhedo na sambhavatīti.
For, since that (supramundane refuge-taking) is accomplished only at the moment of the path in the manner stated, and because such an undertaking does not exist, this division is not possible.
Vì sự thành tựu của nó chỉ diễn ra vào khoảnh khắc của Đạo theo cách đã nói, nên sự phân biệt này không thể có được do không có sự thọ trì như vậy.
Attā sanniyyātīyati appīyati pariccajīyati etenāti attasanniyyātanaṃ, yathāvuttaṃ saraṇagamanasaṅkhātaṃ diṭṭhijukammaṃ.
Attasanniyyātanaṃ (the surrender of self) is the aforementioned diṭṭhijukamma, called refuge-taking, by which one surrenders, entrusts, and relinquishes oneself.
“Attasanniyyātanaṃ” (sự hiến dâng tự ngã) là sự hiến dâng, sự trao phó, sự từ bỏ tự ngã bằng điều này, tức là diṭṭhijukamma, được gọi là quy y như đã nói.
Taṃ ratanattayaṃ parāyaṇaṃ paṭisaraṇametassāti tapparāyaṇo, puggalo, cittuppādo vā, tassa bhāvo tapparāyaṇatā, tadeva diṭṭhijukammaṃ.
Tapparāyaṇa (having that as one's ultimate resort) is a person or a thought-moment for whom the Triple Gem is the ultimate resort, the refuge; and its state is tapparāyaṇatā (the state of having that as one's ultimate resort), which is precisely that diṭṭhijukamma.
“Tapparāyaṇo” (có điều đó làm nơi nương tựa) là người hoặc tâm thức mà Tam Bảo đó là nơi nương tựa, là nơi ẩn náu của người đó; “tapparāyaṇatā” (trạng thái có điều đó làm nơi nương tựa) là trạng thái của điều đó, tức là chính diṭṭhijukamma.
‘‘Saraṇa’’nti adhippāyena sissabhāvaṃ antevāsikabhāvasaṅkhātaṃ vattapaṭivattādikaraṇaṃ upagacchati etenāti sissabhāvūpagamanaṃ. Saraṇagamanādhippāyeneva paṇipatati etenāti paṇipāto, paṇipatanañcettha abhivādanapaccuṭṭhānaañjalikammasāmīcikammameva, sabbattha ca atthato yathāvuttadiṭṭhijukammameva veditabbaṃ.
Sissabhāvūpagamanaṃ (taking on the state of a disciple) is that by which one enters the state of a disciple, meaning an apprentice who performs duties and counter-duties, with the intention of refuge. Paṇipāto (prostration) is that by which one prostrates with the intention of refuge-taking. And here, prostration means bowing, rising to greet, respectfully joining hands, and all acts of proper conduct; and in all cases, by meaning, it should be understood as precisely the aforementioned diṭṭhijukamma.
“Sissabhāvūpagamanaṃ” (sự chấp nhận địa vị học trò) là sự chấp nhận địa vị học trò, tức là địa vị đệ tử, thực hiện các bổn phận và đối đáp v.v. với ý nghĩa là quy y bằng điều này. “Paṇipāto” (sự đảnh lễ) là sự đảnh lễ bằng điều này với ý nghĩa quy y; và ở đây, sự đảnh lễ là sự chào hỏi, đứng dậy, chắp tay và các hành động tôn kính, và ở mọi nơi, về ý nghĩa, nó cần được hiểu là chính diṭṭhijukamma đã nói.
Saṃsāradukkhanittharaṇatthaṃ attano attabhāvassa pariccajanaṃ attapariccajanaṃ.
Attapariccajanaṃ (the abandonment of self) is the giving up of one's own existence for the sake of escaping the suffering of saṃsāra.
Sự từ bỏ tự ngã (attabhāva) của mình để thoát khỏi khổ đau của luân hồi là “attapariccajanaṃ” (sự từ bỏ tự ngã).
Tapparāyaṇatādīsupi eseva nayo.
The same method applies to tapparāyaṇatā (having that as one's ultimate resort) and so on.
Trong “tapparāyaṇatā” v.v. cũng theo cách này.
Hitopadesakathāpariyāyena dhammassāpi ācariyabhāvo samudācarīyati ‘‘phalo ambo aphalo ca, te satthāro ubho mamā’’tiādīsu viyāti āha ‘‘dhammassa antevāsiko’’ti.
It is said "dhammassa antevāsiko (a disciple of the Dhamma)" because, by way of instructive stories, the Dhamma is also regarded as a teacher, as in "Some mangoes bear fruit, some do not, both are my teachers."
Theo cách nói của câu chuyện giáo huấn có lợi, Pháp cũng được gọi là bậc thầy, như trong câu “phalo ambo aphalo ca, te satthāro ubho mamā” (cây xoài có quả và không quả, cả hai đều là thầy của ta) v.v., nên đã nói “dhammassa antevāsiko” (là đệ tử của Pháp).
‘‘Abhivādanā’’tiādi paṇipātassa atthadassanaṃ.
Abhivādanā (paying homage) and so on, explain the meaning of prostration.
“Abhivādanā” v.v. là sự trình bày ý nghĩa của paṇipāta.
Buddhādīnaṃyevāti avadhāraṇassa attasanniyyātanādīsupi sīhagatikavasena adhikāro veditabbo.
The restrictive particle (yeva) in "buddhādīnaṃyevā (only of the Buddha and others)" should be understood to apply to attasanniyyātana (surrender of self) and others, by way of a lion's gait.
Sự giới hạn “Buddhādīnaṃyevā” (chỉ của chư Phật v.v.) cũng cần được hiểu là có hiệu lực theo kiểu sư tử vồ mồi (sīhagatikavasena) trong attasanniyyātana v.v.
Evañhi tadaññanivattanaṃ kataṃ hotīti.
For in this way, the exclusion of others is accomplished.
Như vậy, sự loại trừ những điều khác đã được thực hiện.
‘‘Imesañhī’’tiādi catudhā pavattanassa samatthanaṃ, kāraṇadassanaṃ vā.
Imesañhītiādi (These, indeed, etc.) is the establishment or explanation of the reason for the fourfold occurrence.
“Imesañhī” v.v. là sự chứng minh cho sự diễn tiến bốn cách, hoặc là sự trình bày nguyên nhân.
Evaṃ attasanniyyātanādīni ekena pakārena dassetvā idāni aparehipi pakārehi dassetuṃ ‘‘apicā’’tiādi āraddhaṃ, etena attasanniyyātanatapparāyaṇatādīnaṃ catunnaṃ pariyāyantarehipi attasanniyyātanatapparāyaṇatādi katameva hoti atthassa abhinnattā yathā taṃ ‘‘sikkhāpaccakkhānaabhūtārocanānī’’ti dasseti.
Thus, having shown attasanniyyātana (the surrender of self) and so on in one way, now apicā (furthermore, etc.) is begun to show them in other ways. By this, it shows that attasanniyyātana, tapparāyaṇatā (having that as one's ultimate resort) and so on, of the four (kinds of refuge-taking), are indeed accomplished as attasanniyyātana, tapparāyaṇatā and so on, even in other classifications, because the meaning is not different, just as "renunciation of training" and "declarations of non-human states" are not different in meaning.
Sau khi trình bày attasanniyyātana v.v. theo một cách, bây giờ để trình bày theo những cách khác, câu “apicā” v.v. được bắt đầu, và điều này cho thấy rằng attasanniyyātana, tapparāyaṇatā v.v. bốn loại này cũng là attasanniyyātana, tapparāyaṇatā v.v. theo các cách khác, vì ý nghĩa không khác biệt, giống như “sikkhāpaccakkhānaabhūtārocanānī” (sự từ bỏ giới luật và sự công bố những điều không có thật).
Jīvitapariyantikanti bhāvanapuṃsakavacanaṃ, yāvajīvaṃ gacchāmīti attho.
Jīvitapariyantikaṃ (for as long as life lasts) is a neuter noun expressing state, meaning "I go for refuge as long as I live."
“Jīvitapariyantikaṃ” là từ trung tính chỉ trạng thái, có nghĩa là “con xin quy y suốt đời”.
Mahākassapo kira sayameva pabbajitavesaṃ gahetvā mahātitthabrāhmaṇagāmato nikkhamitvā gacchanto tigāvutamaggaṃ paccuggamanaṃ katvā antarā ca rājagahaṃ, antarā ca nāḷandaṃ bahuputtakanigrodharukkhamūle ekakameva nisinnaṃ bhagavantaṃ passitvā ‘‘ayaṃ bhagavā arahaṃ sammāsambuddho’’ti ajānantoyeva ‘‘satthārañca vatāhaṃ passeyyaṃ, bhagavantameva passeyya’’ntiādinā (saṃ. ni. 2.154) saraṇagamanamakāsi.
It is said that Mahākassapa, having taken on the appearance of a renunciant himself, left the brahmin village of Mahātittha, and as he was walking, having gone three gavutas to meet (the Buddha), he saw the Blessed One sitting alone at the root of the Bapuputtaka Nigrodha tree, between Rājagaha and Nāḷandā. Without knowing, "This Blessed One is an Arahant, a Perfectly Self-Enlightened One," he took refuge, saying, "Satthārañca vatāhaṃ passeyyaṃ, bhagavantameva passeyya (Oh, if only I could see the Teacher, I would see only the Blessed One!)," and so on.
Đại Ca Diếp (Mahākassapa) đã tự mình khoác y phục xuất gia, rời làng Bà La Môn Mahātittha và đang đi thì gặp Đức Thế Tôn đang ngồi một mình dưới gốc cây đa Bahuputtaka, giữa Rājagaha và Nāḷanda, sau khi đi được ba gāvuta. Ngài đã quy y mà không biết rằng “Đức Thế Tôn này là Bậc A La Hán, Chánh Đẳng Giác” với lời nói “satthārañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyaṃ” (ước gì tôi được thấy Bậc Đạo Sư, ước gì tôi được thấy chính Đức Thế Tôn) v.v.
Tena vuttaṃ ‘‘mahākassapassa saraṇagamanaṃ viyā’’ti.
Therefore, it is said, "mahākassapassa saraṇagamanaṃ viyā (like Mahākassapa’s refuge-taking)."
Do đó, đã nói “mahākassapassa saraṇagamanaṃ viyā” (giống như sự quy y của Đại Ca Diếp).
Vitthāro kassapasaṃyuttaṭṭhakathāyaṃ (saṃ. ni. aṭṭha. 2.2.154) gahetabbo.
The detailed account should be taken from the Commentary on the Kassapa Saṃyutta.
Chi tiết cần được lấy từ Chú giải Kassapasaṃyutta (saṃ. ni. aṭṭha. 2.2.154).
Tattha satthārañcavatāhaṃ passeyyaṃ, bhagavantameva passeyyanti sace ahaṃ satthāraṃ passeyyaṃ, imaṃ bhagavantaṃyeva passeyyaṃ.
There, "Satthārañcavatāhaṃ passeyyaṃ, bhagavantameva passeyya (Oh, if only I could see the Teacher, I would see only the Blessed One!)" means, "If I were to see a Teacher, I would see only this Blessed One.
Ở đó, “satthārañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyaṃ” có nghĩa là: nếu tôi được thấy một Bậc Đạo Sư, tôi sẽ thấy chính Đức Thế Tôn này.
Na hi me ito aññena satthārā bhavituṃ sakkā.
For it is not possible for me to have another Teacher than this (Blessed One). "
Thật vậy, tôi không thể có một Bậc Đạo Sư nào khác ngoài Ngài.
Sugatañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyanti sace ahaṃ sammāpaṭipattiyā suṭṭhu gatattā sugataṃ nāma passeyyaṃ, imaṃ bhagavantaṃyeva passeyyaṃ.
"Sugatañca vatāhaṃ passeyyaṃ, bhagavantameva passeyya (Oh, if only I could see the Well-Gone One, I would see only the Blessed One!)" means, "If I were to see one called Sugata (Well-Gone), who has gone well by right practice, I would see only this Blessed One.
“Sugatañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyaṃ” có nghĩa là: nếu tôi được thấy một Bậc Thiện Thệ (Sugata) do đã đi đúng đường, tôi sẽ thấy chính Đức Thế Tôn này.
Na hi me ito aññena sugatena bhavituṃ sakkā.
For it is not possible for me to have another Sugata than this (Blessed One). "
Thật vậy, tôi không thể có một Bậc Thiện Thệ nào khác ngoài Ngài.
Sammāsambuddhañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyanti sace ahaṃ sammā sāmañca saccāni buddhattā sammāsambuddhaṃ nāma passeyyaṃ, imaṃ bhagavantaṃyeva passeyyaṃ, na hi me ito aññena sammāsambuddhena bhavituṃ sakkāti ayamettha aṭṭhakathā.
"Sammāsambuddhañca vatāhaṃ passeyyaṃ, bhagavantameva passeyya (Oh, if only I could see the Perfectly Self-Enlightened One, I would see only the Blessed One!)" means, "If I were to see one called Sammāsambuddha (Perfectly Self-Enlightened), who has directly known the truths by himself without error, I would see only this Blessed One. For it is not possible for me to have another Sammāsambuddha than this (Blessed One)." This is the commentary here.
“Sammāsambuddhañca vatāhaṃ passeyyaṃ, bhagavantameva passeyyaṃ” có nghĩa là: nếu tôi được thấy một Bậc Chánh Đẳng Giác (Sammāsambuddha) do đã tự mình giác ngộ các Chân lý một cách đúng đắn, tôi sẽ thấy chính Đức Thế Tôn này; thật vậy, tôi không thể có một Bậc Chánh Đẳng Giác nào khác ngoài Ngài – đây là Chú giải ở đây.
Sabbattha ca-saddo, vata-saddo ca padapūraṇamattaṃ, ce-saddena vā bhavitabbaṃ ‘‘sace’’ti aṭṭhakathāyaṃ (saṃ. ni. aṭṭha. 2.2.154) vuttattā.
Everywhere, the word ca and the word vata are merely expletive particles, or it should be ce (if), because it is stated in the Commentary that it is sace (if).
Ở mọi nơi, từ “ca” và từ “vata” chỉ là để làm đầy đủ từ ngữ, hoặc nên là từ “ce” vì đã được nói trong Chú giải (saṃ. ni. aṭṭha. 2.2.154) là “sace”.
Vata-saddo ca passitukāmatāya ekaṃsatthaṃ dīpetītipi yujjati.
The word vata is also appropriately interpreted as indicating the certainty of the desire to see.
Từ “vata” cũng hợp lý khi chỉ ra sự chắc chắn của mong muốn được thấy.
‘‘So aha’’ntiādi suttanipāte āḷavakasutte. Tattha kiñcāpi maggeneva tassa saraṇagamanamāgataṃ, sotāpannabhāvadassanatthaṃ, pana pasādānurūpadassanatthañca evaṃ vācaṃ bhindatīti tadaṭṭhakathāyaṃ (su. ni. aṭṭha. 1.181) vuttaṃ.
“So ahaṃ” (I am), etc., is mentioned in the Suttanipāta, in the Āḷavaka Sutta. There, although his going for refuge came about through the Path itself, yet, in order to show his state of being a Stream-enterer (Sotāpanna), and also to show the appropriateness of his devotion, he spoke thus, as stated in the commentary to that text.
“So ahaṃ” (Ta là) v.v… được nói trong Āḷavaka Sutta của Suttanipāta. Ở đó, mặc dù sự quy y của Āḷavaka đã đến bằng Đạo lộ, nhưng để hiển thị trạng thái của một Bậc Nhập Lưu (Sotāpanna), và để hiển thị sự tùy thuận theo niềm tin, lời nói được phân tách như vậy, điều này được nói trong Chú giải của nó.
Gāmā gāmanti aññasmā devagāmā aññaṃ devagāmaṃ, devatānaṃ vā khuddakaṃ, mahantañca gāmantipi attho.
“From village to village” means from one devagāma to another devagāma, or to a small or large village of devas.
Gāmā gāmaṃ (từ làng này đến làng khác) nghĩa là từ một làng chư thiên này đến một làng chư thiên khác, hoặc là làng nhỏ hay làng lớn của chư thiên.
Purā puranti etthāpi eseva nayo.
The same method applies to “from city to city” here.
Purā puraṃ (từ thành này đến thành khác) ở đây cũng theo cách tương tự.
Dhammassa ca sudhammatanti buddhassa subuddhataṃ, dhammassa sudhammataṃ, saṅghassa suppaṭipannatañca abhitthavitvāti saha samuccayena, pāṭhasesena ca attho, sambuddhaṃ namassamāno dhammaghosako hutvā vicarissāmīti vuttaṃ hoti.
“And the good quality of the Dhamma” means having extolled the perfect enlightenment of the Buddha, the perfect goodness of the Dhamma, and the perfect practice of the Saṅgha; this is the meaning in conjunction with the conjunctive particle “ca” and the remainder of the text. It means, “Having paid homage to the Perfectly Enlightened One and become a proclaimer of the Dhamma, I shall wander.”
Dhammassa ca sudhammataṃ (và Pháp là Pháp thiện) nghĩa là tán thán Đức Phật là Bậc Chánh Đẳng Giác (Subuddha), Pháp là Pháp thiện (Sudhamma), và Tăng là Bậc thực hành chân chánh (Suppaṭipanna), với sự kết hợp của giới từ “ca” (và), và phần còn lại của câu, có nghĩa là: “Tôi sẽ đi khắp nơi, đảnh lễ Đức Phật, trở thành người tuyên bố Pháp.”
Āḷavakādīnanti ādi-saddena sātāgirahemavatādīnampi saṅgaho.
In “Āḷavakādīnaṃ” (of Āḷavaka and others), the term “ādi” (and others) includes Sātāgira, Hemavata, and others.
Āḷavakādīnaṃ (của Āḷavaka và những vị khác): Với từ ādi (v.v…), Sātāgira, Hemavata v.v… cũng được bao gồm.
Nanu ca ete āḷavakādayo adhigatamaggattā maggeneva āgatasaraṇagamanā, kasmā tesaṃ tapparāyaṇatāsaraṇagamanaṃ vuttanti?
But are not these Āḷavaka and others those whose going for refuge came about through the Path itself, having attained the Path? Why, then, is their refuge referred to as a "tapparāyaṇatā-saraṇagamanaṃ" (going for refuge with that as their final goal)?
Há chẳng phải Āḷavaka và những vị này, do đã chứng đắc Đạo, nên sự quy y của họ đã đến bằng Đạo lộ sao? Tại sao lại nói sự quy y với họ là quy y nương tựa (tapparāyaṇatā)?
Maggenāgatasaraṇagamanehipi tehi tapparāyaṇatākārassa paveditattā.
Because even with the going for refuge that arose through the Path, the nature of their having that as their final goal was declared by them.
Bởi vì họ đã bày tỏ trạng thái nương tựa (tapparāyaṇatā) đó ngay cả với sự quy y đã đến bằng Đạo lộ.
‘‘So ahaṃ vicarissāmi…pe… sudhammataṃ, (saṃ. ni. 1.246; su. ni. 194) te mayaṃ vicarissāma, gāmā gāmaṃ nagā nagaṃ…pe… sudhammata’’nti (su. ni. 182) ca hi etehi tapparāyaṇatākāro pavedito.
For it was by them that the nature of having that as their final goal was declared, as in “So ahaṃ vicarissāmi…pe… sudhammataṃ, te mayaṃ vicarissāma, gāmā gāmaṃ nagā nagaṃ…pe… sudhammataṃ.”
Thật vậy, Āḷavaka và những vị này đã bày tỏ trạng thái nương tựa đó qua các câu: “Ta sẽ đi khắp nơi… v.v… Pháp là Pháp thiện” (Saṃ. Ni. 1.246; Su. Ni. 194) và “Chúng ta sẽ đi khắp nơi, từ làng này đến làng khác, từ núi này đến núi khác… v.v… Pháp là Pháp thiện” (Su. Ni. 182).
Tasmā saraṇagamanavisesamanapekkhitvā pavedanākāramattaṃ upadisantena evaṃ vuttanti daṭṭhabbaṃ.
Therefore, it should be understood that this was said by one who, disregarding the specific type of going for refuge, merely pointed out the manner of its declaration.
Vì vậy, cần phải hiểu rằng điều này được nói để chỉ ra trạng thái tuyên bố thuần túy, không xét đến sự đặc biệt của sự quy y.
Athāti ‘‘kathaṃ kho brāhmaṇo hotī’’tiādinā puṭṭhassa aṭṭhavidhapañhassa ‘‘pubbenivāsaṃ yo vedī’’tiādinā byākaraṇapariyosānakāle.
“Atha” (then) refers to the time at the conclusion of the explanation of the eightfold question, such as “How, indeed, does one become a brahmin?”, with expressions like “He who knows his former existences…”
Atha (Rồi): Vào thời điểm kết thúc lời giải đáp cho tám loại câu hỏi, bắt đầu bằng “Này Bà-la-môn, làm thế nào để trở thành Bà-la-môn?”, với câu “Người nào biết được túc mạng” v.v…
Idañhi majjhimapaṇṇāsake brahmāyusutte (ma. ni. 2.394) paricumbatīti pariphusati.
Indeed, in the Majjhimapaṇṇāsaka, in the Brahmāyu Sutta, “paricumbatīti” means touches closely.
Điều này được nói trong Brahmāyu Sutta của Majjhima Paṇṇāsaka (Ma. Ni. 2.394). Paricumbatī (hôn) nghĩa là chạm vào.
Parisambāhatīti parimajjati.
“Parisambāhatīti” means massages.
Parisambāhatī (xoa bóp) nghĩa là xoa.
Evampi paṇipāto daṭṭhabboti evampi paramanipaccakārena paṇipāto daṭṭhabbo.
“Evampi paṇipāto daṭṭhabbo” means that even thus homage should be understood, with extreme prostration.
Evampi paṇipāto daṭṭhabbo (sự đảnh lễ cũng nên được hiểu như vậy) nghĩa là sự đảnh lễ cũng nên được hiểu là sự đảnh lễ với lòng khiêm cung tột độ như vậy.
So panesāti paṇipāto.
“So panesā” refers to homage.
So panesa (Và đây là) sự đảnh lễ.
Ñāti…pe… vasenāti ettha ñātivasena, bhayavasena, ācariyavasena, dakkhiṇeyyavasenāti paccekaṃ yojetabbaṃ dvandaparato suyyamānattā.
In “ñāti…pe… vasenā” (by way of relatives, etc.), it should be construed individually as by way of kinship, by way of fear, by way of a teacher, and by way of being worthy of offerings, because “vasena” is heard after a dvanda compound.
Ñāti… v.v… vasenā (do thân tộc… v.v…): Ở đây, nên kết hợp từng từ riêng lẻ là do thân tộc, do sợ hãi, do thầy, do đáng cúng dường, vì từ “vasena” (do) được nghe sau các cặp từ ghép.
Tattha ñātivasenāti ñātibhāvavasena.
Among these, “ñātivasenā” means by way of kinship.
Trong đó, ñātivasenā (do thân tộc) nghĩa là do trạng thái thân tộc.
Bhāvappadhānaniddeso hi ayaṃ, bhāvalopaniddeso vā tabbhāvasseva adhippetattā.
For this explanation is either a primary exposition of the state (bhāva) or an exposition omitting the word for state, since the state itself is intended.
Đây là một sự trình bày ưu tiên trạng thái, hoặc là một sự trình bày bỏ qua trạng thái, vì chỉ trạng thái đó được ý muốn.
Evaṃ sesesupi paṇipātapadena cetesaṃ sambandho tabbasena paṇipātassa catubbidhattā.
Similarly, in the remaining cases, their connection is with the term “paṇipāta” (homage), because homage is fourfold by that respective way.
Tương tự, trong các trường hợp còn lại, sự kết nối của chúng với từ “paṇipāta” (đảnh lễ) là do sự đảnh lễ có bốn loại tùy theo trạng thái đó.
Tenāha ‘‘dakkhiṇeyyapaṇipātenā’’ti, dakkhiṇeyyatāhetukena paṇipātenevāti attho.
Therefore, he said, “dakkhiṇeyyapaṇipātena” (by homage to one worthy of offerings), meaning by homage motivated by being worthy of offerings.
Vì vậy, ngài nói “dakkhiṇeyyapaṇipātena” (bằng sự đảnh lễ đáng cúng dường), nghĩa là bằng sự đảnh lễ do trạng thái đáng cúng dường.
Itarehīti ñātibhāvādihetukehi paṇipātehi.
“Itarehī” refers to homage motivated by kinship, etc.
Itarehi (bởi những cái khác) nghĩa là bởi những sự đảnh lễ có nguyên nhân là trạng thái thân tộc v.v…
‘‘Seṭṭhavasenevā’’tiādi tassevatthassa samatthanaṃ.
“Seṭṭhavasenevā” (only by way of the best) and so on, is an affirmation of that very meaning.
“Seṭṭhavasenevā” (chỉ do trạng thái tối thượng) v.v… là sự xác nhận cho ý nghĩa đó.
Idāni ‘‘na itarehī’’tiādinā vuttameva atthattayaṃ yathākkamaṃ vitthārato dassetuṃ ‘‘tasmā’’tiādi vuttaṃ.
Now, to elaborate sequentially on the three meanings stated by “na itarehī” (not by others), etc., “tasmā” (therefore) and so on, are mentioned.
Bây giờ, để trình bày chi tiết ba ý nghĩa đã được nói bằng “na itarehi” (không phải bởi những cái khác) v.v… theo thứ tự, “tasmā” (do đó) v.v… được nói.
‘‘Sākiyo vā’’ti pitupakkhato ñātikuladassanaṃ, ‘‘koliyo vā’’ti pana mātupakkhato.
“Sākiyo vā” (or a Sākiyan) indicates the kinship from the father’s side, while “koliyo vā” (or a Koliyan) indicates it from the mother’s side.
“Sākiyo vā” (hoặc là người Sākya) là sự hiển thị dòng họ từ phía cha, còn “koliyo vā” (hoặc là người Koliya) là từ phía mẹ.
Vandatīti paṇipātassa upalakkhaṇavacanaṃ.
“Vandatī” (pays homage) is a term indicative of prostration.
Vandatī (đảnh lễ) là từ chỉ sự đảnh lễ.
Rājapūjitoti rājūhi, rājūnaṃ vā pūjito yathā ‘‘gāmapūjito’’ti.
“Rājapūjito” means honored by kings or honored of kings, similar to “gāmapūjito” (honored by the village).
Rājapūjito (được vua tôn kính) nghĩa là được các vị vua tôn kính, hoặc được tôn kính bởi các vị vua, giống như “gāmapūjito” (được dân làng tôn kính).
Pūjāvacanapayoge hi kattari sāmivacanamicchanti saddavidū.
Indeed, grammarians desire the genitive case for the agent when using verbs of honoring.
Thật vậy, các nhà ngữ pháp mong muốn cách nói sở hữu cách (sāmivacana) ở chủ cách (kattari) khi sử dụng từ “pūjā” (tôn kính).
Bhagavatoti bodhisattabhūtassa, buddhabhūtassa vā bhagavato.
“Bhagavato” means to the Bhagavā (Blessed One) who was a Bodhisatta or who was a Buddha.
Bhagavato (của Đức Thế Tôn) nghĩa là của Đức Thế Tôn khi Ngài là Bồ Tát, hoặc khi Ngài là Phật.
Uggahitanti sikkhitasippaṃ.
“Uggahitaṃ” means learned craft.
Uggahitaṃ (đã học) là nghề đã học.
‘‘Catudhā’’tiādi siṅgālovādasutte (dī. ni. 3.265) gharamāvasanti ghare vasanto, kammappavacanīyayogato cettha bhummatthe upayogavacanaṃ.
“Catudhā” (fourfold), etc., is in the Siṅgālovāda Sutta. “Gharamāvasanti” means dwelling in a house. Here, due to its connection with a kammappavacanīya, the accusative case is used in the sense of the locative.
“Catudhā” (bốn phần) v.v… được nói trong Siṅgālovāda Sutta (Dī. Ni. 3.265). Gharamāvasaṃ (sống trong nhà) nghĩa là người sống trong nhà. Ở đây, do sự kết hợp với kammappavacanīya, từ này mang ý nghĩa của trạng thái địa điểm trong bhummattha.
Kammaṃ payojayeti kasivāṇijjādikammaṃ payojeyya.
“Kammaṃ payojaye” means one should apply oneself to work such as farming and trading.
Kammaṃ payojaye (nên thực hiện công việc) nghĩa là nên thực hiện các công việc như cày cấy, buôn bán v.v…
Kulānañhi na sabbakālaṃ ekasadisaṃ vattati, kadāci rājādivasena āpadāpi uppajjati, tasmā ‘‘āpadāsu uppannāsu bhavissatī’’ti evaṃ manasi katvā nidhāpeyyāti āha ‘‘āpadāsu bhavissatī’’ti.
For families do not always fare the same; sometimes calamities arise due to kings and so on. Therefore, he said, “āpadāsu bhavissati” (it will be for times of distress), meaning one should store up, reflecting, “It will be useful when calamities arise.”
Thật vậy, các gia đình không phải lúc nào cũng duy trì một trạng thái giống nhau; đôi khi tai họa cũng phát sinh do các vị vua v.v… Do đó, ngài nói “āpadāsu bhavissati” (sẽ có trong những lúc hiểm nguy), nghĩa là nên giữ gìn như vậy, nghĩ rằng “nó sẽ hữu ích khi tai họa phát sinh.”
Imesu pana catūsu koṭṭhāsesu ‘‘ekena bhoge bhuñjeyyā’’ti vuttakoṭṭhāsatoyeva gahetvā bhikkhūnampi kapaṇaddhikādīnampi dānaṃ dātabbaṃ, pesakāranhāpitakādīnampi vetanaṃ dātabbanti ayaṃ bhogapariggahaṇānusāsanī, evarūpaṃ anusāsaniṃ uggahetvāti attho.
Among these four portions, taking only the portion stated as “ekena bhoge bhuñjeyyā” (one part for enjoyment), donations should be given to bhikkhus, paupers, travelers, etc., and wages should be paid to servants, barbers, etc. This is an instruction on the management of wealth. This is the meaning, having grasped such an instruction.
Trong bốn phần này, chỉ lấy phần được nói là “ekena bhoge bhuñjeyya” (nên hưởng thụ tài sản bằng một phần), nên bố thí cho các Tỳ-khưu, người nghèo khổ, khách lữ hành v.v… và nên trả lương cho người làm công, thợ cạo v.v… Đây là lời khuyên về việc quản lý tài sản, nghĩa là nên học theo lời khuyên như vậy.
Idañhi diṭṭhadhammikaṃyeva sandhāya vadati, samparāyikaṃ, pana niyyānikaṃ vā anusāsaniṃ paccāsisantopi dakkhiṇeyyapaṇipātameva karoti nāmāti daṭṭhabbaṃ.
Indeed, this refers only to worldly benefit, but it should be understood that even one who hopes for benefit in the next life or for liberation performs homage to one worthy of offerings.
Điều này được nói chỉ liên quan đến lợi ích hiện tại. Tuy nhiên, cần phải hiểu rằng ngay cả người mong cầu lời khuyên về lợi ích đời sau hoặc sự giải thoát cũng thực hiện sự đảnh lễ đáng cúng dường.
‘‘Yo panā’’tiādi ‘‘seṭṭhavaseneva…pe… gaṇhātī’’ti vuttassatthassa vitthāravacanaṃ.
“Yo panā” (but whoever), etc., is an elaborate explanation of the meaning stated as “seṭṭhavaseneva…pe… gaṇhātī” (takes it only by way of the best).
“Yo panā” (Còn người nào) v.v… là lời giải thích chi tiết cho ý nghĩa đã nói là “seṭṭhavaseneva… v.v… gaṇhātī” (chỉ do trạng thái tối thượng… v.v… nhận lấy).
‘‘Eva’’ntiādi pana ‘‘seṭṭhavasena ca bhijjatī’’ti vuttassa byatirekadassanaṃ.
“Evaṃ” (thus), etc., however, shows the contrast to what was stated as “seṭṭhavasena ca bhijjatī” (and it is broken by way of the best).
Còn “Evaṃ” (Như vậy) v.v… là sự hiển thị sự khác biệt của điều đã nói là “seṭṭhavasena ca bhijjatī” (và bị phá vỡ do trạng thái tối thượng).
Atthavasā liṅgavibhattivipariṇāmoti katvā gahitasaraṇāya upāsikāya vātipi yojetabbaṃ.
It should also be construed as referring to a female lay follower (upāsikā) who has taken refuge, considering that gender and case endings change according to the meaning.
Cũng nên kết hợp với “gahitasaraṇāya upāsikāya vā” (hoặc đối với nữ cư sĩ đã thọ Tam quy), coi rằng sự thay đổi về giống và cách là do ý nghĩa.
Evamīdisesu.
Thus, in such cases.
Tương tự trong những trường hợp như vậy.
Pabbajitampīti pi-saddo sambhāvanatthoti vuttaṃ ‘‘pageva apabbajita’’nti.
“Pabbajitampī” (even a renunciant)—the particle “pi” here means commendation, as stated in “pageva apabbajita” (how much more a non-renunciant).
Pabbajitampi (ngay cả người xuất gia): Từ pi (cũng) có nghĩa là sự tán thán, điều này được nói là “pageva apabbajitaṃ” (huống chi người chưa xuất gia).
Saraṇagamanaṃ na bhijjati seṭṭhavasena avanditattā.
“Saraṇagamanaṃ na bhijjati” (the going for refuge is not broken) because it was not done out of reverence for the highest.
Saraṇagamanaṃ na bhijjati (sự quy y không bị phá vỡ) vì không đảnh lễ theo cách tối thượng.
Tathāti anukaḍḍhanatthe nipāto ‘‘saraṇagamanaṃ na bhijjatī’’ti.
“Tathā” (likewise) is a particle in the sense of drawing in, referring to “saraṇagamanaṃ na bhijjatī” (the going for refuge is not broken).
Tathā (Tương tự) là một từ bất biến có nghĩa là sự kéo theo, kéo theo câu “saraṇagamanaṃ na bhijjati” (sự quy y không bị phá vỡ).
Raṭṭhapūjitattāti raṭṭhe, raṭṭhavāsīnaṃ vā pūjitattā.
“Raṭṭhapūjitattā” means being honored in the country, or by the inhabitants of the country.
Raṭṭhapūjitattā (do được quốc gia tôn kính) nghĩa là do được tôn kính trong quốc gia, hoặc do được cư dân quốc gia tôn kính.
Tayidaṃ bhayavasena vanditabbabhāvasseva samatthanaṃ, na tu abhedassa kāraṇadassanaṃ, tassa pana kāraṇaṃ seṭṭhavasena avanditattāti veditabbaṃ.
This serves to confirm that one should pay homage out of fear, and not to show a reason for the non-breaking of refuge. It should be understood that the reason for the non-breaking of refuge is paying homage without seeing it as the highest.
Điều này chỉ là sự xác nhận cho việc nên đảnh lễ do sợ hãi, chứ không phải là sự hiển thị nguyên nhân của sự không phá vỡ. Nguyên nhân của sự không phá vỡ đó cần được hiểu là do không đảnh lễ theo cách tối thượng.
Vuttañhi ‘‘seṭṭhavasena ca bhijjatī’’ti.
For it was stated, “seṭṭhavasena ca bhijjatī” (and it is broken by way of the best).
Thật vậy, đã nói rằng “seṭṭhavasena ca bhijjatī” (và bị phá vỡ do trạng thái tối thượng).
Seṭṭhavasenāti loke aggadakkhiṇeyyatāya seṭṭhabhāvavasenāti attho.
“Seṭṭhavasenā” means by way of the highest, by being the foremost worthy of offerings in the world.
Seṭṭhavasenā (do trạng thái tối thượng) nghĩa là do trạng thái tối thượng là bậc đáng cúng dường cao nhất trên thế gian.
Tenāha ‘‘ayaṃ loke aggadakkhiṇeyyoti vandatī’’ti.
Therefore, it is said, “ayaṃ loke aggadakkhiṇeyyoti vandatī” (one pays homage, thinking, ‘This one is the foremost worthy of offerings in the world’).
Vì vậy, ngài nói “ayaṃ loke aggadakkhiṇeyyoti vandatī” (người ấy đảnh lễ vì* đây là bậc đáng cúng dường cao nhất trên thế gian).
Titthiyampi vandato na bhijjati, pageva itaraṃ.
“Titthiyampi vandato na bhijjati” (even for one who pays homage to a titthiya, it is not broken), how much more for others.
Titthiyampi vandato na bhijjati (đối với người đảnh lễ ngoại đạo cũng không bị phá vỡ), huống chi đối với người khác.
Saraṇagamanappabhedoti saraṇagamanavibhāgo, tabbibhāgasambandhato cettha sakkā abhedopi sukhena dassetunti abhedadassanaṃ kataṃ.
“Saraṇagamanappabhedo” means the classification of going for refuge. Here, because of its connection to that classification, the non-breaking can also be easily shown, hence the demonstration of non-breaking is made.
Saraṇagamanappabhedo (sự phân loại quy y) nghĩa là sự phân chia quy y. Ở đây, sự hiển thị sự không phá vỡ được thực hiện để có thể dễ dàng hiển thị sự không phá vỡ do sự liên quan đến sự phân chia đó.
Ariyamaggo eva lokuttarasaraṇagamananti cattāri sāmaññaphalāni vipākaphalabhāvena vuttāni.
The Noble Path itself is the supramundane going for refuge. Thus, the four fruits of recluseship are spoken of as fruits of result.
Chính Đạo lộ Thánh là sự quy y siêu thế (lokuttara saraṇagamana), do đó bốn quả Sa-môn được nói là trạng thái của quả dị thục.
Sabbadukkhakkhayoti sakalassa vaṭṭadukkhassa anuppādanirodho nibbānaṃ.
“Sabbadukkhakkhayo” means Nibbāna, the cessation without arising of all suffering of saṃsāra.
Sabbadukkhakkhayo (sự diệt tận mọi khổ) là Nibbāna, sự diệt trừ không phát sinh của tất cả khổ luân hồi.
Ettha ca kammasadisaṃ vipākaphalaṃ, tabbiparītaṃ ānisaṃsaphalanti daṭṭhabbaṃ.
Here, the fruit similar to kamma should be understood as vipāka-phala (resultant fruit), and the opposite of that as ānisaṃsa-phala (fruit of benefit).
Ở đây, cần hiểu rằng vipākaphalaṃ (quả dị thục) là quả tương tự như nghiệp, còn ānisaṃsaphalaṃ (quả lợi ích) là quả ngược lại.
Yathā hi sālibījādīnaṃ phalāni taṃsadisāni vipakkāni nāma honti, vipākaniruttiñca labhanti, na mūlaṅkurapattakkhandhanāḷāni, evaṃ kusalākusalānaṃ phalāni arūpadhammabhāvena, sārammaṇabhāvena ca sadisāni vipakkāni nāma honti, vipākaniruttiñca labhanti, na tadaññāni kammanibbattānipi kammaasadisāni, tāni pana ānisaṃsāni nāma honti, ānisaṃsaniruttimattañca labhantīti.
Just as the fruits of rice seeds and so on are called ripened results when they are similar to the seeds, and acquire the term "vipāka" (result), but not the roots, sprouts, leaves, stems, or stalks, so too the fruits of wholesome and unwholesome actions are called ripened results when they are similar by way of being immaterial phenomena and by having the same object, and acquire the term "vipāka," but other kamma-produced results that are not similar to kamma, although kamma-produced, are not called ripened results and do not acquire the term "vipāka." Instead, they are called benefits, and acquire only the term "ānisaṃsa" (benefit).
Giống như quả của hạt lúa v.v… được gọi là dị thục khi chúng tương tự như hạt đó và đạt được danh xưng dị thục, chứ không phải là rễ, mầm, lá, thân cây, cọng, thì tương tự như vậy, quả của nghiệp thiện và bất thiện được gọi là dị thục khi chúng tương tự về trạng thái danh pháp và trạng thái có đối tượng, và đạt được danh xưng dị thục. Còn những quả khác do nghiệp tạo ra nhưng không tương tự như nghiệp thì không đạt được danh xưng dị thục; chúng được gọi là lợi ích (ānisaṃsa) và chỉ đạt được danh xưng lợi ích.
‘‘Vuttañheta’’ntiādinā dhammapade aggidattabrāhmaṇavatthupāḷimāharitvā dasseti.
“Vuttañheta” (for this has been said), etc., cites and presents the Aggidatta Brāhmaṇa story from the Dhammapada.
“Vuttañheta” (Điều này đã được nói) v.v… được trích dẫn từ Aggidattabrāhmaṇavatthupāḷi trong Dhammapada để hiển thị.
Yo cāti ettha ca-saddo byatireke, yo panāti attho.
In " Yo cā," the word " ca" is in the sense of exclusion; the meaning is "who, however."
Trong câu Yo cā, từ ca có nghĩa là 'ngoại trừ', tức là 'yo pana'.
Tatrāyamadhippāyo – byatirekatthadīpane yadi ‘‘bahuṃ ve saraṇaṃ yanti, pabbatāni vanāni cā’’tiādinā (dha. pa. 188) vuttaṃ khemaṃ saraṇaṃ na hoti, na uttamaṃ saraṇaṃ, etañca saraṇamāgamma sabbadukkhā na pamuccati, evaṃ sati kiṃ nāma vatthu khemaṃ saraṇaṃ hoti, uttamaṃ saraṇaṃ, kiṃ nāma vatthuṃ saraṇamāgamma sabbadukkhā pamuccatīti ce?
Herein, this is the intention: If, in illustrating the sense of exclusion, the secure refuge mentioned in the discourse beginning with "Many indeed go for refuge, to mountains and forests" is not a secure refuge, not the ultimate refuge, and by relying on this refuge one is not liberated from all suffering, then what kind of thing is a secure refuge, what is the ultimate refuge, and by relying on what kind of thing is one liberated from all suffering, if it were asked?
Ý nghĩa ở đây là: khi giải thích nghĩa ngoại trừ, nếu sự nương tựa an toàn được nói đến trong câu "Chúng đến nương tựa nhiều, vào núi non, rừng rậm, v.v." không phải là nơi nương tựa an toàn, không phải là nơi nương tựa tối thượng, và nương tựa vào đó mà không thoát khỏi mọi khổ đau, thì vật nào là nơi nương tựa an toàn, nơi nương tựa tối thượng, và nương tựa vào vật nào mà thoát khỏi mọi khổ đau?
Evamīdisesu.
Thus in such cases.
Tương tự như vậy trong những trường hợp này.
Lokiyassa saraṇagamanassa aññatitthiyāvandanādinā kuppanato, calanato ca akuppaṃ acalaṃ lokuttarameva saraṇagamanaṃ pakāsetuṃ ‘‘cattāri ariyasaccāni, sammappaññāya passatī’’ti vuttaṃ.
To proclaim the unshakeable and stable supramundane refuge-taking, due to the worldly refuge-taking being disturbed and shaken by venerating other teachers and so forth, it is said, " sees the four noble truths with right wisdom."
Để làm sáng tỏ rằng chỉ có sự quy y siêu thế mới là bất động, không lay chuyển, vì sự quy y thế gian bị hủy hoại và lay chuyển bởi việc tôn kính các ngoại đạo, v.v., nên đã nói “thấy Tứ Diệu Đế bằng chánh trí tuệ (sammappaññāya)”.
Vācāsiliṭṭhatthañcettha sammāsaddassa rassattaṃ.
And here, the shortening of the vowel in the word sammā is for linguistic smoothness.
Ở đây, việc rút ngắn âm của từ sammā là để làm cho lời nói trôi chảy hơn.
‘‘Dukkha’’ntiādi ‘‘cattāri ariyasaccānī’’ti vuttassa sarūpadassanaṃ.
" Suffering" and so forth is the presentation of the nature of what is stated as "the four noble truths."
“Dukkha” và những từ tiếp theo là sự trình bày bản chất của điều được nói đến là “Tứ Diệu Đế”.
Dukkhassa ca atikkamanti dukkhanirodhaṃ.
" And the transcendence of suffering" means the cessation of suffering.
Dukkhassa ca atikkama có nghĩa là sự diệt khổ (dukkha-nirodha).
Dukkhūpasamagāminanti dukkhanirodhagāmiṃ.
" Leading to the appeasement of suffering" means leading to the cessation of suffering.
Dukkhūpasamagāmina có nghĩa là dẫn đến sự diệt khổ.
‘‘Eta’’nti ‘‘cattāri…pe… passatī’’ti (dha. pa. 190) evaṃ vuttaṃ lokuttarasaraṇagamanasaṅkhātaṃ ariyasaccadassanaṃ.
" This" refers to the vision of the Noble Truths, which is called supramundane refuge-taking, as stated, "the four...pe... sees."
“Eta” (này) là sự thấy Tứ Diệu Đế, tức là sự quy y siêu thế, như đã nói “thấy Tứ Diệu Đế… (dhp. 190)”.
Kho-saddo avadhāraṇattho padattayepi yojetabbo.
The word " kho," meaning certainly, should be connected to all three terms.
Từ kho có nghĩa là khẳng định, nên được áp dụng cho cả ba từ.
Niccato anupagamanādivasenāti ‘‘nicca’’nti aggahaṇādivasena, itinā niddisitabbehi to-saddamicchanti saddavidū.
" By not approaching as permanent, etc." means by not grasping as "permanent," etc. Grammarians desire the suffix "-to" after words that should be indicated with "iti."
Niccato anupagamanādivasenā có nghĩa là không chấp thủ là thường hằng, v.v. Các nhà ngữ pháp muốn từ to được dùng sau các từ được chỉ định bằng iti.
‘‘Vuttañheta’’ntiādinā ñāṇavibhaṅgādīsu (ma. ni. 3.126; a. ni. 1.268) āgataṃ pāḷiṃ sādhakabhāvena āharati.
By starting with " Vuttañheta," the Pāḷi text found in the Ñāṇavibhaṅga, etc., is brought in as evidence.
Với “Vuttañheta” và những từ tiếp theo, văn bản Pāḷi được trích dẫn từ Ñāṇavibhaṅga và các kinh khác (Ma. Ni. 3.126; A. Ni. 1.268) như một bằng chứng.
Aṭṭhānanti janakahetupaṭikkhepo.
" Aṭṭhāna" is the rejection of the generative cause.
Aṭṭhāna là sự bác bỏ nguyên nhân sinh khởi.
Anavakāsoti paccayahetupaṭikkhepo.
" Anavakāso" is the rejection of the causal condition.
Anavakāso là sự bác bỏ nguyên nhân điều kiện.
Ubhayenāpi kāraṇameva paṭikkhipati.
By both, it rejects the cause itself.
Cả hai đều bác bỏ nguyên nhân.
Yanti yena kāraṇena.
" Yaṃ" means by which cause.
Ya có nghĩa là do nguyên nhân nào.
Diṭṭhisampannoti maggadiṭṭhiyā sampanno sotāpanno.
" Diṭṭhisampanno" means a stream-entrant endowed with the path-view.
Diṭṭhisampanno là một vị Nhập Lưu (sotāpanna) đã thành tựu chánh kiến (maggadiṭṭhi).
Kañci saṅkhāranti catubhūmakesu saṅkhatasaṅkhāresu ekampi saṅkhāraṃ.
" Kañci saṅkhāraṃ" means not even one conditioned phenomenon among the conditioned phenomena in the four planes of existence.
Kañci saṅkhāra có nghĩa là dù chỉ một hợp thể (saṅkhāra) trong các hợp thể hữu vi (saṅkhata-saṅkhāra) thuộc bốn cõi.
Niccato upagaccheyyāti ‘‘nicco’’ti gaṇheyya.
" Niccato upagaccheyyā" means would grasp as "permanent."
Niccato upagaccheyyā có nghĩa là chấp thủ là “thường hằng”.
Sukhato upagaccheyyāti ‘‘ekantasukhī attā hoti arogo paraṃ maraṇā’’ti (dī. ni. 1.76) evaṃ attadiṭṭhivasena ‘‘sukho’’ti gaṇheyya, diṭṭhivippayuttacittena pana ariyasāvako pariḷāhavūpasamatthaṃ mattahatthiparittāsito cokkhabrāhmaṇo viya ukkārabhūmiṃ kañci saṅkhāraṃ sukhato upagacchati.
" Sukhato upagaccheyyā" means would grasp as "pleasant" in the sense of self-view, as in "the self is exclusively happy, free from illness after death." However, a noble disciple with a mind dissociated from wrong view approaches any conditioned phenomenon as pleasant for the sake of appeasing affliction, like a pure brāhmaṇa terrified by a maddened elephant approaches a refuse heap.
Sukhato upagaccheyyā có nghĩa là chấp thủ là “lạc” theo tà kiến về tự ngã (attadiṭṭhi), như “tự ngã hoàn toàn an lạc, không bệnh tật sau khi chết”. Tuy nhiên, một Thánh đệ tử (ariyasāvaka) với tâm không bị tà kiến chi phối, chấp thủ bất kỳ hợp thể nào là lạc để làm dịu đi sự nóng bức, giống như một Bà la môn thanh tịnh bị voi điên làm cho sợ hãi trên bãi rác.
Attavāre kasiṇādipaṇṇattisaṅgahaṇatthaṃ ‘‘saṅkhāra’’nti avatvā ‘‘dhamma’’nti vuttaṃ.
In the context of self, to include kasiṇa and other concepts, the word " dhamma" is used instead of "saṅkhāra."
Để bao gồm các khái niệm như kasiṇa trong phần attavāra, thay vì nói “saṅkhāra”, đã nói “dhamma”.
Yathāha parivāre –
As it is said in the Parivāra:
Như đã nói trong Parivāra:
‘‘Mātara’’ntiādīsu janikā mātā, janako pitā, manussabhūto khīṇāsavo arahāti adhippeto.
In " Mātaraṃ" and so forth, the intention is mother as the progenitor, father as the progenitor, and an arahant as a human being who is free from defilements.
Trong “Mātara” và những từ tiếp theo, mātā (mẹ) được hiểu là mẹ ruột, pitā (cha) là cha ruột, arahā là một vị A-la-hán đã đoạn tận các lậu hoặc (khīṇāsava) sống trong cõi người.
Kiṃ pana ariyasāvako tehi aññampi pāṇaṃ jīvitā voropeyyāti?
Would a noble disciple then intentionally kill any other living being besides them?
Vậy Thánh đệ tử có giết hại sinh vật nào khác ngoài những người đó không?
Etampi aṭṭhānameva.
This is also an impossibility.
Điều đó cũng là không thể.
Cakkavattirajjasakajīvitahetupi hi so taṃ jīvitā na voropeyya, tathāpi puthujjanabhāvassa mahāsāvajjatādassanatthaṃ ariyabhāvassa ca balavatāpakāsanatthaṃ evaṃ vuttanti daṭṭhabbaṃ.
For even for the sake of sovereignty over the world or his own life, he would not intentionally kill a living being; nevertheless, it should be understood that this is stated to show the great culpability of being a common person and to strongly proclaim the power of being noble.
Thật vậy, dù vì vương quốc của một Chuyển Luân Vương hay vì mạng sống của chính mình, vị ấy cũng sẽ không tước đoạt mạng sống đó. Tuy nhiên, điều này được nói ra để chỉ ra sự nguy hiểm lớn của trạng thái phàm phu và để làm nổi bật sức mạnh của trạng thái Thánh.
Paduṭṭhacittoti vadhakacittena padūsanacitto, padūsitacitto vā.
" Paduṭṭhacitto" means one whose mind is corrupted with murderous intent, or one whose mind is corrupted.
Paduṭṭhacitto có nghĩa là tâm bị ô nhiễm bởi ý muốn giết hại, hoặc tâm đã bị ô nhiễm.
Lohitaṃ uppādeyyāti jīvamānakasarīre khuddakamakkhikāya pivanamattampi lohitaṃ uppādeyya.
" Lohitaṃ uppādeyyā" means would cause even as much blood to be drawn as a small fly would drink from the living body.
Lohitaṃ uppādeyyā có nghĩa là làm chảy máu dù chỉ một lượng nhỏ như ruồi hút trên thân thể đang sống.
Saṅghaṃ bhindeyyāti samānasaṃvāsakaṃ samānasīmāyaṃ ṭhitaṃ saṅghaṃ pañcahi kāraṇehi bhindeyya, vuttañhetaṃ ‘‘pañcahupāli ākārehi saṅgho bhijjati kammena, uddesena, voharanto, anussāvanena, salākaggāhenā’’ti (pari. 458) aññaṃ satthāranti ito aññaṃ titthakaraṃ ‘‘ayaṃ me satthā’’ti evaṃ gaṇheyya, netaṃ ṭhānaṃ vijjatīti attho.
" Saṅghaṃ bhindeyyā" means would break the Saṅgha residing in the same communion and within the same boundary by five factors, as it is stated: "Upāli, the Saṅgha is broken by five factors: by action, by declaration, by speaking, by giving notice, by taking the voting slips." " Aññaṃ satthāraṃ" means would take another teacher apart from this one, an heretic, as "This is my teacher." This is not possible; such is the meaning.
Saṅghaṃ bhindeyyā có nghĩa là chia rẽ Tăng đoàn đang sống chung trong cùng một giới hạn (sīmā) bằng năm nguyên nhân. Điều này đã được nói: “Này Upāli, Tăng đoàn bị chia rẽ bởi năm cách: bởi hành động (kamma), bởi sự tuyên bố (uddesa), bởi lời nói (vohāra), bởi sự nhắc nhở (anussāvana), và bởi việc lấy phiếu (salākaggāha).” (Pari. 458) Aññaṃ satthāra có nghĩa là chấp nhận một giáo chủ khác ngoài vị này, tức là một ngoại đạo, và nói: “Đây là thầy của tôi.” Điều đó là không thể.
Bhavasampadāti sugatibhavena sampadā, idaṃ vipākaphalaṃ.
" Bhavasampadā" means prosperity with a good destiny. This is the fruit of karma (vipāka-phala).
Bhavasampadā là sự thành tựu về cõi sống tốt đẹp (sugati-bhava); đây là quả dị thục (vipāka-phala).
Bhogasampadāti manussabhogadevabhogehi sampadā, idaṃ pana ānisaṃsaphalaṃ.
" Bhogasampadā" means prosperity with human enjoyments and divine enjoyments. This, however, is the fruit of advantage (ānisaṃsa-phala).
Bhogasampadā là sự thành tựu về tài sản của loài người và tài sản của chư thiên; đây là quả lợi ích (ānisaṃsa-phala).
‘‘Vuttañheta’’ntiādinā devatāsaṃyuttādipāḷiṃ (saṃ. ni. 1.37) sādhakabhāvena dasseti.
By " Vuttañheta" and so forth, the Pāḷi from the Devatāsaṃyutta, etc., is presented as evidence.
Với “Vuttañheta” và những từ tiếp theo, văn bản Pāḷi từ Devatāsaṃyutta và các kinh khác (Saṃ. Ni. 1.37) được trình bày như một bằng chứng.
‘‘Aparampī’’tiādinā saḷāyatanavagge moggallānasaṃyutte (saṃ. ni. 4.341) āgataṃ aññampi phalamāha, aparampi phalaṃ mahāmoggallānattherena vuttanti attho.
By " Aparampī" and so forth, another result mentioned in the Moggallānasaṃyutta of the Saḷāyatana Vagga is stated; the meaning is that another result was stated by the Elder Mahāmoggallāna.
Với “Aparampī” và những từ tiếp theo, một kết quả khác được nói đến trong Moggallānasaṃyutta thuộc Saḷāyatanavagga (Saṃ. Ni. 4.341), có nghĩa là một kết quả khác đã được Đại Trưởng lão Moggallāna nói đến.
Aññe deveti asaraṇaṅgate deve.
" Aññe deve" means devas who have not gone for refuge.
Aññe deve có nghĩa là các vị thiên không quy y.
Dasahi ṭhānehīti dasahi kāraṇehi.
" Dasahi ṭhānehi" means by ten reasons.
Dasahi ṭhānehī có nghĩa là bằng mười lý do.
‘‘Dibbenā’’tiādi tassarūpadassanaṃ.
" Dibbenā" and so forth is the description of its nature.
“Dibbenā” và những từ tiếp theo là sự trình bày bản chất của điều đó.
Adhigaṇhantīti abhibhavanti atikkamitvā tiṭṭhanti.
" Adhigaṇhanti" means they overpower, they surpass and stand superior.
Adhigaṇhantī có nghĩa là vượt trội, vượt qua và đứng vững.
‘‘Esa nayo’’ti iminā ‘‘sādhu kho devānaminda dhammasaraṇagamanaṃ hotī’’ti (saṃ. ni. 4.341) suttapadaṃ atidisati.
" Esa nayo" extends the suttapada "It is good, king of devas, to go for refuge in the Dhamma" in this manner.
“Esa nayo” chỉ đến câu kinh “Này Thiên chủ, sự quy y Pháp thật là tốt lành.” (Saṃ. Ni. 4.341).
Velāmasuttaṃ nāma aṅguttaranikāye navanipāte jātigottarūpabhogasaddhāpaññādīhi mariyādavelātikkantehi uḷārehi guṇehi samannāgatattā velāmanāmakassa bodhisattabhūtassa caturāsītisahassarājūnaṃ ācariyabrāhmaṇassa dānakathāpaṭisaññuttaṃ suttaṃ (a. ni. 9.20) tattha hi karīsassa catutthabhāgappamāṇānaṃ caturāsītisahassasaṅkhyānaṃ suvaṇṇapātirūpiyapātikaṃsapātīnaṃ yathākkamaṃ rūpiyasuvaṇṇa hiraññapūrānaṃ, sabbālaṅkārapaṭimaṇḍitānaṃ, caturāsītiyā hatthisahassānaṃ caturāsītiyā assasahassānaṃ, caturāsītiyā rathasahassānaṃ, caturāsītiyā dhenusahassānaṃ, caturāsītiyā kaññāsahassānaṃ, caturāsītiyā pallaṅkasahassānaṃ, caturāsītiyā vatthakoṭisahassānaṃ, aparimāṇassa ca khajjabhojjādibhedassa āhārassa pariccajanavasena sattamāsādhikāni sattasaṃvaccharāni nirantaraṃ pavattavelāmamahādānato ekassa sotāpannassa dinnadānaṃ mahapphalataraṃ, tato sataṃsotāpannānaṃ dinnadānato ekassa sakadāgāmino, tato ekassa anāgāmino, tato ekassa arahato, tato ekassa paccekabuddhassa, tato sammāsambuddhassa, tato buddhappamukhassa saṅghassa dinnadānaṃ mahapphalataraṃ, tato cātuddisaṃ saṅghaṃ uddissa vihārakaraṇaṃ, tato saraṇagamanaṃ mahapphalataranti ayamattho pakāsito.
The Velāma Sutta is in the Ninth Nipāta of the Aṅguttara Nikāya. It is a sutta related to the discourse on giving by the brāhmaṇa named Velāma, who was a Bodhisatta and a teacher of eighty-four thousand kings, and who was endowed with noble virtues that surpassed all bounds of birth, clan, beauty, wealth, faith, and wisdom. In that sutta, it is revealed that a gift given to one Sotāpanna is greatly more fruitful than the Velāma's great offering, which continuously took place for seven years and seven months, consisting of eighty-four thousand gold, silver, and bronze bowls each measuring a quarter of a karīsa and filled respectively with silver, gold, and precious gems; eighty-four thousand elephants adorned with all ornaments; eighty-four thousand horses; eighty-four thousand chariots; eighty-four thousand milch cows; eighty-four thousand maidens; eighty-four thousand couches; eighty-four thousand crores of cloths; and an immeasurable quantity of food, solid and soft, and other edibles. More fruitful than a gift to one hundred Sotāpannas is a gift to one Sakadāgāmin; more fruitful than that is a gift to one Anāgāmin; more fruitful than that is a gift to one Arahant; more fruitful than that is a gift to one Paccekabuddha; more fruitful than that is a gift to a Sammāsambuddha; more fruitful than that is a gift to the Saṅgha led by the Buddha; more fruitful than that is the construction of a monastery dedicated to the Saṅgha of the four directions; and more fruitful than that is taking refuge (saraṇagamana). This meaning is expounded.
Velāmasuttaṃ (Kinh Velāma) là một bài kinh liên quan đến câu chuyện bố thí của vị Bà-la-môn tên Velāma, một vị Bồ-tát, người thầy của tám vạn bốn ngàn vị vua, người có những phẩm chất cao quý vượt qua giới hạn về chủng tộc, dòng dõi, hình tướng, tài sản, đức tin, trí tuệ, v.v., được tìm thấy trong Tạng Tăng Chi Bộ, Cửu Tập. Trong kinh này, ý nghĩa được tuyên bố là: sự bố thí cho một vị Nhập Lưu có quả báo lớn hơn đại bố thí Velāma, được thực hiện liên tục trong bảy năm và bảy tháng, trong đó có sự cúng dường tám vạn bốn ngàn bát vàng, bát bạc, bát đồng, mỗi bát chứa đầy bạc, vàng, châu báu; tám vạn bốn ngàn con voi được trang sức đầy đủ; tám vạn bốn ngàn con ngựa; tám vạn bốn ngàn cỗ xe; tám vạn bốn ngàn con bò cái vắt sữa; tám vạn bốn ngàn trinh nữ; tám vạn bốn ngàn chiếc giường; tám vạn bốn ngàn vạn y phục; và vô số thức ăn, đồ uống, v.v. Bố thí cho một vị Nhất Lai có quả báo lớn hơn bố thí cho một trăm vị Nhập Lưu; bố thí cho một vị Bất Lai có quả báo lớn hơn; bố thí cho một vị A-la-hán có quả báo lớn hơn; bố thí cho một vị Độc Giác Phật có quả báo lớn hơn; bố thí cho một vị Chánh Đẳng Giác có quả báo lớn hơn; bố thí cho Tăng đoàn có Đức Phật dẫn đầu có quả báo lớn hơn; và việc xây dựng tinh xá dâng cúng Tăng đoàn bốn phương có quả báo lớn hơn; việc quy y có quả báo lớn hơn.
Vuttañhetaṃ –
And this has been said:
Điều này đã được nói đến:
Iminā ca ukkaṭṭhaparicchedato lokuttarasseva saraṇagamanassa phalaṃ dassitanti veditabbaṃ.
It should be understood that by this highest classification, the fruit of only the supramundane (lokuttara) taking of refuge is shown.
Và cần phải biết rằng, bằng cách này, quả báo của sự quy y siêu thế đã được chỉ ra ở mức độ tối thượng.
Tathā hi velāmasuttaṭṭhakathāyaṃ vuttaṃ ‘‘saraṇaṃ gaccheyyāti ettha maggenāgataṃ anivattanasaraṇaṃ adhippetaṃ, apare panāhu ‘attānaṃ niyyātetvā dinnattā saraṇagamanaṃ tato mahapphalatara’nti vutta’’nti (a. ni. aṭṭha. 3.9.20) kūṭadantasuttaṭṭhakathāyaṃ pana vakkhati ‘‘yasmā ca saraṇagamanaṃ nāma tiṇṇaṃ ratanānaṃ jīvitapariccāgamayaṃ puññakammaṃ saggasampattiṃ deti, tasmā mahapphalatarañca mahānisaṃsatarañcāti veditabba’’nti (dī. ni. aṭṭha. 1.350, 351) iminā pana nayena lokiyassāpi saraṇagamanassa phalaṃ idha dassitamevāti gahetabbaṃ.
Thus, it is stated in the Velāma Sutta Aṭṭhakathā: "In 'should take refuge,' the unretrogressive taking of refuge, attained by the path, is intended. Others, however, say, 'taking refuge is more fruitful because it is given by entrusting oneself.'" In the Kūṭadanta Sutta Aṭṭhakathā, it will be said: "Because taking refuge is a meritorious act involving the sacrifice of one's life to the Three Jewels, it bestows heavenly prosperity; therefore, it should be understood as greatly more fruitful and greatly more advantageous." By this method, it should be understood that the fruit of even mundane (lokiya) taking of refuge is shown here.
Thật vậy, trong Chú giải Velāmasuttaṃ có nói: “Ở đây, ‘nên quy y’ có nghĩa là sự quy y bất thoái chuyển đạt được bằng Đạo. Những người khác nói rằng: ‘Việc quy y có quả báo lớn hơn vì đã hiến dâng chính mình’.” Tuy nhiên, trong Chú giải Kūṭadantasuttaṃ sẽ nói: “Vì sự quy y, tức là hành động thiện nghiệp hiến dâng sinh mạng cho Ba Ngôi Báu, mang lại sự an lạc của cõi trời, nên cần phải biết rằng nó có quả báo lớn hơn và lợi ích lớn hơn.” Với cách giải thích này, cần phải hiểu rằng quả báo của sự quy y thế gian cũng đã được chỉ ra ở đây.
Ācariyadhammapālattherenapi (dī. ni. ṭī. 1.250) hi ayamevattho icchitoti viññāyati idha ceva aññāsu ca majjhimāgamaṭīkādīsu avisesatoyeva vuttattā, ācariyasāriputtattherenāpi ayamattho abhimato siyā sāratthadīpaniyaṃ, (sārattha. ṭī. verañjakaaṇḍavaṇṇanā.15) aṅguttaraṭīkāyañca tadubhayasādhāraṇavacanato.
It is understood that this very meaning is desired by Ācariya Dhammapāla Thera too, as it is stated unreservedly here and in other works such as the Majjhimāgama Ṭīkā. Ācariya Sāriputta Thera might also agree with this meaning due to the common expression found in the Sāratthadīpanī and the Aṅguttara Ṭīkā.
Cũng được biết rằng, ý nghĩa này được tôn giả Ācariya Dhammapāla chấp thuận, vì nó được nói đến một cách không phân biệt ở đây và trong các bộ Chú giải Trung Bộ (Majjhimāgamaṭīkā) khác. Tôn giả Ācariya Sāriputta cũng có thể đồng tình với ý nghĩa này, vì có những lời nói chung cho cả hai trong Sāratthadīpanī và Chú giải Tăng Chi Bộ (Aṅguttaraṭīkā).
Apare pana vadanti ‘‘kūṭadantasuttaṭṭhakathāyampi (dī. ni. ṭī. 1.249) lokuttarasseva saraṇagamanassa phalaṃ vutta’’nti, tadayuttameva tathā avuttattā.
Others, however, say that "the fruit of only the supramundane taking of refuge is stated even in the Kūṭadanta Sutta Aṭṭhakathā," but that is inappropriate, as it is not stated as such.
Tuy nhiên, những người khác nói rằng: “Ngay cả trong Chú giải Kūṭadantasuttaṃ, quả báo của sự quy y siêu thế cũng đã được nói đến,” nhưng điều đó không đúng vì nó không được nói như vậy.
‘‘Yasmā…pe… detī’’ti hi tadubhayasādhāraṇakāraṇavasena tadubhayassāpi phalaṃ tattha vuttanti.
Indeed, "Because... it bestows..." states the fruit of both (mundane and supramundane) by way of a common reason for both.
Thật vậy, “yasmā…pe… detī” (vì…v.v… ban cho) là lời nói chỉ ra quả báo của cả hai (quy y thế gian và siêu thế) dựa trên lý do chung cho cả hai.
Velāmasuttādīnanti ettha ādisaddena (a. ni. 4.34; itivu. 90) aggappasādasuttachattamāṇavakavimānādīnaṃ (vi. va. 886 ādayo) saṅgaho daṭṭhabbo.
In "Velāma Sutta and so on," the term "and so on" should be understood to include the Aggappasāda Sutta and the Chāttamāṇavaka Vimāna, etc.
Ở đây, trong Velāmasuttādīnaṃ, với từ ādi (v.v.), cần hiểu là bao gồm các kinh như Aggappasādasuttaṃ và các thiên cung như Chattamāṇavakavimānaṃ.
Aññāṇaṃ nāma vatthuttayassa guṇānamajānanaṃ tattha sammoho.
Aññāṇa (ignorance) is not knowing the virtues of the Three Jewels, confusion regarding them.
Aññāṇaṃ (vô minh) là không biết các phẩm chất của Ba Ngôi Báu, tức là sự mê muội trong đó.
Saṃsayo nāma ‘‘buddho nu kho, na nu kho’’tiādinā (dī. ni. aṭṭha. 2.216) vicikicchā.
Saṃsayo (doubt) is vacillation, such as "Is he a Buddha, or not a Buddha?"
Saṃsayo (nghi ngờ) là sự hoài nghi như “có phải là Phật không, hay không phải là Phật?” v.v.
Micchāñāṇaṃ nāma vatthuttayassa guṇānaṃ aguṇabhāvaparikappanena viparītaggāho.
Micchāñāṇa (wrong knowledge) is wrong apprehension by conceiving the virtues of the Three Jewels to be non-virtues.
Micchāñāṇaṃ (tà kiến) là sự chấp thủ sai lầm bằng cách cho rằng các phẩm chất của Ba Ngôi Báu là không có phẩm chất.
Ādisaddena anādarāgāravādīnaṃ saṅgaho.
The word "ādi" (etc.) includes disrespect and irreverence.
Từ ādi (v.v.) bao gồm sự thiếu tôn trọng, thiếu kính trọng, v.v.
Saṃkilissatīti saṃkiliṭṭhaṃ malīnaṃ bhavati.
Saṃkilissatī means it becomes defiled and polluted.
Saṃkilissatīti (bị ô nhiễm) có nghĩa là trở nên ô uế, dơ bẩn.
Na mahājutikantiādipi saṃkilesapariyāyo eva.
" Na mahājutikaṃ" (not greatly luminous) and so on are also synonyms for defilement.
Cụm từ Na mahājutikaṃ v.v. cũng là một từ đồng nghĩa với sự ô nhiễm.
Tattha na mahājutikanti na mahujjalaṃ, aparisuddhaṃ apariyodātanti attho.
In that context, " na mahājutikaṃ" means not greatly brilliant, impure, or not thoroughly purified.
Ở đây, na mahājutikaṃ có nghĩa là không rực rỡ, không thanh tịnh, không trong sạch.
Na mahāvipphāranti na mahānubhāvaṃ, apaṇītaṃ anuḷāranti attho.
" Na mahāvipphāraṃ" means not of great power, not excellent, not noble.
Na mahāvipphāraṃ có nghĩa là không có oai lực lớn, không cao quý, không vĩ đại.
Sāvajjoti taṇhādiṭṭhādivasena sadoso.
Sāvajjo (blameworthy) means faulty due to craving, wrong view, and so on.
Sāvajjo (có lỗi) có nghĩa là có khuyết điểm do tham ái, tà kiến, v.v.
Tadeva phalavasena vibhāvetuṃ ‘‘aniṭṭhaphalo’’ti vuttaṃ, sāvajjattā akantiphalo hotīti attho.
To elaborate on that very fault in terms of its result, it is said " aniṭṭhaphalo" (having an undesirable result), meaning it has an unpleasing result due to being blameworthy.
Để giải thích điều đó theo khía cạnh quả báo, đã nói “aniṭṭhaphalo” (quả không mong muốn), có nghĩa là vì có lỗi nên quả báo không được ưa thích.
Lokiyasaraṇagamanaṃ sikkhāsamādānaṃ viya agahitakālaparicchedaṃ jīvitapariyantameva hoti, tasmā tassa khandhabhedena bhedo, so ca taṇhādiṭṭhādivirahitattā adosoti āha ‘‘anavajjo kālakiriyāya hotī’’ti.
Mundane taking of refuge, like undertaking precepts, has no set time limit but is for the duration of one's life. Therefore, it is broken by the dissolution of the aggregates. That dissolution is without fault, being free from craving, wrong view, and so on. Therefore, it is said, " anavajjo kālakiriyāya hoti" (it is faultless at the time of death).
Sự quy y thế gian, giống như việc thọ trì giới, không có giới hạn thời gian cố định mà chỉ kéo dài đến cuối cuộc đời. Do đó, sự phá vỡ của nó là do sự tan rã của thân thể, và sự phá vỡ đó không có lỗi vì không có tham ái, tà kiến, v.v. Vì vậy, đã nói “anavajjo kālakiriyāya hotī” (không có lỗi khi chết).
Soti anavajjo saraṇagamanabhedo.
" So" (that) refers to the faultless breaking of the taking of refuge.
So (nó) là sự phá vỡ của quy y không có lỗi.
Satipi anavajjatte iṭṭhaphalopi na hoti, pageva aniṭṭhaphalo avipākattā.
Even though it is faultless, it does not lead to a desirable result, let alone an undesirable result, because it is devoid of Kamma-result (vipāka).
Dù không có lỗi, nó cũng không mang lại quả báo mong muốn, huống chi là quả báo không mong muốn, vì nó không có quả báo.
Na hi taṃ akusalaṃ hoti, atha kho bhedanamattanti adhippāyo.
Indeed, it is not unwholesome, but merely a breaking. This is the intention.
Ý nghĩa là nó không phải là bất thiện, mà chỉ là sự phá vỡ.
Bhavantarepīti aññasmimpi bhave.
" Bhavantarepi" means in another existence.
Bhavantarepī (ngay cả trong kiếp khác) có nghĩa là trong một kiếp khác.
Dharasaddassa dvikammikattā ‘‘upāsaka’’nti idampi kammameva, tañca kho ākāraṭṭhāneti atthamattaṃ dassetuṃ ‘‘upāsako ayanti evaṃ dhāretū’’ti vuttaṃ.
Because the word "dhara" is ditransitive, "upāsakaṃ" is also an object (kamma). To show merely that it is in the position of a manner (ākāra), it is said, " upāsako ayaṃti evaṃ dhāretū" (Let him hold that 'this is a lay follower').
Vì từ dhara là một động từ hai tân ngữ, nên “upāsakaṃ” (cư sĩ) cũng là một tân ngữ. Và để chỉ ra ý nghĩa rằng nó ở vị trí của một trạng thái, đã nói “upāsako ayaṃti evaṃ dhāretū” (hãy giữ rằng người này là một cư sĩ).
Dhāretūti ca upadhāretūti attho.
And " dhāretū" means "may he bear in mind."
Và dhāretū có nghĩa là upadhāretū (hãy ghi nhớ).
Upadhāraṇañcettha jānanamevāti dasseti ‘‘jānātū’’ti iminā.
And here, bearing in mind is simply knowing, as shown by " jānātū" (may he know).
Và ở đây, sự ghi nhớ có nghĩa là sự hiểu biết, điều này được chỉ ra bằng “jānātū” (hãy biết).
Upāsakavidhikosallatthanti upāsakabhāvavidhānakosallatthaṃ.
" Upāsakavidhikosallatthaṃ" means for the sake of skill in the definition of a lay follower.
Upāsakavidhikosallatthaṃ có nghĩa là để thành thạo trong việc quy định trạng thái của một cư sĩ.
Ko upāsakoti sarūpapucchā, kiṃ lakkhaṇo upāsako nāmāti vuttaṃ hoti.
" Ko upāsako" (Who is a lay follower?) is a question about its nature. It means, "What is the characteristic of a lay follower?"
Ko upāsako (ai là cư sĩ?) là một câu hỏi về bản chất, có nghĩa là một cư sĩ có đặc điểm gì?
Kasmāti hetupucchā, kena pavattinimittena upāsakasaddo tasmiṃ puggale niruḷhoti adhippāyo.
" Kasmā" (Why?) is a question about the cause. The intention is, "By what causal designation does the term 'upāsaka' become established in that individual?"
Kasmā (tại sao?) là một câu hỏi về nguyên nhân, có nghĩa là do nhân duyên nào mà từ cư sĩ được gắn cho người đó?
Tenāha ‘‘kasmā upāsakoti vuccatī’’ti.
Therefore, it is said, " kasmā upāsako ti vuccati" (Why is he called a lay follower?).
Vì vậy, đã nói “kasmā upāsakoti vuccatī” (tại sao gọi là cư sĩ?).
Saddassa hi abhidheyye pavattinimittameva tadatthassa tabbhāvakāraṇaṃ.
Indeed, the causal designation (pavattinimitta) of a word, in referring to its object, is the cause of that meaning's existence.
Thật vậy, đối với một từ, nhân duyên phát sinh của từ đó chính là nguyên nhân của trạng thái đó đối với ý nghĩa của từ đó.
Kimassa sīlanti vatasamādānapucchā, kīdisaṃ assa upāsakassa sīlaṃ, kittakena vatasamādānenāyaṃ sīlasampanno nāma hotīti attho.
" Kimassa sīlaṃ" (What is his virtue?) is a question about the undertaking of a vow. It means, "What kind of virtue does this lay follower possess? By what extent of undertaking a vow is he called virtuous?"
Kimassa sīlaṃ (giới của người đó là gì?) là một câu hỏi về sự thọ trì giới, có nghĩa là giới của cư sĩ đó là gì, người này được gọi là người đầy đủ giới hạnh bằng cách thọ trì giới như thế nào?
Ko ājīvoti kammasamādānapucchā, ko assa sammāājīvo, kena kammasamādānena assa ājīvo sambhavatīti pucchati, so pana micchājīvassa parivajjanena hotīti micchājīvopi vibhajīyati.
" Ko ājīvo" (What is his livelihood?) is a question about the undertaking of Kamma. It asks, "What is his right livelihood? By what undertaking of Kamma does his livelihood come about?" That (right livelihood) occurs by avoiding wrong livelihood; hence, wrong livelihood is also distinguished.
Ko ājīvo (sinh kế là gì?) là một câu hỏi về sự thọ trì nghiệp, có nghĩa là sinh kế chân chính của người đó là gì, sinh kế của người đó được tạo ra bằng cách thọ trì nghiệp nào? Và sinh kế đó được tạo ra bằng cách tránh tà mạng, vì vậy tà mạng cũng được phân tích.
Kā vipattīti tadubhayesaṃ vippaṭipattipucchā, kā assa upāsakassa sīlassa, ājīvassa ca vipattīti attho.
" Kā vipattī" (What is the downfall?) is a question about the deviation of both. It means, "What is the downfall of this lay follower's virtue and livelihood?"
Kā vipattī (sự suy thoái là gì?) là một câu hỏi về sự sai lầm của cả hai, có nghĩa là sự suy thoái về giới hạnh và sinh kế của cư sĩ đó là gì?
Sāmaññaniddiṭṭhe hi sati anantarasseva vidhi vā paṭisedho vāti anantarassa gahaṇaṃ.
For, when something is generally indicated, what is immediately proximate is taken, whether it be an injunction or a prohibition. Therefore, "anantarassa" here refers to the proximate undertaking of virtue and livelihood. (This sentence structure suggests the meaning of the nissaya for this line is more an explanation of the previous one.)
Thật vậy, khi có sự chỉ định chung, thì sự chấp nhận của điều liền kề là một quy tắc hay một sự cấm đoán.
Kā sampattīti tadubhayesameva sammāpaṭipattipucchā, kā assa upāsakassa sīlassa, ājīvassa ca sampattīti vuttanayena attho.
“ What is accomplishment?” This is a question concerning the right practice of both (sīla and livelihood). The meaning, as stated, is: “What is the accomplishment of this lay follower’s morality (sīla) and livelihood (ājīva)?”
Sự thành tựu là gì (Kā sampattī)? Đó là câu hỏi về sự thực hành đúng đắn của cả hai điều đó, nghĩa là: "Sự thành tựu về giới và sinh kế của vị cận sự nam này là gì?" theo cách đã nói.
Sarūpavacanatthādisaṅkhātena pakārena kiratīti pakiṇṇaṃ, tadeva pakiṇṇakaṃ, anekākārena pavattaṃ atthavinicchayanti attho.
“ Pakiṇṇaṃ (miscellaneous)” means that which explains by way of its nature, etymology, meaning, and so on. That itself is pakiṇṇakaṃ (miscellany); the meaning is the determination of meaning that arises in various ways.
Điều được quy định theo cách thức được gọi là bản chất, ý nghĩa từ ngữ, v.v., đó là pakiṇṇaṃ, chính điều đó là pakiṇṇakaṃ, nghĩa là sự xác định ý nghĩa diễn ra theo nhiều phương diện.
Yo kocīti khattiyabrāhmaṇādīsu yo koci, iminā padena akāraṇamettha jātiādivisesoti dasseti, ‘‘saraṇagato’’ti iminā pana saraṇagamanamevettha pamāṇanti.
“ Whoever” indicates that among khattiyas, brahmins, and others, whoever it may be, this word shows that lineage and other distinctions are not a cause here. The word “ saraṇagato (gone for refuge),” on the other hand, indicates that taking refuge is the standard here.
Bất cứ ai (Yo koci): Bất cứ ai trong các giai cấp Sát-đế-lợi, Bà-la-môn, v.v. Bằng từ này, cho thấy rằng sự phân biệt về giai cấp, v.v., không phải là nguyên nhân ở đây; còn bằng từ "đã quy y (saraṇagato)", cho thấy sự quy y là tiêu chuẩn ở đây.
‘‘Gahaṭṭho’’ti ca iminā āgārikesveva upāsakasaddo niruḷho, na pabbajjūpagatesūti.
And the word “ gahaṭṭho (householder)” indicates that the term upāsaka is established specifically for those living at home, not for those who have gone forth into homelessness.
Và bằng từ "gia chủ (gahaṭṭho)", cho thấy rằng từ "cận sự nam (upāsaka)" chỉ được dùng cho những người tại gia, chứ không phải cho những người đã xuất gia.
Tamatthaṃ mahāvaggasaṃyutte mahānāmasuttena (saṃ. ni. 5.1033) sādhento ‘‘vuttañheta’’ntiādimāha.
To establish that meaning, the teacher states, “ This has been said,” and so on, citing the Mahānāma Sutta in the Mahāvagga Saṃyutta.
Để chứng minh ý nghĩa đó, Ngài đã nói "Điều này đã được nói" và tiếp theo trong Kinh Mahānāma (Saṃyutta Nikāya 5.1033) thuộc Mahāvagga Saṃyutta.
Tattha yatoti buddhādisaraṇagamanato.
There, “ yato (from which)” means from taking refuge in the Buddha and others.
Ở đó, "từ đó (yato)" có nghĩa là từ sự quy y Phật, v.v.
Mahānāmāti attano cūḷapituno sukkodanassa puttaṃ mahānāmaṃ nāma sakyarājānaṃ bhagavā ālapati.
“ Mahānāmā” refers to the Buddha addressing Mahānāma, the Sakyan king, who was the son of his paternal uncle Sukkodana.
Mahānāma, Đức Thế Tôn gọi vua Sakya tên Mahānāma, con trai của chú Ngài là Sukkodana.
Ettāvatāti ettakena buddhādisaraṇagamanena upāsako nāma hoti, na jātiādīhi kāraṇehīti adhippāyo.
“ Ettāvatā (by this much)” means that by this much—by taking refuge in the Buddha and others—one is called an upāsaka, and not by reasons such as birth and so on. This is the intention.
Đến mức này (Ettāvatā): Ý nghĩa là, chỉ với sự quy y Phật, v.v., đến mức này, người đó được gọi là cận sự nam, chứ không phải vì các lý do như giai cấp, v.v.
Kāmañca tapussabhallikānaṃ viya dvevācikaupāsakabhāvopi atthi, so pana tadā vatthuttayābhāvato kadāciyeva hotīti sabbadā pavattaṃ tevācikaupāsakabhāvaṃ dassetuṃ ‘‘saraṇagato’’ti vuttaṃ.
Although there is also the state of being a two-spoked (dvevācika) upāsaka, like Tapussa and Bhallika, that occurs only occasionally due to the absence of the Triple Gem at that time. Therefore, the word “saraṇagato” is used to indicate the always-present state of being a three-spoked (tevācika) upāsaka.
Mặc dù cũng có trường hợp là cận sự nam nhị ngữ (dvevācika upāsaka), như trường hợp của Tapussa và Bhallika, nhưng điều đó chỉ xảy ra đôi khi vì lúc đó chưa có Tam Bảo; do đó, để chỉ ra trạng thái cận sự nam tam ngữ (tevācika upāsaka) thường xuyên, từ "đã quy y" được nói đến.
Tepi hi pacchā tisaraṇagatā eva, na cettha sambhavati aññaṃ paṭikkhipitvā ekaṃ vā dve vā saraṇagato upāsako nāmāti imamatthampi ñāpetuṃ evaṃ vuttanti daṭṭhabbaṃ.
For they too later took refuge in the Triple Gem. And it should be understood that this was said to make known that taking refuge in one or two of the refuges, while rejecting the others, does not constitute an upāsaka.
Cũng cần phải hiểu rằng, họ cũng là những người đã quy y Tam Bảo sau này, và từ này được nói để cho biết rằng không thể có một cận sự nam đã quy y một hoặc hai nơi nương tựa mà lại từ bỏ những nơi khác.
Veramaṇiyoti ettha veraṃ vuccati pāṇātipātādidussīlyaṃ, tassa maṇanato hananato vināsanato veramaṇiyo nāma, pañca viratiyo viratipadhānattā tassa sīlassa.
In “ veramaṇiyo (abstentions),” “vera” means the unwholesome conduct (dussīlya) of taking life, etc. Because they suppress, destroy, and eliminate that unwholesomeness, they are called abstentions. These are the five abstentions, because of the predominance of abstention in this sīla.
Ở đây, sự kiêng cữ (veramaṇiyo) được gọi là sự bất thiện như sát sinh, v.v. Vì nó ngăn chặn, tiêu diệt, phá hủy những điều bất thiện đó, nên được gọi là kiêng cữ. Đó là năm sự kiêng cữ, vì giới đó chủ yếu là sự kiêng cữ.
Tathā hi udāhaṭe mahānāmasutte vuttaṃ ‘‘pāṇātipātā paṭivirato hotī’’tiādi (saṃ. ni. 5.1033) ‘‘yathāhā’’tiādinā sādhakaṃ, sarūpañca dasseti yathā taṃ uyyānapālassa ekeneva udakapatiṭṭhānapayogena ambasecanaṃ, garusinānañca.
Thus, it is stated in the Mahānāma Sutta cited, “He abstains from taking life,” and so on. This statement, “ as it has been said,” and so on, provides confirmation and illustrates its nature, just as the watering of a mango tree and the bathing of the teacher by a single act of establishing water by the gardener.
Như đã nói trong Kinh Mahānāma đã dẫn: "Người ấy kiêng cữ sát sinh" và tiếp theo (Saṃyutta Nikāya 5.1033). Bằng cách nói "như đã nói" và tiếp theo, Ngài chứng minh và chỉ ra bản chất, giống như việc người giữ vườn tưới cây xoài và tắm cho vị thầy chỉ bằng một lần dùng nước.
Yathāha ambavimāne (vi. va. 1151 ādayo) –
As it is said in the Ambavimāna:
Như đã nói trong Ambavimāna (Vimānavatthu 1151 và tiếp theo) –
Micchāvaṇijjāti ayuttavaṇijjā, na sammāvaṇijjā, asāruppavaṇijjakammānīti attho.
“ Micchāvaṇijjā (wrong livelihood)” means improper trades, not right livelihood, but wrongful trading activities.
Buôn bán tà mạng (Micchāvaṇijjā): Là buôn bán không đúng đắn, không phải buôn bán chân chánh, nghĩa là các hành vi buôn bán không phù hợp.
Pahāyāti akaraṇeneva pajahitvā.
“ Pahāya (having abandoned)” means having abandoned by not doing them at all.
Từ bỏ (Pahāyā): Từ bỏ bằng cách không thực hiện.
Dhammenāti dhammato anapetena, tena micchāvaṇijjakammena ājīvanato aññampi adhammikaṃ ājīvanaṃ paṭikkhipati.
“ Dhammenā (righteously)” means not departing from the Dhamma. By this, it rejects other unrighteous livelihoods besides living by such wrongful trading activities.
Theo Pháp (Dhammenā): Không lìa Pháp. Bằng từ đó, Ngài từ chối cả những sinh kế bất thiện khác ngoài việc kiếm sống bằng các hành vi buôn bán tà mạng.
Samenāti avisamena, tena kāyavisamādiduccaritaṃ vajjetvā kāyasamādinā sucaritena ājīvanaṃ dasseti.
“ Samenā (equitably)” means without inequality. By this, it shows living a livelihood through good conduct, such as bodily balance, avoiding bodily imbalance and other misconduct.
Bình đẳng (Samenā): Không bất bình đẳng. Bằng từ đó, Ngài chỉ ra việc kiếm sống bằng thiện hạnh như thân bình đẳng, v.v., sau khi từ bỏ các ác hạnh như thân bất bình đẳng, v.v.
‘‘Vuttañheta’’ntiādinā pañcaṅguttarapāḷimāharitvā sādhakaṃ, sarūpañca dasseti.
By “ This has been said,” and so on, the text cites the Pañcaṅguttara Pāḷi to provide confirmation and illustrate its nature.
Bằng cách nói "Điều này đã được nói" và tiếp theo, Ngài trích dẫn Pañcaṅguttarapāḷi để chứng minh và chỉ ra bản chất.
Vāṇijānaṃ ayanti vaṇijjā, yassa kassaci vikkayo, itthiliṅgapadametaṃ.
“ Vaṇijjā (trade)” is the livelihood of merchants; it is the selling of anything whatsoever. This is a feminine gender word.
Buôn bán (vaṇijjā) là của các thương nhân, là việc mua bán của bất cứ ai. Từ này là từ giống cái.
Satthavaṇijjāti āvudhabhaṇḍaṃ katvā vā kāretvā vā yathākataṃ paṭilabhitvā vā tassa vikkayo.
“ Satthavaṇijjā (trade in weapons)” means selling weapons, whether by making them oneself, having them made by others, or acquiring them as they are made.
Buôn bán vũ khí (Satthavaṇijjā): Là việc bán vũ khí sau khi tự mình chế tạo hoặc sai người khác chế tạo, hoặc nhận lại vũ khí đã chế tạo.
Sattavaṇijjāti manussavikkayo.
“ Sattavaṇijjā (trade in living beings)” means selling human beings.
Buôn bán người (Sattavaṇijjā): Là việc bán người.
Maṃsavaṇijjāti sūnakārādayo viya migasūkarādike posetvā maṃsaṃ sampādetvā vikkayo.
“ Maṃsavaṇijjā (trade in meat)” means selling meat by raising deer, pigs, and so on, and preparing the meat, just like butchers.
Buôn bán thịt (Maṃsavaṇijjā): Là việc nuôi các loài thú như hươu, heo, v.v., rồi chế biến thịt và bán, như những người bán thịt, v.v.
Majjavaṇijjāti yaṃ kiñci majjaṃ yojetvā tassa vikkayo.
“ Majjavaṇijjā (trade in intoxicants)” means selling any intoxicating drink after brewing it.
Buôn bán rượu (Majjavaṇijjā): Là việc pha chế bất kỳ loại rượu nào và bán nó.
Visavaṇijjāti visaṃ yojetvā, saṅgahetvā vā tassa vikkayo.
“ Visavaṇijjā (trade in poison)” means selling poison, whether by compounding it or collecting it.
Buôn bán chất độc (Visavaṇijjā): Là việc pha chế hoặc thu thập chất độc và bán nó.
Tattha satthavaṇijjā paroparodhanimittatāya akaraṇīyāti vuttā, sattavaṇijjā abhujissabhāvakaraṇato, maṃsavaṇijjā vadhahetuto, majjavaṇijjā pamādaṭṭhānato, visavaṇijjā parūpaghātakāraṇato.
Among these, trade in weapons is said to be not to be done because it causes harm to others; trade in living beings because it leads to making them unfree; trade in meat because it is a cause of killing; trade in intoxicants because it leads to heedlessness; and trade in poison because it causes injury to others.
Trong số đó, buôn bán vũ khí được nói là không nên làm vì nó là nguyên nhân gây hại cho người khác; buôn bán người vì nó gây ra tình trạng không tự do; buôn bán thịt vì nó là nguyên nhân của việc giết hại; buôn bán rượu vì nó là nguyên nhân của sự lơ đễnh; buôn bán chất độc vì nó là nguyên nhân gây hại cho người khác.
Tassevāti yathāvuttassa pañcaveramaṇilakkhaṇassa sīlassa ceva pañcamicchāvaṇijjādippahānalakkhaṇassa ājīvassa ca paṭiniddeso.
“ Tasseva (of that very one)” refers to a restatement of the sīla characterized by the five abstentions as described, and the livelihood characterized by the abandonment of the five wrong livelihoods, etc.
Của chính điều đó (Tassevā): Là sự chỉ định lại của giới có đặc tính là năm sự kiêng cữ đã nói và sinh kế có đặc tính là từ bỏ năm loại buôn bán tà mạng, v.v.
Vipattīti bhedo, pakopo ca.
“ Vipattī (failure)” means breakdown and corruption.
Sự hư hoại (Vipattī): Là sự phá vỡ và sự suy đồi.
Evaṃ sīlaājīvavipattivasena upāsakassa vipattiṃ dassetvā assaddhiyādivasenapi dassento ‘‘apicā’’tiādimāha.
Having thus shown the lay follower’s failure by way of the failure in sīla and livelihood, the teacher then states, “ Furthermore,” and so on, to show it also by way of lack of faith and so on.
Như vậy, sau khi chỉ ra sự hư hoại của cận sự nam theo cách hư hoại về giới và sinh kế, Ngài tiếp tục chỉ ra theo cách vô tín, v.v., bằng cách nói "Hơn nữa (apicā)" và tiếp theo.
Yāyāti assaddhiyādivippaṭipattiyā.
“ Yāyā (by which)” means by which wrong practice of lack of faith and so on.
Nào là (Yāyā): Bằng sự thực hành sai lầm như vô tín, v.v.
Caṇḍāloti nīcadhammajātikaṭṭhena upāsakacaṇḍālo.
“ Caṇḍālo (outcaste)” means an upāsaka who is an outcaste due to his low nature of qualities.
Kẻ hạ tiện (Caṇḍālo): Là cận sự nam hạ tiện, vì bản chất pháp của người ấy thấp kém.
Malanti malīnaṭṭhena upāsakamalaṃ.
“ Malaṃ (stain)” means an upāsaka's stain due to his defiled nature.
Uế tạp (Malaṃ): Là uế tạp của cận sự nam, vì bản chất dơ bẩn.
Patikiṭṭhoti lāmakaṭṭhena upāsakanihīno.
“ Patikiṭṭho (despicable)” means a lowly upāsaka due to his wretched nature.
Kẻ thấp hèn (Patikiṭṭho): Là kẻ thấp hèn trong số các cận sự nam, vì bản chất tồi tệ.
Sāpissāti sāpi assaddhiyādivippaṭipatti assa upāsakassa vipattīti veditabbā.
“ Sāpissā” (that too) means that lack of faith and other wrong practices should be understood as the failure of that lay follower.
Điều đó cũng là (Sāpissā): Điều đó, tức là sự thực hành sai lầm như vô tín, v.v., cũng là sự hư hoại của cận sự nam đó, cần phải biết như vậy.
Kā panāyanti vuttaṃ ‘‘te cā’’tiādi.
What is this failure? This is stated in “ Te cā (And these),” and so on.
Điều này là gì? Điều này đã được nói trong "Những điều đó là (te cā)" và tiếp theo.
Upāsakacaṇḍālasuttaṃ, (a. ni. 5.175) upāsakaratanasuttañca pañcaṅguttare.
The Upāsaka Caṇḍāla Sutta and the Upāsaka Ratana Sutta are found in the Aṅguttara Nikāya (Book of Fives, Sutta 175).
Kinh Upāsakacaṇḍāla và Kinh Upāsakarataṇa nằm trong Pañcaṅguttara Nikāya.
Tattha buddhādīsu, kammakammaphalesu ca saddhāvipariyāyo micchāvimokkho assaddhiyaṃ, tena samannāgato assaddho.
Among these, assaddho (faithless) is one who is endowed with unfaithfulness, which is a perversion of faith in the Buddha and others, and in kamma and its results, and wrong liberation.
Ở đó, sự đảo ngược niềm tin vào Đức Phật, v.v., và vào nghiệp và quả của nghiệp, sự giải thoát sai lầm là vô tín (assaddhiyaṃ); người được trang bị điều đó là vô tín (assaddho).
Yathāvuttasīlavipattiājīvavipattivasena dussīlo.
Dussīlo (immoral) is one whose sīla is corrupted, as described, and whose livelihood is corrupted.
Phá giới (dussīlo) vì sự hư hoại về giới và sự hư hoại về sinh kế đã nói.
‘‘Iminā diṭṭhādinā idaṃ nāma maṅgalaṃ hotī’’ti evaṃ bālajanaparikappitena kotūhalasaṅkhātena diṭṭhasutamutamaṅgalena samannāgato kotūhalamaṅgaliko.
Kotūhalamaṅgaliko (one who is superstitious about omens) is one who is endowed with omens (maṅgala) that are seen, heard, or cognized, such as “By this sight, such and such a blessing will occur,” as imagined by foolish people, which is called curiosity (kotūhala).
Người được trang bị những điều may mắn đã thấy, đã nghe, đã biết được những người ngu dại tưởng tượng ra như: "Với điều đã thấy này, v.v., điều này được gọi là điều may mắn", được gọi là người tin vào điềm may rủi (kotūhalamaṅgaliko).
Maṅgalaṃ paccetī ti diṭṭhamaṅgalādibhedaṃ maṅgalameva pattiyāyati no kammanti kammassakataṃ no pattiyāyati.
“ Maṅgalaṃ paccetī” means he believes only in omens, such as auspicious sights, and “ no kamma” means he does not believe in the ownership of kamma.
Tin vào điềm lành (Maṅgalaṃ paccetī): Tin tưởng vào các điềm lành như đã thấy, v.v., không phải nghiệp (no kammaṃ) là không tin vào nghiệp báo.
Ito ca bahiddhāti ito sabbaññubuddhasāsanato bahiddhā bāhirakasamaye.
“ Ito ca bahiddhā (and outside of this)” means outside of this Dispensation of the Omniscient Buddha, among external sects.
Bên ngoài giáo pháp này (Ito ca bahiddhā): Bên ngoài giáo pháp của Đức Phật Toàn Giác này, tức là trong các giáo phái bên ngoài.
Ca-saddo aṭṭhānapayutto, sabbattha ‘‘assaddho’’tiādīsu yojetabbo.
The word “ ca” is used inappropriately and should be linked everywhere in phrases like “assaddho” and so on.
Từ "ca" được dùng không đúng chỗ, cần phải được ghép vào tất cả các từ như "vô tín (assaddho)", v.v.
Dakkhiṇeyyaṃ pariyesatīti duppaṭipannaṃ dakkhiṇārahasaññī gavesati.
“ Dakkhiṇeyyaṃ pariyesatī (seeks those worthy of offerings)” means he searches for one who practices wrongly, considering him worthy of offerings.
Tìm kiếm người đáng cúng dường (Dakkhiṇeyyaṃ pariyesatī): Tìm kiếm những người thực hành sai lầm mà mình cho là đáng cúng dường.
Tatthāti bahiddhā bāhirakasamaye.
“ Tatthā (there)” means among external sects.
Ở đó (Tatthā): Trong các giáo phái bên ngoài.
Pubbakāraṃ karotīti paṭhamataraṃ dānamānanādikaṃ kusalakiriyaṃ karoti, bāhirakasamaye paṭhamataraṃ kusalakiriyaṃ katvā pacchā sāsane karotīti vuttaṃ hotīti.
“ Pubbakāraṃ karotī (does the prior deed)” means he performs wholesome actions such as giving and honoring first. It is said that he performs wholesome actions first among external sects, and later in the Dispensation.
Thực hiện việc làm đầu tiên (Pubbakāraṃ karotī): Thực hiện các hành vi thiện lành như bố thí, tôn trọng, v.v., trước tiên. Điều này có nghĩa là, trước tiên thực hiện các hành vi thiện lành trong các giáo phái bên ngoài, sau đó mới thực hiện trong giáo pháp.
Tatthāti vā tesaṃ bāhirakānaṃ titthiyānantipi vadanti.
Alternatively, “ tatthā (there)” is also said by teachers to mean those external heretics.
Hoặc ở đó (tatthā), một số vị thầy cũng nói rằng đó là đối với các ngoại đạo.
Ettha ca dakkhiṇeyyapariyesanapubbakāre ekaṃ katvā pañca dhammā veditabbā.
Here, the five qualities should be understood by combining "seeking those worthy of offerings" and "doing the prior deed" into one.
Ở đây, cần phải hiểu năm pháp này bằng cách gộp việc tìm kiếm người đáng cúng dường và việc làm đầu tiên thành một.
Assāti upāsakassa.
“ Assā (of that)” means of the upāsaka.
Của người ấy (Assā): Của cận sự nam.
Sīlasampadāti yathāvuttena pañcaveramaṇilakkhaṇena sīlena sampadā.
“ Sīlasampadā (accomplishment in sīla)” means accomplishment in sīla, characterized by the five abstentions as described.
Sự thành tựu về giới (Sīlasampadā): Là sự thành tựu về giới với đặc tính là năm sự kiêng cữ đã nói.
Ājīvasampadāti pañcamicchāvaṇijjādippahānalakkhaṇena ājīvena sampadā.
“ Ājīvasampadā (accomplishment in livelihood)” means accomplishment in livelihood, characterized by the abandonment of the five wrong livelihoods, etc.
Sự thành tựu về sinh kế (Ājīvasampadā): Là sự thành tựu về sinh kế với đặc tính là từ bỏ năm loại buôn bán tà mạng, v.v.
Evaṃ sīlasampadāājīvasampadāvasena upāsakassa sampattiṃ dassetvā saddhādivasenapi dassento ‘‘ye cassā’’tiādimāha.
Having thus shown the lay follower’s accomplishment by way of accomplishment in sīla and livelihood, the teacher then states, “ And those,” and so on, to show it also by way of faith and so on.
Như vậy, sau khi chỉ ra sự thành tựu của cận sự nam theo cách thành tựu về giới và thành tựu về sinh kế, Ngài tiếp tục chỉ ra theo cách niềm tin, v.v., bằng cách nói "Và những điều đó (ye cassā)" và tiếp theo.
Ye ca pañca dhammā, tepi assa sampattīti yojanā.
And the five qualities, these too are his accomplishments"—thus is the connection.
Và năm pháp ấy, chúng cũng là sự thành tựu của vị ấy, đó là cách nối câu.
Dhammehīti guṇehi.
Dhammehī means by qualities.
Dhammehīti có nghĩa là các phẩm chất.
Catunnaṃ parisānaṃ ratijananaṭṭhena upāsakova ratanaṃ upāsakaratanaṃ. Guṇasobhākittisaddasugandhatādīhi upāsakova padumaṃ upāsakapadumaṃ. Tathā upāsakapuṇḍarīkaṃ. Sesaṃ vipattiyaṃ vuttavipariyāyena veditabbaṃ.
The upāsaka himself is a gem, as he brings joy to the four assemblies—hence, upāsakaratana. The upāsaka himself is a lotus, due to his excellence in qualities, splendor, renown, fragrance, and so on—hence, upāsakapaduma. Similarly, upāsakapuṇḍarīkaṃ. The rest should be understood in contrast to what was stated regarding failure.
Do là người làm cho bốn hội chúng hoan hỷ, vị cận sự nam ấy là một viên ngọc quý, nên gọi là upāsakaratanaṃ (viên ngọc cận sự nam). Do các phẩm chất như vẻ đẹp, danh tiếng, hương thơm tốt, vị cận sự nam ấy là một hoa sen, nên gọi là upāsakapadumaṃ (hoa sen cận sự nam). Tương tự, upāsakapuṇḍarīkaṃ (hoa sen trắng của cận sự nam). Phần còn lại cần được hiểu theo nghĩa ngược lại với những gì đã nói trong trường hợp thất bại.
Nigaṇṭhīnanti nigaṇṭhasamaṇīnaṃ.
Nigaṇṭhīna means for the female Nigaṇṭhas (Jain renunciants).
Nigaṇṭhīnanti là của các ni sư Nigaṇṭha.
Ādimhīti paṭhamatthe.
Ādimhī means in the sense of first, initial.
Ādimhīti có nghĩa là ban đầu.
Ucchagganti ucchuaggaṃ ucchukoṭi.
Ucchagga means the tip of sugarcane, the end of sugarcane.
Ucchagganti là ngọn mía, chóp mía.
Tathā veḷagganti etthāpi.
Similarly, in veḷagga, it is the same.
Tương tự với veḷagganti ở đây.
Koṭiyanti pariyantakoṭiyaṃ, pariyantattheti attho.
Koṭiya means at the very end, at the extreme limit; that is the meaning of "at the limit".
Koṭiyanti là ở điểm cuối, có nghĩa là ở phần cuối.
Ambilagganti ambilakoṭṭhāsaṃ.
Ambilagga means the sour part.
Ambilagganti là phần chua.
Tathā tittakagganti etthāpi.
Similarly, in tittakagga, it is the same.
Tương tự với tittakagganti ở đây.
Vihāraggenāti ovarakakoṭṭhāsena ‘‘imasmiṃ gabbhe vasantānaṃ idaṃ nāma phalaṃ pāpuṇātī’’tiādinā taṃtaṃvasanaṭṭhānakoṭṭhāsenāti attho.
Vihāraggenā means by the portion of the living quarter, for example, "for those dwelling in this chamber, such and such a result is attained," meaning by the portion of each respective dwelling place.
Vihāraggenāti có nghĩa là theo phần phòng ốc, tức là theo phần chỗ ở đó, chẳng hạn như “những ai ở trong căn phòng này sẽ đạt được quả này” v.v.
Pariveṇaggenāti etthāpi eseva nayo.
Pariveṇaggenā also follows the same method.
Tương tự với pariveṇaggenāti, cũng cùng một phương pháp.
Aggeti ettha upayogavacanassa ekārādeso, vacanavipallāso vā, katvā-saddo ca sesoti vuttaṃ ‘‘ādiṃ katvā’’ti.
Regarding agge, the e ending is a substitute for the accusative case, or there is an inversion of case; and the word katvā is understood, as stated in "ādiṃ katvā" (beginning with).
Trong từ Agge, có sự thay thế của âm ‘e’ cho từ chỉ công dụng, hoặc là sự đảo ngược của từ, và từ ‘katvā’ là phần còn lại, nên được nói là “ādiṃ katvā” (lấy làm khởi đầu).
Bhāvatthe tā-saddoti dasseti ‘‘ajjabhāva’’nti iminā, ajjabhāvo ca nāma tasmiṃ dhammassavanasamaye dharamānakatāpāpuṇakabhāvo.
The particle tā is in the sense of state, indicated by "ajjabhāva". Ajjabhāva refers to the state of existing or being present at the time of hearing the Dhamma.
Dấu hiệu ‘tā’ ở đây chỉ ý nghĩa của trạng thái, được giải thích bằng từ “ajjabhāva” này. Ajjabhāva có nghĩa là trạng thái hiện hữu trong thời điểm nghe pháp đó.
Tadā hi taṃ nissayavasena dharamānataṃ nimittaṃ katvā taṃdivasanissitaaruṇuggamanato paṭṭhāya yāva puna aruṇuggamanā etthantare ajjasaddo pavattati, tasmā tasmiṃ samaye dharamānakatāsaṅkhātaṃ ajjabhāvaṃ ādiṃ katvāti attho daṭṭhabbo.
At that time, making that existing state as the reason, by relying on that day from the sunrise until the next sunrise, the word ajja is used. Therefore, the meaning should be understood as "beginning with the state of existing at that time, which is called ajjabhāva."
Vào thời điểm đó, lấy sự hiện hữu của nó làm dấu hiệu dựa trên sự nương tựa vào ngày đó, từ lúc bình minh của ngày đó cho đến bình minh kế tiếp, từ ‘ajja’ được sử dụng trong khoảng thời gian này. Do đó, ý nghĩa cần được hiểu là “lấy trạng thái hiện hữu trong thời điểm đó, tức là ajjabhāva, làm khởi đầu”.
Ajjatanti vā ajjaicceva attho tā-saddassa sakatthavuttito yathā ‘‘devatā’’ti, ayaṃ ācariyānaṃ mati.
Or, Ajjata means simply ajja, as the tā suffix conveys the sense of its own word, like in devatā. This is the opinion of the teachers.
Hoặc Ajjatanti chỉ có nghĩa là ajja, vì từ ‘tā’ tự nó mang ý nghĩa riêng, giống như “devatā”. Đây là quan điểm của các vị thầy.
Evaṃ paṭhamakkharena dissamānapāṭhānurūpaṃ atthaṃ dassetvā idāni tatiyakkharena dissamānapāṭhānurūpaṃ atthaṃ dassetuṃ ‘‘ajjadaggeti vā pāṭho’’tiādi vuttaṃ.
Having thus shown the meaning according to the discernible reading with the first letter, it is now said "ajjadaggeti vā pāṭho" (or the reading is ajjadaggi) and so on, to show the meaning according to the discernible reading with the third letter.
Sau khi giải thích ý nghĩa phù hợp với cách đọc được thấy qua chữ cái đầu tiên, bây giờ để giải thích ý nghĩa phù hợp với cách đọc được thấy qua chữ cái thứ ba, đã nói “ajjadaggeti vā pāṭho” (hoặc là cách đọc ajjadagga) v.v.
Āgamamattattā dakāro padasandhikaro.
The letter d is merely an augment, acting as a conjunction between words.
Vì chỉ là sự thêm vào, âm ‘da’ là âm nối từ.
Ajjāti hi nepātikamidaṃ padaṃ.
Indeed, ajja is an indeclinable particle.
Thật vậy, Ajjā là một từ bất biến (nipāta).
Tenāha ‘‘ajja agganti attho’’ti.
Therefore, it is said, "ajja agganti attho" (the meaning is ajja agga).
Do đó, đã nói “ajja agganti attho” (có nghĩa là ajja agga).
‘‘Pāṇo’’ti idaṃ paramatthato jīvitindriye eva, ‘‘pāṇupeta’’nti ca karaṇattheneva samāsoti ñāpetuṃ ‘‘yāva me jīvitaṃ pavattati, tāva upeta’’nti āha.
The word "pāṇo" refers to the faculty of life (jīvitindriya) in the ultimate sense, and to indicate that "pāṇupeta" is a compound in the instrumental case, it is said: "yāva me jīvitaṃ pavattati, tāva upeta" (as long as my life continues, so long have I gone for refuge).
Từ “pāṇo” này, theo nghĩa tối thượng, chỉ là sinh mạng căn (jīvitindriya). Và để làm rõ rằng “pāṇupeta” là một hợp từ theo nghĩa công cụ, đã nói “yāva me jīvitaṃ pavattati, tāva upeta” (chừng nào sinh mạng tôi còn tồn tại, chừng đó tôi nương tựa).
Upeti upagacchatīti hi upeto, pāṇehi karaṇabhūtehi upeto pāṇupetoti attho ācariyehi abhimato.
For upeti upagacchati means approaches, therefore upeto is one who has approached. Pāṇupeto means one who has approached by means of the vital breath (pāṇa) as the instrument. This meaning is favored by the teachers.
Upeti (đến gần), upagacchati (tiếp cận) nên gọi là upeto (người tiếp cận). Pāṇehi (bằng sinh mạng) là công cụ, upeto (người tiếp cận) nên gọi là pāṇupeto (người tiếp cận bằng sinh mạng), đây là ý nghĩa được các vị thầy chấp thuận.
Iminā ca ‘‘pāṇupetanti idaṃ padaṃ tassa saraṇagamanassa āpāṇakoṭikatādassana’’nti imamatthaṃ vibhāveti.
And by this, it clarifies the meaning that "this word pāṇupeta indicates the lifelong nature of his going for refuge."
Và bằng cách này, câu này làm rõ ý nghĩa rằng “từ pāṇupeta này biểu thị sự nương tựa đó kéo dài đến cuối đời sống (āpāṇakoṭikatā)”.
‘‘Pāṇupeta’’nti hi iminā yāva me pāṇā dharanti, tāva saraṇaṃ upeto, upento ca na vācāmattena, na ca ekavāraṃ cittuppādamattena, atha kho pāṇānaṃ pariccajanavasena yāvajīvaṃ upetoti āpāṇakoṭikatā dassitā.
Indeed, by this "pāṇupeta", it is shown that as long as my life (pāṇā) endures, so long have I gone for refuge; and this taking of refuge is not merely by speech, nor by a single moment of thought, but by sacrificing one's life, it is a refuge taken for life, thus indicating its lifelong nature.
Thật vậy, bằng từ “pāṇupeta” này, đã chỉ ra rằng sự nương tựa kéo dài đến cuối đời sống (āpāṇakoṭikatā), nghĩa là “chừng nào sinh mạng tôi còn tồn tại, chừng đó tôi nương tựa, và sự nương tựa này không chỉ bằng lời nói, không chỉ bằng một lần khởi tâm, mà là sự nương tựa suốt đời bằng cách từ bỏ sinh mạng”.
‘‘Tīhi…pe… gata’’nti idaṃ ‘‘saraṇaṃ gata’’nti etassa atthavacanaṃ.
"Tīhi…pe… gata" is an explanation of the meaning of "saraṇaṃ gata" (gone for refuge).
Câu “Tīhi…pe… gata” này là lời giải thích ý nghĩa của “saraṇaṃ gata” (đã quy y).
‘‘Anaññasatthuka’’nti idaṃ pana antogadhāvadhāraṇena, aññatthāpohanena ca nivattetabbatthadassanaṃ.
However, "anaññasatthuka" indicates that the meaning to be negated is through inclusion of emphasis and exclusion of others.
Còn từ “Anaññasatthuka” này là sự biểu thị ý nghĩa cần loại bỏ bằng cách bao gồm sự xác định (avadhāraṇa) và bằng cách loại trừ những cái khác.
Ekacco kappiyakārakasaddassa attho upāsakasaddassa vacanīyopi bhavatīti vuttaṃ ‘‘upāsakaṃ kappiyakāraka’’nti, attasanniyyātanasaraṇagamanaṃ vā sandhāya evaṃ vuttanti daṭṭhabbaṃ.
It is said "upāsakaṃ kappiyakāraka" because sometimes the meaning of the word kappiyakāraka can also be conveyed by the word upāsaka; or it should be understood that it is said this way with reference to taking refuge by entrusting oneself.
Đã nói “upāsakaṃ kappiyakāraka” (cận sự nam là người làm việc thích hợp) vì đôi khi ý nghĩa của từ kappiyakāraka cũng có thể là ý nghĩa của từ upāsaka. Hoặc cần hiểu rằng điều này được nói liên quan đến sự quy y bằng cách hiến dâng bản thân.
Evaṃ ‘‘pāṇupeta’’nti iminā nītatthato dassitaṃ tassa saraṇagamanassa āpāṇakoṭikataṃ dassetvā evaṃ vadanto panesa rājā ‘‘jīvitena saha vatthuttayaṃ paṭipūjento saraṇagamanaṃ rakkhāmī’’ti adhippāyaṃ vibhāvetīti neyyatthato vibhāvitaṃ tassa rañño adhippāyaṃ vibhāvento ‘‘ahañhī’’tiādimāha.
Having thus explained the lifelong nature of his going for refuge in the sense of what is explicitly meant by "pāṇupeta", the king, in saying this, clarifies his intention that "I shall observe the going for refuge, honoring the Triple Gem with my life." Thus, elucidating the king's intention as understood through implication, it is said "ahañhī" and so on.
Như vậy, sau khi chỉ ra sự quy y đó kéo dài đến cuối đời sống (āpāṇakoṭikataṃ) được biểu thị bằng từ “pāṇupeta” theo nghĩa trực tiếp (nītatthato), vị vua ấy nói như vậy để làm rõ ý định của mình rằng “tôi sẽ giữ gìn sự quy y bằng cách tôn kính Tam Bảo cùng với sinh mạng”. Để làm rõ ý định của vị vua đó được biểu thị theo nghĩa giải thích (neyyatthato), đã nói “ahañhī” v.v.
Tattha hi-saddo samatthane, kāraṇatthe vā, tena imāya yuttiyā, iminā vā kāraṇena upāsakaṃ maṃ bhagavā dhāretūti ayamattho pakāsito.
There, the word hi is in the sense of completion or in the sense of cause. By this reason or by this cause, O Bhagavā, may you regard me as a lay follower—this meaning is revealed.
Trong đó, từ hi có nghĩa là sự hoàn tất hoặc nguyên nhân. Do đó, ý nghĩa được làm rõ là “Bạch Thế Tôn, xin Ngài hãy xem con là một cận sự nam bằng lý do này, hoặc bằng nguyên nhân này”.
Accayanaṃ sādhumariyādaṃ atikkamma madditvā pavattanaṃ accayo, kāyikādiajjhācārasaṅkhāto dosoti āha ‘‘aparādho’’ti, acceti abhibhavitvā pavattati etenāti vā accayo, kāyikādivītikkamassa pavattanako akusaladhammasaṅkhāto doso eva, so ca aparajjhati etenāti aparādhoti vuccati.
Transgression is acting by overstepping and crushing the proper noble conduct; it is a fault in the form of misconduct related to body, etc. Therefore, it is said "aparādho" (offense). Or, accayo means that by which one overcomes and acts, which is a fault in the form of unwholesome kamma that causes physical and other transgressions. And that is called aparādho because one offends by it.
Sự vượt quá giới hạn tốt đẹp, chà đạp lên và hành động là accayo. Đó là lỗi lầm được gọi là hành vi sai trái về thân nghiệp v.v., nên nói “aparādho” (lỗi lầm). Hoặc accayo là điều mà nhờ đó người ta vượt qua và hành động, đó là lỗi lầm được gọi là pháp bất thiện làm cho sự vi phạm về thân nghiệp v.v. xảy ra. Và lỗi lầm đó được gọi là aparādho vì người ta phạm lỗi bằng nó.
So hi aparajjhantaṃ purisaṃ abhibhavitvā pavattati.
Indeed, that fault overcomes and afflicts the person who transgresses.
Thật vậy, lỗi lầm đó vượt qua và ảnh hưởng đến người phạm lỗi.
Tenāha ‘‘atikkamma abhibhavitvā pavatto’’ti.
Therefore, it is said, "atikkamma abhibhavitvā pavatto" (one who transgresses, having overcome).
Do đó, đã nói “atikkamma abhibhavitvā pavatto” (hành động bằng cách vượt qua và lấn át).
Dhammanti dasarājadhammaṃ.
Dhamma means the ten royal virtues (dasarājadhamma).
Dhammanti là mười pháp vương.
Vitthāro panetassa mahāhaṃsajātakādīhi vibhāvetabbo.
Its elaborate exposition should be clarified by the Mahāhaṃsajātaka and other Jātakas.
Sự mở rộng của nó cần được làm rõ bằng các câu chuyện Jātaka như Mahāhaṃsajātakādīhi v.v.
Caratīti ācarati karoti.
Caratī means practices, performs.
Caratīti có nghĩa là thực hành, làm.
Dhammenevāti dhammato anapeteneva, anapetakusaladhammenevāti attho.
Dhammenevā means without deviating from the Dhamma, or without deviating from wholesome Dhamma; that is the meaning.
Dhammenevāti có nghĩa là không rời xa Pháp, tức là không rời xa các pháp thiện.
Tenāha ‘‘na pitughātanādinā adhammenā’’ti.
Therefore, it is said, "na pitughātanādinā adhammenā" (not by unrighteousness such as parricide, etc.).
Do đó, đã nói “na pitughātanādinā adhammenā” (không bằng phi pháp như giết cha v.v.).
‘‘Paṭiggaṇhātū’’ti etassa adhivāsanaṃ sampaṭicchatūti saddato attho, adhippāyato pana atthaṃ dassetuṃ ‘‘khamatū’’ti vuttaṃ.
The literal meaning of "Paṭiggaṇhātū" is "may he accept, may he consent." To show the intended meaning, "khamatū" (may he forgive) is stated.
Ý nghĩa theo từ ngữ của “Paṭiggaṇhātū” là “xin hãy chấp nhận sự chịu đựng (adhivāsanaṃ)”. Còn để làm rõ ý nghĩa theo ý định, đã nói “khamatū” (xin hãy tha thứ).
Puna akaraṇamettha saṃvaroti dasseti ‘‘puna evarūpassā’’tiādinā.
It indicates that not doing it again is restraint, by saying "puna evarūpassā" (again of such a kind) and so on.
Lại nữa, sự không làm điều đó (lỗi lầm) trong tương lai được gọi là sự chế ngự (saṃvara), được chỉ ra bằng “puna evarūpassā” v.v.
‘‘Aparādhassā’’tiādi aññamaññaṃ vevacanaṃ.
"Aparādhassā" and so on are synonyms for each other.
“Aparādhassā” v.v. là những từ đồng nghĩa lẫn nhau.
251. ‘‘Yathādhammo ṭhito, tathevā’’ti imināpi yathā-saddassa anurūpatthamāha, sādhusamāciṇṇakusaladhammānurūpanti attho.
251. By "Yathādhammo ṭhito, tathevā", it refers to the appropriate meaning of the word yathā, which means in accordance with the wholesome Dhamma practiced by the virtuous.
251. Bằng câu “Yathādhammo ṭhito, tathevā” này, cũng nói ý nghĩa phù hợp với từ yathā, có nghĩa là phù hợp với các pháp thiện được người tốt thực hành.
Paṭisaddassa anatthakataṃ dasseti ‘‘karosī’’ti iminā.
It shows the meaninglessness of the prefix paṭi with "karosī".
Chỉ ra rằng từ Paṭi không có nghĩa riêng bằng từ “karosī” (bạn làm).
Paṭikammaṃ karosītipi vadanti.
They also say paṭikammaṃ karosī (you perform the remedy).
Cũng có người nói là “Paṭikammaṃ karosīti” (bạn làm sự sửa chữa).
Yathādhammaṃ paṭikaraṇaṃ nāma katāparādhassa khamāpanamevāti āha ‘‘khamāpesīti vuttaṃ hotī’’ti.
To remedy according to the Dhamma means to seek forgiveness for an offense committed. Therefore, it is said, "khamāpesīti vuttaṃ hotī" (it means "he caused to forgive").
Sự sửa chữa theo Pháp (yathādhammaṃ paṭikaraṇaṃ) có nghĩa là sự xin lỗi của người đã phạm lỗi, nên đã nói “khamāpesīti vuttaṃ hotī” (có nghĩa là đã xin lỗi).
‘‘Paṭiggaṇhāmā’’ti etassa adhivāsanaṃ sampaṭicchāmāti atthaṃ dasseti ‘‘khamāmā’’ti iminā.
It shows the meaning of "we accept" for "Paṭiggaṇhāmā" by stating "khamāmā" (we forgive).
Bằng từ “khamāmā” (chúng tôi tha thứ), chỉ ra ý nghĩa của “Paṭiggaṇhāmā” (chúng tôi chấp nhận) là “chúng tôi chịu đựng”.
Vuddhi hesāti ettha ha-kāro padasiliṭṭhatāya āgamo, hi-saddo vā nipātamattaṃ.
In Vuddhi hesā, the particle ha is an augment for smoothness of utterance, or hi is merely an indeclinable particle.
Trong câu Vuddhi hesā, âm ha là sự thêm vào để làm cho từ ngữ trôi chảy, hoặc từ hi chỉ là một tiểu từ.
Esāti yathādhammaṃ paṭikiriyā, āyatiṃ saṃvarāpajjanā ca.
Esā refers to rectifying according to the Dhamma and undertaking restraint in the future.
Esā (điều này) là sự sửa chữa theo Pháp, và sự chế ngự trong tương lai.
Tenāha ‘‘yo accayaṃ…pe… āpajjatī’’ti.
Therefore, it is said, "yo accayaṃ…pe… āpajjatī" (whoever confesses his transgression... and restrains himself).
Do đó, đã nói “yo accayaṃ…pe… āpajjatī” (người nào phạm lỗi…v.v… và chế ngự).
Sadevakena lokena ‘‘saraṇa’’nti araṇīyato upagantabbato tathāgato ariyo nāmāti vuttaṃ ‘‘buddhassa bhagavato’’ti.
The Tathāgata is called Ariyo (Noble) because he is worthy of approach (araṇīyato upagantabbato) as a refuge (saraṇaṃ) by the world with its deities. Therefore, it is said, "buddhassa bhagavato" (of the Blessed One, the Buddha).
Đã nói “buddhassa bhagavato” (của Đức Phật Thế Tôn) vì Như Lai được gọi là ariyo (bậc cao quý) do được thế gian cùng chư thiên tôn kính là nơi nương tựa.
Vineti satte etenāti vinayo, sāsanaṃ.
Vinayo is the instruction (sāsanaṃ) by which beings are disciplined.
Điều mà nhờ đó Ngài giáo hóa chúng sinh là vinayo (giới luật), tức là giáo pháp.
Vaddhati saggamokkhasampatti etāyāti vuddhi. Katamā pana sā, yā ‘‘esā’’ti niddiṭṭhā vuddhīti codanamapanetuṃ ‘‘yo accaya’’ntiādi vuttanti sambandhaṃ dasseti ‘‘katamā’’tiādinā, yā ayaṃ saṃvarāpajjanā, sā ‘‘esā’’ti niddiṭṭhā vuddhi nāmāti attho.
Vuddhi is that by which the blessings of heaven and liberation flourish. What, then, is that growth indicated by "esā"? To remove this question, it is said "yo accaya" and so on. This shows the connection. The meaning to be understood is that this undertaking of restraint is the growth indicated by "esā."
Sự thành tựu của thiên giới và giải thoát tăng trưởng nhờ điều này là vuddhi (sự tăng trưởng). Để loại bỏ câu hỏi “vậy sự tăng trưởng được chỉ định là ‘esā’ là gì?”, đã nói “yo accaya” v.v. để chỉ sự liên kết, có nghĩa là sự chế ngự này được chỉ định là sự tăng trưởng.
‘‘Yathādhammaṃ paṭikarotī’’ti idaṃ āyatiṃ saṃvarāpajjanāya pubbakiriyādassananti viññāpanatthaṃ ‘‘yathādhammaṃ paṭikaritvā āyatiṃ saṃvarāpajjanā’’ti vuttaṃ.
The phrase "Yathādhammaṃ paṭikarotī" is meant to clarify that it is the preliminary action for undertaking future restraint. Therefore, it is stated "yathādhammaṃ paṭikaritvā āyatiṃ saṃvarāpajjanā" (having rectified according to the Dhamma, undertaking restraint in the future).
Câu “Yathādhammaṃ paṭikarotī” này là sự chỉ ra hành động sơ khởi cho sự chế ngự trong tương lai, nên đã nói “yathādhammaṃ paṭikaritvā āyatiṃ saṃvarāpajjanā” (sau khi sửa chữa theo Pháp, sự chế ngự trong tương lai) để làm rõ.
Esā hi ācariyānaṃ pakati, yadidaṃ yena kenaci pakārena adhippāyantaraviññāpanaṃ, etapadena pana tassāpi paṭiniddeso sambhavati ‘‘yathādhammaṃ paṭikarotī’’ tipi paṭiniddisitabbassa dassanato.
Indeed, this is the nature of the teachers, that is, to explain another meaning in some way or another, and by this word, a re-designation of that (meaning) is also possible, because it is seen that "he acts in accordance with the Dhamma" is also to be re-designated.
Thật vậy, đây là bản chất của các vị luận sư (ācariya), tức là việc diễn giải ý nghĩa khác bằng bất kỳ cách nào, và với từ này, sự giải thích lại điều đó cũng có thể xảy ra, vì nó cho thấy rằng điều cần được giải thích lại là “người ấy sửa chữa theo Chánh Pháp (yathādhammaṃ paṭikaroti)”.
Keci pana ‘‘yathādhammaṃ paṭikarotī’ti idaṃ pubbakiriyāmattasseva dassanaṃ, na paṭiniddisitabbassa.
However, some say, "The phrase 'he acts in accordance with the Dhamma' is merely a showing of the preliminary action, not a re-designation of what is to be re-designated.
Tuy nhiên, một số người nói rằng: “Câu ‘người ấy sửa chữa theo Chánh Pháp’ chỉ là sự trình bày về hành động ban đầu, chứ không phải là điều cần được giải thích lại.
‘Āyatiñca saṃvaraṃ āpajjatī’ti idaṃ pana paṭiniddisitabbassevāti viññāpanatthaṃ evaṃ vutta’’nti vadanti, tadayuttameva khamāpanassāpi vuddhihetubhāvena ariyūpavāde vuttattā.
But the phrase 'and in the future he undertakes restraint' is a re-designation of what is to be re-designated. This was stated in order to make this known." That is indeed inappropriate, because even forgiveness is stated in the Ariyūpavāda as a cause of growth.
Còn câu ‘và trong tương lai sẽ thực hành sự chế ngự’ mới là điều cần được giải thích lại, nên được nói như vậy để làm rõ ý nghĩa.” Điều đó hoàn toàn không hợp lý, vì việc xin lỗi cũng được nói là nguyên nhân của sự tăng trưởng trong trường hợp xúc phạm bậc Thánh (ariyūpavāda).
Itarathā hi khamāpanābhāvepi āyatiṃ saṃvarāpajjanāya eva ariyūpavādāpagamanaṃ vuttaṃ siyā, na ca pana vuttaṃ, tasmā vuttanayeneva attho veditabboti.
Otherwise, it would be said that the transgression against noble ones ceases merely by undertaking future restraint, even without forgiveness, but it is not said so. Therefore, the meaning should be understood according to the method stated.
Nếu không thì, dù không có sự xin lỗi, việc thoát khỏi tội xúc phạm bậc Thánh cũng sẽ được nói là chỉ do sự chế ngự trong tương lai, nhưng điều đó không được nói. Do đó, ý nghĩa phải được hiểu theo cách đã nói.
Kasmā pana ‘‘yāya’’ntiādinā dhammaniddeso dassito, nanu pāḷiyaṃ ‘‘yo accaya’’ntiādinā puggalaniddeso katoti codanaṃ sodhetuṃ ‘‘desanaṃ panā’’tiādi āraddhaṃ.
Why, then, is the exposition of Dhamma shown with "by which" and so on, when in the Pāḷi, the exposition of the individual is made with "whatever transgression" and so on? To clarify this question, "but the teaching" and so on was commenced.
Để giải đáp câu hỏi: “Tại sao sự trình bày về Pháp lại được chỉ ra bằng ‘yāya’ v.v., lẽ ra trong Pāḷi, sự trình bày về cá nhân được thực hiện bằng ‘yo accaya’ v.v.?” nên mới bắt đầu bằng “desanaṃ panā” v.v.
Puggalādhiṭṭhānaṃ karontoti puggalādhiṭṭhānadhammadesanaṃ karonto.
"Making it person-based" means making a Dhamma teaching that is person-based.
“Puggalādhiṭṭhānaṃ karonto” nghĩa là thực hiện sự thuyết Pháp dựa trên cá nhân (puggalādhiṭṭhāna-dhamma-desanā).
Puggalādhiṭṭhānāpi hi puggalādhiṭṭhānadhammadesanā, puggalādhiṭṭhānapuggaladesanāti duvidhā hoti.
Indeed, person-based teachings are of two kinds: Dhamma teachings that are person-based, and person teachings that are person-based.
Thật vậy, sự thuyết Pháp dựa trên cá nhân (puggalādhiṭṭhānā) có hai loại: thuyết Pháp dựa trên cá nhân (puggalādhiṭṭhāna-dhamma-desanā) và thuyết về cá nhân dựa trên cá nhân (puggalādhiṭṭhāna-puggala-desanā).
Ayametthādhippāyo – kiñcāpi ‘‘vuddhi hesā’’tiādinā dhammādhiṭṭhānadesanā āraddhā, tathāpi puna puggalādhiṭṭhānaṃ karontena ‘‘yo accaya’’ntiādinā puggalādhiṭṭhānadesanā āraddhā desanāvilāsavasena, veneyyajjhāsayavasena cāti.
This is the intention here: although the Dhamma-based teaching was commenced with "this is growth" and so on, nevertheless, the person-based teaching, commencing with "whatever transgression" and so on, was commenced by the Buddha, making it person-based again, by way of the beauty of the teaching and by way of the disposition of those to be trained.
Ý nghĩa ở đây là: Mặc dù sự thuyết Pháp dựa trên Pháp (dhammādhiṭṭhāna-desanā) đã được bắt đầu bằng “vuddhi hesā” v.v., nhưng sau đó, Đức Phật đã bắt đầu sự thuyết Pháp dựa trên cá nhân bằng “yo accaya” v.v. theo phong cách thuyết Pháp và theo ý nguyện của những người có thể được giáo hóa.
Tadubhayavaseneva hi dhammādhiṭṭhānādibhedena catubbidhā desanā.
Indeed, the teaching is fourfold, divided into Dhamma-based and so on, by virtue of these two.
Thật vậy, chỉ theo hai cách đó, sự thuyết Pháp có bốn loại, với sự phân biệt như dựa trên Pháp (dhammādhiṭṭhāna) v.v.
252. Vacasāyatteti vacasā āyatte.
252. "Vacasāyatte" means dependent on speech.
252. “Vacasāyatte” nghĩa là gắn liền với lời nói.
Vācāpaṭibandhatteti vadanti, taṃ ‘‘so hī’’tiādinā viruddhaṃ viya dissati.
They say it means "bound by speech", but that seems to contradict "for he" and so on.
Một số người nói rằng nó có nghĩa là “bị ràng buộc bởi lời nói”, nhưng điều đó dường như mâu thuẫn với câu “so hī” v.v.
Vacasāyattheti pana vācāpariyosānattheti attho yutto osānakaraṇatthassa sāsaddassa vasena sāyasaddanipphattito yathā ‘‘dāyo’’ti.
However, the meaning "vacasāyatte" as "at the end of speech" is appropriate, as the word sāya is derived from the root sā meaning "to make an end", like dāya.
Tuy nhiên, ý nghĩa thích hợp của “vacasāyatthe” là “kết thúc lời nói”, vì từ “sāya” được hình thành từ gốc “sa” mang ý nghĩa làm cho kết thúc, giống như “dāyo”.
Evañhi samatthanavacanampi upapannaṃ hoti.
In this way, the meaning of "completed utterance" also becomes suitable.
Khi đó, lời nói có khả năng cũng trở nên hợp lý.
Gamanāya kataṃ vācāpariyosānaṃ katvā vuttattā tasmiṃyeva atthe vattatīti.
Because it is said, having made the conclusion of speech for going, it functions in that very meaning.
Vì lời nói đã được nói sau khi kết thúc việc đi, nên nó mang ý nghĩa đó.
Handasaddañhi codanatthe, vacasaggatthe ca icchanti.
Indeed, they desire the word handa in the sense of urging and in the sense of concluding speech.
Thật vậy, người ta mong muốn từ “handa” mang ý nghĩa thúc giục và ý nghĩa kết thúc lời nói.
‘‘Handa dāni bhikkhave āmantayāmī’’tiādīsu (dī. ni. 2.218; saṃ. ni. 1.186) hi codanatthe, ‘‘handa dāni apāyāmī’’tiādīsu (jā. 2.22.843) vacasaggatthe, vacasaggo ca nāma vācāvissajjanaṃ, tañca vācāpariyosānamevāti daṭṭhabbaṃ.
In phrases like "Now, monks, I exhort you" (Dī. Ni. 2.218; Saṃ. Ni. 1.186), it is in the sense of urging, and in phrases like "Now, I shall depart" (Jā. 2.22.843), it is in the sense of concluding speech. And concluding speech means the dismissal of speech, and that is indeed the end of speech.
Trong các đoạn như “handa dāni bhikkhave āmantayāmī” v.v., nó mang ý nghĩa thúc giục, còn trong các đoạn như “handa dāni apāyāmī” v.v., nó mang ý nghĩa kết thúc lời nói. Và “vacasaggo” có nghĩa là từ bỏ lời nói, và điều đó chính là sự kết thúc lời nói.
Dukkarakiccavasena bahukiccatāti āha ‘‘balavakiccā’’ti.
"It is a matter of many duties by way of difficult duties," thus it is said, " a weighty duty."
Để chỉ ra rằng có nhiều việc phải làm do tính chất khó khăn của công việc, nên nói “balavakiccā” (nhiều việc nặng nhọc).
‘‘Avassaṃ kattabbaṃ kiccaṃ, itaraṃ karaṇīyaṃ. Paṭhamaṃ vā kattabbaṃ kiccaṃ, pacchā kattabbaṃ karaṇīyaṃ. Khuddakaṃ vā kiccaṃ, mahantaṃ karaṇīya’’ntipi udānaṭṭhakathādīsu (udā. aṭṭha. 15) vuttaṃ.
"That which must necessarily be done is kicca, the other is karaṇīya. Or, that which must be done first is kicca, that which must be done later is karaṇīya. Or, a small matter is kicca, a great matter is karaṇīya," this is also stated in the Udānaṭṭhakathā and other texts.
Cũng được nói trong Udānaṭṭhakathā v.v.: “Việc nhất định phải làm là kiccaṃ, việc khác là karaṇīyaṃ. Hoặc việc phải làm trước là kiccaṃ, việc phải làm sau là karaṇīyaṃ. Hoặc việc nhỏ là kiccaṃ, việc lớn là karaṇīyaṃ.”
Yaṃ-taṃ-saddānaṃ niccasambandhattā, gamanakālajānanato, aññakiriyāya ca anupayuttattā ‘‘tassa kālaṃ tvameva jānāsī’’ti vuttaṃ.
Because of the constant connection of the words yaṃ and taṃ, because of knowing the time of departure, and because of not being applicable to another action, it is said, " You yourself know its time."
Vì các từ “yaṃ-taṃ” luôn có mối liên hệ, và vì biết thời gian ra đi, và vì không sử dụng cho hành động khác, nên nói “tassa kālaṃ tvameva jānāsī” (chỉ có con biết thời điểm đó).
Idaṃ vuttaṃ hoti ‘‘tayā ñātaṃ gamanakālaṃ tvameva ñatvā gacchāhī’’ti.
This means: "Knowing the time of departure that is known by you, you yourself go."
Điều này có nghĩa là: “Con hãy tự biết thời điểm ra đi mà con đã biết, rồi hãy đi.”
Atha vā yathā kattabbakiccaniyojane ‘‘imaṃ jāna, imaṃ dehi, imaṃ āharā’’ti (pāci. 88, 93) vuttaṃ, tathā idhāpi tayā ñātaṃ kālaṃ tvameva jānāsi, gamanavasena karohīti gamane niyojetīti dassetuṃ ‘‘tvameva jānāsī’’ti pāṭhaseso vuttoti daṭṭhabbaṃ.
Alternatively, just as it is said in the injunction of duties to be performed, "Know this, give this, bring this," so too here, to show that he is being enjoined to depart by saying, "You yourself know the time known by you, do it by way of departing," the remaining part of the text, " You yourself know," is stated, so it should be understood.
Hoặc để chỉ ra rằng, giống như trong việc giao phó công việc phải làm, người ta nói “hãy biết điều này, hãy đưa điều này, hãy mang điều này đến”, thì ở đây cũng vậy, Đức Phật giao phó việc đi bằng cách nói: “Con tự biết thời điểm mà con đã biết, hãy thực hiện việc đi.” Nên phải hiểu rằng phần còn lại của câu “tvameva jānāsī” được nói ra.
‘‘Tikkhattuṃ padakkhiṇaṃ katvā’’tiādi yathāsamāciṇṇaṃ pakaraṇādhigatamattaṃ dassetuṃ vuttaṃ.
The phrase " Having circumambulated three times" and so on is stated to indicate merely what is customarily practiced and understood from the context.
Câu “Tikkhattuṃ padakkhiṇaṃ katvā” v.v. được nói ra để chỉ ra rằng đó chỉ là việc thực hành theo truyền thống đã được biết đến trong trường hợp này.
Tattha padakkhiṇanti pakārato kataṃ dakkhiṇaṃ.
Therein, padakkhiṇa means a circumambulation performed correctly (to the right).
Ở đó, “padakkhiṇaṃ” là việc đi vòng bên phải được thực hiện một cách đặc biệt.
Tenāha ‘‘tikkhattu’’nti.
Therefore, it is said, " three times."
Vì vậy nói “tikkhattuṃ” (ba lần).
Dasanakhasamodhānasamujjalanti dvīsu hatthesu jātānaṃ dasannaṃ nakhānaṃ samodhānena ekībhāvena samujjalantaṃ, tena dvinnaṃ karatalānaṃ samaṭṭhapanaṃ dasseti.
Dasanakhasamodhānasamujjalam means shining brightly with the ten fingernails joined together, thereby indicating the joining of the two palms.
“Dasanakhasamodhānasamujjalaṃ” nghĩa là tỏa sáng rực rỡ bởi sự kết hợp, sự hợp nhất của mười móng tay trên hai bàn tay. Điều này chỉ ra việc đặt hai lòng bàn tay lại với nhau.
Añjalinti hatthapuṭaṃ.
Añjali means clasped hands.
“Añjaliṃ” là chắp tay.
Añjati byattiṃ pakāseti etāyāti añjali. Añju-saddañhi byattiyaṃ, alipaccayañca icchanti saddavidū.
It is called añjali because clarity (byatti) is manifested by it. Grammarians desire the word añju in the sense of clarity and the suffix ali.
“Añjali” là cái mà nhờ đó sự rõ ràng được biểu lộ. Các nhà ngữ pháp học mong muốn từ “añju” mang ý nghĩa rõ ràng và hậu tố “ali”.
Abhimukhovāti sammukho eva, na bhagavato piṭṭhiṃ dassetvāti attho.
Abhimukho means facing directly, not showing one's back to the Blessed One.
“Abhimukhova” nghĩa là đối mặt, không quay lưng lại với Đức Thế Tôn.
Pañcappatiṭṭhitavandanānayo vutto eva.
The method of prostration with five points of contact has already been explained.
Cách lạy ngũ thể đầu địa đã được nói rồi.
253. Imasmiṃyeva attabhāve vipaccanakānaṃ attano pubbe katakusalamūlānaṃ khaṇanena khato, tesameva upahananena upahato, padadvayenapi tassa kammāparādhameva dasseti pariyāyavacanattā padadvayassa.
253. Khato (damaged) means by the destruction of one's roots of merit done previously, which are to ripen in this very existence; upahato (harmed) means by the affliction of those very roots. By both terms, it shows only that king's offense of ānantariya-kamma, because the two terms are synonyms.
253. Trong chính kiếp sống này, do việc hủy hoại các căn lành (kusalamūla) mà mình đã tạo ra trước đây, những căn lành sẽ chín muồi, nên gọi là “khato” (bị hủy hoại); do việc làm tổn hại chính những căn lành đó, nên gọi là “upahato” (bị tổn hại). Cả hai từ này đều chỉ ra tội lỗi nghiệp chướng của người ấy, vì cả hai từ đều là đồng nghĩa.
Kusalamūlasaṅkhātapatiṭṭhābhedanena khatūpahatabhāvaṃ dassetuṃ ‘‘bhinnapatiṭṭho jāto’’ti vuttaṃ.
To show the state of being damaged and harmed by the breaking of the foundation, which is the roots of merit, it is said, " has become one whose foundation is broken."
Để chỉ ra trạng thái bị hủy hoại và tổn hại do việc phá vỡ nền tảng được gọi là căn lành, nên nói “bhinnapatiṭṭho jāto” (đã trở thành người bị phá vỡ nền tảng).
Patiṭṭhā, mūlanti ca atthato ekaṃ.
Patiṭṭhā (foundation) and mūla (root) are one in meaning.
“Patiṭṭhā” (nền tảng) và “mūla” (căn) về ý nghĩa là một.
Patiṭṭhahati sammattaniyāmokkamanaṃ etāyāti hi patiṭṭhā, tassa kusalūpanissayasampadā, sā kiriyāparādhena bhinnā vināsitā etenāti bhinnapatiṭṭho. Tadeva vitthārento ‘‘tathā’’tiādimāha.
Indeed, patiṭṭhā is that by which one firmly establishes oneself in the fixed course of rightness; that is, the attainment of wholesome support. Since this has been broken, destroyed by this king through the offense of his action, he is bhinnapatiṭṭho (one whose foundation is broken). Expanding on this, he says, " Thus," and so on.
Thật vậy, “patiṭṭhā” là cái mà nhờ đó sự tiến vào Chánh Định (sammattaniyāmokkamana) được thiết lập. Đó là sự thành tựu của duyên lành (kusalūpanissayasampadā). Vị vua này đã phá hoại, đã hủy diệt nó bằng tội lỗi hành động. Vì vậy, người ấy là “bhinnapatiṭṭho”. Để giải thích điều đó, Đức Phật đã nói “tathā” v.v.
Yathā kusalamūlasaṅkhātā attano patiṭṭhānajātā, tathā anena raññā attanāva attā khato khanitoti yojanā.
The connection is: "Just as his own foundation, which is the roots of merit, did not arise, so too by this king, he himself has been dug up and destroyed by himself."
Sự kết nối là: “Giống như các căn lành, tức là nền tảng của chính mình, đã không phát sinh, thì vị vua này đã tự mình hủy hoại chính mình.”
Khatoti hi idaṃ idha kammavasena siddhaṃ, pāḷiyaṃ pana kattuvasenāti daṭṭhabbaṃ.
Indeed, the word khato here is accomplished by way of kamma (object), but in the Pāḷi, it should be understood by way of kattu (agent).
Thật vậy, từ “khato” ở đây được hiểu theo nghĩa nghiệp, còn trong Pāḷi thì theo nghĩa chủ thể.
Padadvayassa pariyāyattā ‘‘upahato’’ti idha na vuttaṃ.
Because the two terms are synonyms, "upahato" is not stated here.
Vì hai từ là đồng nghĩa, nên từ “upahato” không được nói ở đây.
‘‘Rāgo rajo na ca pana reṇu vuccatī’’tiādi (mahāni. 209; cūḷani. 74) vacanato rāgadosamohāva idha rajo nāmāti vuttaṃ ‘‘rāgarajādivirahita’’nti.
Because of the statement "Lust is called dust, but not fine dust," and so on, it is said, " free from the dust of lust and so on," meaning that lust, hatred, and delusion are indeed called dust here.
Theo câu “rāgo rajo na ca pana reṇu vuccatī” v.v., ở đây chỉ có tham, sân, si được gọi là bụi (rajo), nên nói “rāgarajādivirahita” (không có bụi tham ái v.v.).
Vītasaddassa vigatapariyāyataṃ dasseti ‘‘vigatattā’’ti iminā.
It shows that the word vīta is a synonym of vigata by this, " because of being gone."
Từ “vigatattā” này chỉ ra rằng từ “vīta” là đồng nghĩa với “vigata”.
Dhammesu cakkhunti catusaccadhammesu pavattaṃ tesaṃ dassanaṭṭhena cakkhuṃ.
Cakkhu in the Dhamma means the eye that functions in the Four Noble Truths, in the sense of seeing them.
“Dhammesu cakkhu” là con mắt (cakkhu) hoạt động trong các Pháp Tứ Diệu Đế (catusacca-dhamma) theo nghĩa thấy chúng.
Dhammesūti vā heṭṭhimesu tīsu maggadhammesu.
Or, in the Dhamma means in the three lower path-dharmas.
Hoặc “dhammesu” là trong ba Đạo Pháp (maggadhamma) thấp hơn.
Cakkhunti sotāpattimaggasaṅkhātaṃ ekaṃ cakkhuṃ, samudāyekadesavasena ādhāratthasamāsoyaṃ, na tu niddhāraṇatthasamāso.
Cakkhu means the one eye, which is the Sotāpatti-magga. This is an ādhāratthasamāsa (locative compound) by way of a part of a whole, not a niddhāraṇatthasamāsa (determinative compound).
“Cakkhu” là một con mắt được gọi là Đạo Nhập Lưu (sotāpatti-magga). Đây là một hợp chất (samāsa) mang ý nghĩa nền tảng (ādhārattha) theo nghĩa một phần của tổng thể, chứ không phải là hợp chất mang ý nghĩa xác định (niddhāraṇattha).
So hi sāsanaganthesu, sakkataganthesu ca sabbattha paṭisiddhoti.
For that is rejected everywhere in the canonical texts and Sanskrit texts.
Thật vậy, loại hợp chất đó bị cấm ở khắp mọi nơi trong các kinh điển Phật giáo và các kinh điển tiếng Phạn.
Dhammamayanti samathavipassanādhammena nibbattaṃ, iminā ‘‘dhammena nibbattaṃ cakkhu dhammacakkhū’’ti atthamāha.
Dhammamaya means produced by the Dhamma of samatha and vipassanā. By this, he states the meaning: "The eye produced by Dhamma is dhammacakkhu."
“Dhammamaya” là được tạo ra bởi Pháp Chỉ (samatha) và Pháp Quán (vipassanā). Với điều này, Đức Phật nói rằng “con mắt được tạo ra bởi Pháp là dhammacakkhu (Pháp nhãn).”
Apica dhammamayanti sīlāditividhadhammakkhandhoyeva maya-saddassa sakatthe pavattanato, anena ‘‘dhammoyeva cakkhu dhammacakkhū’’ti atthamāha.
Furthermore, dhammamaya means the three aggregates of Dhamma, such as sīla, itself, because the word maya functions in its own sense. By this, he states the meaning: "The Dhamma itself is the eye, the dhammacakkhu."
Hơn nữa, “dhammamaya” là chính ba uẩn Pháp (dhamma-khandha) như Giới (sīla) v.v., vì từ “maya” được sử dụng theo nghĩa tự thân. Với điều này, Đức Phật nói rằng “chính Pháp là con mắt, là dhammacakkhu.”
Aññesu ṭhānesūti aññesu suttapadesesu, etena yathāpāṭhaṃ tividhatthataṃ dasseti.
In other places means in other Sutta passages. By this, it shows the threefold meaning according to the text.
“Aññesu ṭhānesu” là trong các đoạn kinh khác. Với điều này, Đức Phật chỉ ra rằng có ba ý nghĩa theo văn bản.
Idha pana sotāpattimaggassevetaṃ adhivacanaṃ, tasmimpi anadhigate aññesaṃ vattabbatāyeva abhāvatoti adhippāyo.
However, here, this term refers only to the Sotāpatti-magga. The meaning is that if even that is not attained, there is no possibility of speaking of other paths.
Tuy nhiên, ở đây, đó là danh xưng của chính Đạo Nhập Lưu (sotāpatti-magga), và ý nghĩa là nếu Đạo Nhập Lưu chưa được chứng đắc, thì không có gì để nói về những Đạo khác.
Idāni ‘‘khatāyaṃ bhikkhave rājā’’tiādipāṭhassa suviññeyyamadhippāyaṃ dassento ‘‘idaṃ vuttaṃ hotī’’tiādimāha.
Now, explaining the easily understandable meaning of the passage beginning with ‘This king, bhikkhus, is ruined,’ the commentator says, ‘This is what is meant,’ and so on.
Hiện nay, để chỉ rõ ý nghĩa dễ hiểu của đoạn văn bắt đầu bằng ‘‘Này các Tỳ-kheo, vị vua này…’’ thì* nói ‘‘Điều này được nói là…’’ v.v.
Tattha nābhavissāti sace na abhavissatha, evaṃ satīti attho.
There, nābhavissā means, ‘If it had not been, if it had been thus.’
Trong đó, nābhavissā có nghĩa là ‘‘nếu không xảy ra, thì sẽ như vậy’’.
Atīte hi idaṃ kālātipattivacanaṃ, na anāgateti daṭṭhabbaṃ.
Indeed, this is a past conditional verb, not a future one; so it should be understood.
Thật vậy, đây là một từ chỉ quá khứ (kālātipattivacanaṃ), không phải tương lai, nên cần phải hiểu như vậy.
Esa nayo sotāpattimaggaṃ patto abhavissāti etthāpi.
The same method applies to sotāpattimaggaṃ patto abhavissā.
Nguyên tắc này cũng áp dụng cho* ‘‘đã đạt đến Sơ quả (Sotāpatti-magga)’’.
Nanu ca maggapāpuṇanavacanaṃ bhavissamānattā anāgatakālikanti?
Is it not true that the expression of attaining the path, being something that would have happened, refers to the future tense?
Chẳng phải lời nói về việc thành tựu đạo quả là thuộc về thời vị lai vì nó sẽ xảy ra sao?
Saccaṃ aniyamite, idha pana ‘‘idhevāsane nisinno’’ti niyamitattā atītakālikamevāti veditabbaṃ.
It is true when not specified; but here, because it is specified as idhevāsane nisinno (sitting right on this seat), it should be understood as past tense.
Đúng vậy, đối với trường hợp không xác định, nhưng ở đây, vì có sự xác định ‘‘ngồi ngay trên chỗ ngồi này’’, nên cần phải hiểu là thuộc về thời quá khứ.
Idañhi bhagavā rañño āsanā vuṭṭhāya acirapakkantasseva avocāti.
For the Blessed One spoke this just after the king had risen from his seat and departed.
Vì Đức Thế Tôn đã nói điều này ngay sau khi nhà vua đứng dậy khỏi chỗ ngồi và vừa rời đi không lâu.
Pāpamittasaṃsaggenāti devadattena, devadattaparisāsaṅkhātena ca pāpamittena saṃsaggato.
Pāpamittasaṃsaggenā means due to association with evil friends, namely Devadatta and the assembly known as Devadatta's followers.
‘‘Do giao du với ác hữu’’ có nghĩa là do giao du với Devadatta và với ác hữu được gọi là hội chúng của Devadatta.
Assāti sotāpattimaggassa.
Assā means of the Sotāpatti-magga.
Assā là của Sơ quả (Sotāpatti-magga).
‘‘Evaṃ santepī’’tiādinā pāṭhānāruḷhaṃ vacanāvasesaṃ dasseti.
By evaṃ santepī and so on, the commentator shows the remaining words not included in the text.
Bằng ‘‘Dù là như vậy’’ v.v.,* chỉ ra phần còn lại của lời nói không có trong văn bản gốc.
Tasmāti saraṇaṃ gatattā muccissatīti sambandho.
Tasmā is connected with ‘he will be freed because he has gone for refuge’.
‘‘Do đó’’, có sự liên kết là ‘‘sẽ được giải thoát vì đã quy y’’.
‘‘Mama ca sāsanamahantatāyā’’ti pāṭho yutto, katthaci pana ca-saddo na dissati, tattha so luttaniddiṭṭhoti daṭṭhabbaṃ.
The reading mama ca sāsanamahantatāyā is appropriate, but in some places, the word ca is not seen; there, it should be understood as an elided word.
Đoạn văn ‘‘và do sự vĩ đại của giáo pháp của tôi’’ là hợp lý, nhưng ở một số chỗ không thấy từ ca, ở đó cần phải hiểu là ca đã bị lược bỏ.
Na kevalaṃ saraṇaṃ gatattāyeva muccissati, atha kho yattha esa pasanno, pasannākārañca karoti, tassa ca tividhassapi sāsanassa uttamatāyāti hi saha samuccayena attho adhippetoti.
The intended meaning, along with the conjunction, is that he will not only be freed because he has gone for refuge, but also because of the supremacy of the threefold Teaching in which he has faith and shows signs of faith.
Không chỉ được giải thoát vì đã quy y, mà còn vì sự tối thượng của giáo pháp ba loại mà vị ấy đã có lòng tin, và biểu hiện lòng tin đó.
‘‘Yathā nāmā’’tiādi dukkarakammavipākato sukarena muccanena upamādassanaṃ.
The passage yathā nāmā and so on shows an analogy of being freed from the result of a difficult action by an easy means.
‘‘Ví như’’ v.v. là ví dụ về việc được giải thoát một cách dễ dàng khỏi quả báo của nghiệp khó khăn.
Kocīti koci puriso.
Kocī means some man.
Kocī là một người nào đó.
Kassacīti kassaci purisassa, ‘‘vadha’’nti ettha bhāvayoge kammatthe sāmivacanaṃ.
Kassacī means of some man; in vadhaṃ, it is a genitive case in the sense of an object in a verbal noun construction.
Kassacī là của một người nào đó; ở đây, trong* ‘‘vadhaṃ’’, là cách sở hữu (sāmivacanaṃ) theo nghĩa hành động (kamma) trong trạng thái (bhāvayoge).
Pupphamuṭṭhimattena daṇḍenāti pupphamuṭṭhimattasaṅkhātena dhanadaṇḍena.
Pupphamuṭṭhimattena daṇḍenā means with a fine of wealth equal to a handful of flowers.
‘‘Bằng hình phạt chỉ bằng một nắm hoa’’ là bằng hình phạt tiền bạc được gọi là chỉ bằng một nắm hoa.
Mucceyyāti vadhakammadaṇḍato mucceyya, daṇḍenāti vā nissakkatthe karaṇavacanaṃ ‘‘sumuttā mayaṃ tena mahāsamaṇenā’’tiādīsu (dī. ni. 2.232; cūḷava. 437) viya, pupphamuṭṭhimattena dhanadaṇḍato, vadhadaṇḍato ca mucceyyāti attho.
Mucceyyā means he would be freed from the penalty for murder; or daṇḍenā is an instrumental case in the sense of ablation, as in sumuttā mayaṃ tena mahāsamaṇenā and so on; the meaning is that he would be freed from a fine of wealth equal to a handful of flowers and from the penalty for murder.
Mucceyyā là sẽ được giải thoát khỏi hình phạt giết người; hoặc daṇḍenā là cách công cụ (karaṇavacanaṃ) theo nghĩa thoát khỏi (nissakkatthe) như trong ‘‘chúng tôi đã thoát khỏi vị Đại Sa-môn đó’’ v.v., có nghĩa là sẽ được giải thoát khỏi hình phạt tiền bạc chỉ bằng một nắm hoa và hình phạt giết người.
Lohakumbhiyanti lohakumbhinarake.
Lohakumbhiyaṃ means in the Lohakumbhī hell.
‘‘Trong Lohakumbhī’’ là trong địa ngục Lohakumbhī.
Tattha hi tadanubhavanakānaṃ sattānaṃ kammabalena lohamayā mahatī kumbhī nibbattā, tasmā taṃ ‘‘lohakumbhī’’ti vuccati.
There, by the power of kamma, a great iron pot is produced for the beings experiencing it; therefore, that hell is called Lohakumbhī.
Ở đó, do sức mạnh của nghiệp của những chúng sinh phải chịu đựng nó, một cái nồi lớn bằng sắt được tạo ra, vì vậy nó được gọi là ‘‘Lohakumbhī’’.
Uparimatalato adho patanto, heṭṭhimatalato uddhaṃ gacchanto, ubhayathā pana saṭṭhivassasahassāni honti.
Falling down from the upper level and ascending from the lower level, in both ways, it amounts to sixty thousand years.
Rơi xuống từ tầng trên xuống dưới, đi lên từ tầng dưới lên trên, cả hai trường hợp đều là sáu mươi ngàn năm.
Vuttañca –
And it was said:
Cũng đã được nói:
‘‘Heṭṭhimatalaṃ patvā, uparimatalaṃ pāpuṇitvā muccissatī’’ti vadanto imamatthaṃ dīpeti – yathā aññe seṭṭhiputtādayo aparāparaṃ adho patantā, uddhaṃ gacchantā ca anekāni vassasatasahassāni tattha paccanti, na tathā ayaṃ, ayaṃ pana rājā yathāvuttakāraṇena ekavārameva adho patanto, uddhañca gacchanto saṭṭhivassasahassāniyeva paccitvā muccissatīti.
By saying, “Having fallen to the lower level and reached the upper level, he will be freed,” the commentator explains this meaning: just as other sons of merchants and so on are cooked there for many hundreds of thousands of years, falling down again and again and ascending, this king will not be so. But this king, for the reason stated, will be cooked for only sixty thousand years, falling down and ascending only once, and then he will be freed.
Khi nói ‘‘sau khi rơi xuống tầng dưới, và đạt đến tầng trên thì sẽ được giải thoát’’,* làm sáng tỏ ý nghĩa này: như những người con nhà trưởng giả khác, rơi xuống và đi lên nhiều lần, bị thiêu đốt ở đó hàng trăm ngàn năm, thì vị vua này không như vậy. Vị vua này, do nguyên nhân đã nói ở trên, chỉ một lần rơi xuống và đi lên, sau khi bị thiêu đốt sáu mươi ngàn năm thì sẽ được giải thoát.
Ayaṃ pana attho kuto laddhoti anuyogaṃ pariharanto ‘‘idampi kira bhagavatā vuttamevā’’ti āha.
Responding to the question of where this meaning is obtained, the commentator says, idampi kira bhagavatā vuttamevā (this too, it is said, was spoken by the Blessed One).
Để loại bỏ câu hỏi ‘‘Ý nghĩa này được lấy từ đâu?’’,* nói ‘‘Điều này cũng đã được Đức Thế Tôn nói’’.
Kirasaddo cettha anussavanattho, tena bhagavatā vuttabhāvassa ācariyaparamparato suyyamānataṃ, imassa ca atthassa ācariyaparamparābhatabhāvaṃ dīpeti.
Here, the word kira signifies hearsay. By this, it indicates that the fact of its being spoken by the Blessed One was heard through the teacher-tradition, and that this meaning was brought down through the teacher-tradition.
Ở đây, từ kira có nghĩa là ‘‘nghe nói’’, qua đó chỉ ra rằng việc Đức Thế Tôn đã nói điều này được nghe lại từ truyền thống các vị thầy, và ý nghĩa này cũng được truyền lại từ truyền thống các vị thầy.
Atha pāḷiyaṃ saṅgītaṃ siyāti codanamapaneti ‘‘pāḷiyaṃ pana na āruḷha’’nti iminā, pakiṇṇakadesanābhāvena pāḷiyamanāruḷhattā pāṭhabhāvena na saṅgītanti adhippāyo.
Then, to dispel the objection that it might have been recited in the Pāḷi, the commentator says, pāḷiyaṃ pana na āruḷhaṃ (but it was not included in the Pāḷi). The meaning is that it was not recited as part of the Pāḷi because it was a miscellaneous discourse and not included in the Pāḷi.
Sau đó, để loại bỏ câu hỏi ‘‘Chẳng phải điều này đã được kết tập trong Pāḷi sao?’’,* nói ‘‘nhưng nó không được đưa vào Pāḷi’’. Ý nghĩa là do nó là lời dạy lẻ tẻ (pakiṇṇakadesanā), không được đưa vào Pāḷi, nên nó không được kết tập dưới dạng văn bản.
Pakiṇṇakadesanā hi pāḷiyamanāruḷhāti aṭṭhakathāsu vuttaṃ.
Indeed, it is stated in the Aṭṭhakathās that miscellaneous discourses were not included in the Pāḷi.
Thật vậy, trong các tập Chú giải (Aṭṭhakathā) đã nói rằng những lời dạy lẻ tẻ không được đưa vào Pāḷi.
Yadi anantare attabhāve narake paccati, evaṃ sati imaṃ desanaṃ sutvā ko rañño ānisaṃso laddhoti kassaci āsaṅkā siyāti tadāsaṅkānivattanatthaṃ codanaṃ uddharitvā pariharituṃ ‘‘idaṃ panā’’tiādi vuttaṃ.
If, in the very next existence, he is cooked in hell, then, having heard this teaching, what benefit did the king receive? If such a doubt were to arise in anyone, then, in order to remove that doubt, and to raise and resolve the question, the passage beginning with " idaṃ pana" (but this) was stated.
Nếu có ai đó nghi ngờ rằng ‘‘nếu vị vua bị đọa vào địa ngục ngay trong kiếp sống kế tiếp, thì việc nghe lời dạy này có lợi ích gì cho vua?’’, để loại bỏ nghi ngờ đó,* đã nêu ra và giải thích ‘‘Điều này là…’’ v.v.
‘‘Ayañhī’’tiādinā niddālābhādikaṃ diṭṭhadhammikasamparāyikaṃ anekavidhaṃ mahānisaṃsaṃ sarūpato niyametvā dasseti.
By the passage beginning with " Ayañhi" (For this), the teacher defines and shows the manifold great benefits, both immediate and future, such as the attainment of sleep.
Bằng ‘‘Vì đây…’’ v.v.,* xác định và chỉ ra nhiều lợi ích lớn trong hiện tại và vị lai, như việc có được giấc ngủ ngon, v.v.
Ettha hi ‘‘ayaṃ…pe… niddaṃ labhatī’’ti iminā niddālābhaṃ dasseti, tadā kāyikacetasikadukkhāpagatabhāvañca niddālābhasīsena, ‘‘tiṇṇaṃ…pe… akāsī’’ti iminā tiṇṇaṃ ratanānaṃ mahāsakkārakiriyaṃ, ‘‘pothujjanikāya…pe… nāhosī’’ti iminā sātisayaṃ pothujjanikasaddhāpaṭilābhaṃ dassetīti evamādi diṭṭhadhammiko, ‘‘anāgate…pe… parinibbāyissatī’’ti iminā pana ukkaṃsato samparāyiko dassito, anavasesato pana aparāparesu bhavesu aparimāṇoyeva samparāyiko veditabbo.
Here, by " ayaṃ…pe… niddaṃ labhatī" (this… attains sleep), the attainment of sleep is shown, and thereby the absence of bodily and mental suffering is shown under the heading of attaining sleep. By " tiṇṇaṃ…pe… akāsī" (of the three… did), great reverence for the Three Jewels is shown. By " pothujjanikāya…pe… nāhosī" (of the ordinary person… was not), the attainment of extraordinary mundane faith is shown. These are the immediate benefits. By " anāgate…pe… parinibbāyissatī" (in the future… will attain Nibbāna), the ultimate future benefit is shown. As for the remaining, the future benefit in subsequent existences is to be understood as immeasurable.
Ở đây, ‘‘vị ấy… có được giấc ngủ’’ chỉ ra việc có được giấc ngủ, và qua việc có được giấc ngủ, chỉ ra việc thoát khỏi khổ đau thân thể và tâm thần; ‘‘đã thực hiện… ba…’’ chỉ ra việc thực hiện sự tôn kính lớn đối với Ba Ngôi Báu; ‘‘đã không… của phàm phu’’ chỉ ra việc có được niềm tin phàm phu vượt trội, v.v., đây là những lợi ích trong hiện tại; còn ‘‘trong tương lai… sẽ nhập Niết-bàn’’ chỉ ra lợi ích tối cao trong vị lai, và nói chung, trong các kiếp sống tiếp theo, lợi ích trong vị lai là vô lượng.
Tattha madhurāyāti madhurarasabhūtāya.
There, madhurāya means having a sweet taste.
Trong đó, madhurāyā là có vị ngọt ngào.
Ojavantiyāti madhurarasassāpi sārabhūtāya ojāya ojavatiyā.
Ojavantiyā means possessing vitality, which is the essence of even a sweet taste.
Ojavantiyā là có tinh chất (ojā), là tinh túy của vị ngọt ngào.
Puthujjane bhavā pothujjanikā. Pañca māre visesato jitavāti vijitāvī, parūpadesavirahatā cettha visesabhāvo.
Pothujjanikā is that which exists in an ordinary person (puthujjana). Vijitāvī means one who has especially conquered the five Māras; here, the special characteristic is the absence of instruction from others.
Pothujjanikā là thuộc về phàm phu. Vijitāvī là người đã chiến thắng năm ma vương một cách đặc biệt, ở đây, sự đặc biệt là không cần sự chỉ dạy của người khác.
Paccekaṃ abhisambuddhoti paccekabuddho, anācariyako hutvā sāmaññeva sambodhiṃ abhisambuddhoti attho.
Paccekabuddho means one who is individually awakened; the meaning is that one awakens to enlightenment by oneself, without a teacher.
Paccekabuddho là người đã tự mình giác ngộ (abhisambuddha) một cách riêng lẻ, nghĩa là đã tự mình giác ngộ Bồ-đề mà không có thầy.
Tathā hi ‘‘paccekabuddhā sayameva bujjhanti, na pare bodhenti, attharasameva paṭivijjhanti, na dhammarasaṃ.
Thus, it is stated in the commentaries: "Paccekabuddhas awaken by themselves; they do not awaken others. They penetrate only the meaning-flavor (attharasa), not the Dhamma-flavor (dhammarasa).
Thật vậy, trong các tập Chú giải đã nói: ‘‘Các vị Độc Giác Phật tự mình giác ngộ, không giác ngộ người khác; các vị ấy chỉ thấu hiểu ý nghĩa (attharasa), không thấu hiểu pháp nghĩa (dhammarasa).
Na hi te lokuttaradhammaṃ paññattiṃ āropetvā desetuṃ sakkonti, mūgena diṭṭhasupino viya, vanacarakena nagare sāyitabyañjanaraso viya ca nesaṃ dhammābhisamayo hoti, sabbaṃ iddhisamāpattipaṭisambhidāpabhedaṃ pāpuṇantī’’ti (su. ni. aṭṭha. 1.khaggavisāṇasuttavaṇṇanā; apa. aṭṭha. 1.90, 91) aṭṭhakathāsu vuttaṃ.
Indeed, they cannot express the supramundane Dhamma in terms of concepts and teach it, just as a mute person's dream or a forest dweller's taste of seasoned food in a city. Their comprehension of the Dhamma is like this. They attain all kinds of psychic powers, attainments, and analytical knowledges (paṭisambhidā)."
Các vị ấy không thể diễn giảng pháp siêu thế (lokuttaradhamma) bằng cách đặt nó vào khái niệm (paññatti), giống như giấc mơ của người câm, hoặc như hương vị của món ăn đã nếm ở thành phố của người đi rừng. Sự thấu hiểu pháp của các vị ấy là như vậy. Các vị ấy đạt được tất cả các loại thần thông, thiền định và phân tích pháp (paṭisambhidā).’’
Etthāha – yadi rañño kammantarāyābhāve tasmiṃyeva āsane dhammacakkhu uppajjissatha, atha kathaṃ anāgate paccekabuddho hutvā parinibbāyissati.
Here it is asked: If, in the absence of an obstructing kamma for the king, the Dhamma-eye (dhammacakkhu) would have arisen in that very seat, then how could he become a Paccekabuddha in the future and attain Nibbāna?
Ở đây có người hỏi: Nếu không có chướng ngại nghiệp chướng cho nhà vua, thì Pháp nhãn (dhammacakkhu) đã phát sinh ngay trên chỗ ngồi đó, vậy tại sao trong tương lai vị ấy lại trở thành Độc Giác Phật rồi nhập Niết-bàn?
Yadi ca anāgate paccekabuddho hutvā parinibbāyissati, atha kathaṃ tasmiṃyeva āsane dhammacakkhu uppajjissatha, nanu ime sāvakabodhipaccekabodhiupanissayā bhinnanissayā dvinnaṃ bodhīnaṃ asādhāraṇabhāvato.
And if he is to become a Paccekabuddha in the future and attain Nibbāna, then how could the Dhamma-eye arise in that very seat? Are not these predispositions for a Savakabodhi (disciple's enlightenment) and a Paccekabodhi (solitary Buddha's enlightenment) different predispositions, due to the non-commonality of the two types of enlightenment?
Và nếu trong tương lai vị ấy sẽ trở thành Độc Giác Phật rồi nhập Niết-bàn, vậy tại sao Pháp nhãn lại phát sinh ngay trên chỗ ngồi đó? Chẳng phải những nhân duyên của Bồ-đề của Thanh văn và Bồ-đề của Độc Giác Phật là khác nhau, vì hai loại Bồ-đề này không có điểm chung sao?
Asādhāraṇā hi etā dve yathākkamaṃ pañcaṅgadvayaṅgasampattiyā, abhinīhārasamiddhivasena, pāramīsambharaṇakālavasena, abhisambujjhanavasena cāti?
Indeed, these two are not common, respectively, in terms of the five-fold and two-fold perfections, in terms of the success of the aspiration, in terms of the period of accumulating perfections, and in terms of awakening?
Thật vậy, hai loại này không có điểm chung theo thứ tự về sự thành tựu năm chi và hai chi, về sự thành tựu lời nguyện, về thời gian tích lũy ba-la-mật, và về cách giác ngộ sao?
Nāyaṃ virodho ito paratoyevassa paccekabodhisambhārānaṃ sambharaṇīyattā.
This is not a contradiction, because the accumulation of the requisites for Paccekabodhi is to be done from this point onwards.
Đây không phải là mâu thuẫn, vì sau kiếp này, các tích lũy của Độc Giác Bồ-đề sẽ được tích lũy cho vị ấy.
Sāvakabodhiyā bujjhanakasattāpi hi asati tassā samavāye kālantare paccekabodhiyā bujjhissanti tathābhinīhārassa sambhavatoti.
For even beings who would awaken to Savakabodhi, if the conditions for it are not met, will awaken to Paccekabodhi at a later time, because such an aspiration is possible.
Thật vậy, ngay cả những chúng sinh sẽ giác ngộ Bồ-đề của Thanh văn, nếu không có sự hội đủ của nó, thì trong một thời gian khác, họ cũng sẽ giác ngộ Bồ-đề của Độc Giác Phật, vì lời nguyện như vậy có thể xảy ra.
Apare pana bhaṇanti – ‘‘paccekabodhiyāyevāyaṃ rājā katābhinīhāro.
Others, however, say: “This king had indeed made his aspiration for Paccekabodhi.
Tuy nhiên, những người khác lại nói rằng: ‘Vị vua này đã phát nguyện cầu thành Bồ-đề Duyên Giác (Paccekabodhi) từ trước.
Katābhinīhārāpi hi tattha niyatimappattā tassa ñāṇassa paripākaṃ anupagatattā satthu sammukhībhāve sāvakabodhiṃ pāpuṇissantīti bhagavā ‘sacāyaṃ bhikkhave rājā’tiādimavoca, mahābodhisattānameva ca ānantariyaparimutti hoti, na itaresaṃ bodhisattānaṃ.
For even those who have made an aspiration for Paccekabodhi, if they have not attained fixed destiny and their knowledge has not matured, will attain Sāvakabodhi in the presence of the Teacher." Thus the Blessed One said, "If this king, bhikkhus..." etc., because only Mahābodhisattas are liberated from immediate retribution, not other bodhisattas.
Vì dù đã phát nguyện như vậy nhưng chưa đạt đến sự chắc chắn, do trí tuệ của vị ấy chưa viên mãn, nên khi gặp Đức Phật, vị ấy sẽ đạt được quả vị Thanh văn Bồ-đề (Sāvakabodhi). Do đó, Đức Thế Tôn đã nói: ‘Này chư Tỳ-kheo, nếu vị vua này…’, và sự giải thoát khỏi nghiệp vô gián chỉ dành cho các vị Đại Bồ-tát, chứ không dành cho các vị Bồ-tát khác.
Tathā hi paccekabodhiyaṃ niyato samāno devadatto cirakālasambhūtena lokanāthe āghātena garutarāni ānantariyakammāni pasavi, tasmā kammantarāyena ayaṃ idāni asamavetadassanābhisamayo rājā paccekabodhiniyāmena anāgate vijitāvī nāma paccekabuddho hutvā parinibbāyissatī’’ti daṭṭhabbaṃ, yuttataramettha vīmaṃsitvā gahetabbaṃ.
Thus Devadatta, who was fixed on Paccekabodhi, due to long-standing malice towards the World's Protector, committed extremely grave acts of immediate retribution. Therefore, due to the obstruction of kamma, this king, who currently has not yet penetrated the Dhamma (dassanābhisamaya), will in the future, by the destiny of Paccekabodhi, become a Paccekabuddha named Vijitāvī and attain final Nibbāna.” This should be understood. The more appropriate explanation here should be examined and adopted.
Quả thật, Devadatta, người đã được xác định sẽ thành Duyên Giác Bồ-đề, do lòng thù hận đã tích lũy từ lâu đối với Đấng Thế Tôn, đã tạo ra những nghiệp vô gián cực kỳ nặng nề. Vì vậy, do chướng ngại nghiệp, vị vua này hiện tại chưa thành tựu sự chứng ngộ chân lý, nhưng trong tương lai, với sự chắc chắn về Duyên Giác Bồ-đề, sẽ trở thành một vị Duyên Giác Phật tên là Vijitāvī và nhập Niết-bàn.’ Nên hiểu như vậy, và trong trường hợp này, cần phải suy xét kỹ càng để chấp nhận điều hợp lý hơn.”
Iti sumaṅgalavilāsiniyā dīghanikāyaṭṭhakathāya paramasukhumagambhīraduranubodhatthaparidīpanāya suvimalavipulapaññāveyyattiyajananāya ajjavamaddavasoraccasaddhāsatidhitibuddhikhantivīriyādidhammasamaṅginā sāṭṭhakathe piṭakattaye asaṅgāsaṃhiravisāradañāṇacārinā anekappabhedasakasamayasamayantaragahanajjhogāhinā mahāgaṇinā mahāveyyākaraṇena ñāṇābhivaṃsadhammasenāpatināmatherena mahādhammarājādhirājagarunā katāya sādhuvilāsiniyā nāma līnatthappakāsaniyā sāmaññaphalasuttavaṇṇanāya līnatthappakāsanā.
Thus ends the elucidation of profound meanings in the commentary on the Sāmaññaphalasutta, contained in the Līnatthappakāsanā named Sādhuvilāsinī, composed for the purpose of illuminating extremely subtle, deep, and difficult-to-understand meanings, and for generating excellent, pure, and extensive wisdom and mastery, by the Great Saṅgha Leader and Great Grammarian, the Elder named Ñāṇābhivaṃsa Dhammasenāpati, who possesses the qualities of straightforwardness, gentleness, pleasant conduct, faith, mindfulness, perseverance, wisdom, patience, energy, and other virtues, and whose knowledge roams unhindered, unashamed, and fearless through the three Piṭakas with their commentaries, and who has delved into the intricacies of various schools of thought, both his own and others, and who is the supreme teacher of great righteous kings.
Đó là phần giải thích các ý nghĩa ẩn sâu trong Chú giải Sāmaññaphala Sutta, được biên soạn bởi Đại Trưởng lão Ñāṇābhivaṃsa Dhammasenāpati, một bậc đại học giả, một vị đại sư có trí tuệ siêu việt, rộng lớn, trong sạch, có khả năng làm phát sinh sự tinh thông về trí tuệ, có đầy đủ các pháp như sự ngay thẳng, mềm mỏng, khiêm tốn, tín, niệm, trí, tuệ, nhẫn, tinh tấn, v.v., có trí tuệ không bị vướng mắc, không ngần ngại, không sợ hãi trong Tam Tạng Pīṭaka cùng với các Chú giải, có khả năng thâm nhập vào các giáo lý sâu xa của nhiều tông phái khác nhau, là Đạo sư của các vị Đại Pháp Vương, trong tác phẩm Līnatthappakāsanā tên là Sādhuvilāsinī, làm sáng tỏ những ý nghĩa sâu kín của Chú giải Dīgha Nikāya, Sumaṅgalavilāsinī, nhằm làm sáng tỏ những ý nghĩa vi diệu, thâm sâu, khó lãnh hội.
254. Evaṃ sāmaññaphalasuttaṃ saṃvaṇṇetvā idāni ambaṭṭhasuttaṃ saṃvaṇṇento yathānupubbaṃ saṃvaṇṇokāsassa pattabhāvaṃ vibhāvetuṃ, sāmaññaphalasuttassānantaraṃ saṅgītassa suttassa ambaṭṭhasuttabhāvaṃ pakāsetuṃ ‘‘evaṃ me sutaṃ…pe… kosalesūti ambaṭṭhasutta’’nti āha.
Having thus commented on the Sāmaññaphalasutta, the commentator now, intending to comment on the Ambaṭṭhasutta, and to make clear that the occasion for commentary has arrived in due order, and to announce that the Sutta recited after the Sāmaññaphalasutta is the Ambaṭṭhasutta, said: “Evaṃ me sutaṃ…pe… Kosalesūti Ambaṭṭhasuttaṃ” (Thus have I heard... etc., Kosala - this is the Ambaṭṭhasutta).
254. Sau khi giải thích Sāmaññaphala Sutta như vậy, bây giờ để giải thích Ambaṭṭha Sutta, và để làm rõ rằng thời điểm thích hợp để giải thích theo thứ tự đã đến, cũng như để công bố rằng Sutta được tụng sau Sāmaññaphala Sutta là Ambaṭṭha Sutta, vị Luận sư đã nói: “evaṃ me sutaṃ…pe… kosalesūti ambaṭṭhasutta” (Tôi đã nghe như vầy… tại xứ Kosala, đó là Ambaṭṭha Sutta).
Evamīdisesu.
Thus in such suttas.
Trong những Sutta tương tự như vậy.
Itisaddo cettha ādiattho, padatthavipallāsajotako pana itisaddo luttaniddiṭṭho, ādisaddalopo vā esa, upalakkhaṇaniddeso vā.
Here, the word “iti” has the meaning of 'and so on'. The word "iti" which indicates a reversal of meaning is elliptically expressed, or it is an elision of the word "ādi", or it is an indication by way of illustration.
Ở đây, từ “iti” có nghĩa là “vân vân”, còn từ “iti” biểu thị sự đảo ngữ của từ ngữ thì bị lược bỏ, hoặc đó là sự lược bỏ của từ “ādi” (vân vân), hoặc là sự chỉ định theo cách biểu trưng.
Apubbapadavaṇṇanā nāma heṭṭhā aggahitatāya apubbassa padassa atthavibhajanā.
"Apubbapadavaṇṇanā" (commentary on previously unmentioned terms) means the explanation of the meaning of a new term because it has not been taken up before.
“Apubbapadavaṇṇanā” có nghĩa là giải thích ý nghĩa của một từ chưa được đề cập trước đây.
‘‘Hitvā punappunāgata-matthaṃ atthaṃ pakāsayissāmī’’ti (dī. ni. aṭṭha. 1.ganthārambhakathā) hi vuttaṃ, ‘‘anupubbapadavaṇṇanā’’ti katthaci pāṭho, so ayuttova ṭīkāya anuddhaṭattā, tathā asaṃvaṇṇitattā ca.
For it was stated: "Having omitted repeated meanings, I will elucidate meaning after meaning." Some readings have "anupubbapadavaṇṇanā" (commentary on terms in due order), but that is inappropriate as it is not cited in the Ṭīkā and is not commented upon in that way.
Thật vậy, đã nói trong Nidānakathā của Chú giải Dīgha Nikāya: “Tôi sẽ giải thích từng ý nghĩa, bỏ qua những ý nghĩa đã được lặp đi lặp lại.” Ở một số bản, có đọc là “anupubbapadavaṇṇanā” (giải thích từng từ theo thứ tự), nhưng cách đọc đó không hợp lý vì không được trích dẫn trong Tīkā và cũng không được giải thích như vậy.
‘‘Rājakumārā gottavasena kosalā nāmā’’ti (dī. ni. ṭī. 1.254) ācariyena vuttaṃ.
The Teacher said: “The princes are named Kosalas by lineage.”
Vị Luận sư đã nói: “Các vị hoàng tử theo dòng họ được gọi là Kosala.”
Akkharacintakā pana vadanti ‘‘kosaṃ lanti gaṇhanti, kusalaṃ vā pucchantīti kosalā’’ti.
But grammarians say: “They gather (lanti) a treasury (kosaṃ), or they inquire (pucchanti) about what is skillful (kusalaṃ); therefore, they are Kosalas.”
Tuy nhiên, các nhà ngữ pháp lại nói rằng: “Họ gom góp kho tàng (kosaṃ lanti), hoặc hỏi về sự khéo léo (kusalaṃ pucchanti), nên được gọi là Kosala.”
Janapadinoti janapadavanto, janapadassa vā issarā.
Janapadino means those who possess districts, or rulers of districts.
Janapadino có nghĩa là những người có xứ sở, hoặc là những người cai quản xứ sở.
‘‘Kosalā nāma rājakumārā’’ti vutteyeva siddhepi ‘‘janapadino’’ti vacanaṃ santesupi aññesu taṃtaṃnāmapaññātesu tattha nivasantesu janapadibhāvato tesameva nivasanamupādāya janapadassāyaṃ samaññāti dassanatthaṃ.
Even though it is established by saying "rājakumārā Kosalā nāma" (princes named Kosalas), the statement "janapadino" is made to show that this designation of the district arises from the dwelling of these very people, because they are district-dwellers (janapadino), even when there are others known by those names who reside there.
Dù đã rõ khi nói “các vị hoàng tử tên là Kosala”, nhưng việc thêm từ “janapadino” là để chỉ rõ rằng tên gọi này của xứ sở là do sự cư trú của chính những vị hoàng tử đó, mặc dù có những người khác cũng sống ở đó và được biết đến với những tên gọi khác.
‘‘Tesaṃ nivāso’’ti iminā ‘‘kosalānaṃ nivāsā kosalā’’ti taddhitaṃ dasseti.
By “Tesaṃ nivāso” (Their dwelling place), the Taddhita suffix (in Kosala) is shown to mean “the dwelling place of the Kosalas is Kosala.”
Với câu “Tesaṃ nivāso” (nơi cư trú của họ), từ này cho thấy sự biến cách taddhita: “Kosala là nơi cư trú của các vị Kosala.”
‘‘Ekopi janapado’’ti iminā pana saddatoyevetaṃ puthuvacanaṃ, atthato panesa eko evāti vibhāveti.
By “Ekopi janapado” (even one district), it is clarified that this plural form is merely linguistic, but in reality, it is only one district.
Tuy nhiên, với câu “Ekopi janapado” (dù chỉ một xứ sở), câu này làm rõ rằng về mặt từ ngữ, đó là số nhiều, nhưng về mặt ý nghĩa, đó chỉ là một xứ sở.
Api-saddo cettha anuggahe, tena kāmaṃ ekoyevesa janapado, tathāpi iminā kāraṇena puthuvacanamupapannanti anuggaṇhāti.
Here, the word “api” is for emphasis. By it, although this district is indeed one, still, due to this reason, the plural form is admissible—this is emphasized.
Ở đây, từ “api” có ý nghĩa hỗ trợ, theo đó, mặc dù xứ sở này chỉ là một, nhưng vì lý do này, số nhiều vẫn được chấp nhận.
Yadi ekova janapado, kathaṃ tattha bahuvacananti āha ‘‘ruḷhisaddenā’’tiādi, ruḷhisaddattā bahuvacanamupapannanti vuttaṃ hoti.
If it is only one district, how can there be a plural form there? He replies by saying “ruḷhisaddena” (by common usage), and so on, meaning that the plural form is admissible due to common usage.
Nếu chỉ là một xứ sở, tại sao lại dùng số nhiều ở đó? Vị Luận sư đã nói: “ruḷhisaddenā” (theo cách dùng thông thường), v.v. Điều đó có nghĩa là do cách dùng thông thường, số nhiều là hợp lý.
Nissitesu payuttassa puthuvacanassa, puthubhāvassa vā nissaye abhiniropanā idha ruḷhi, tena vuttaṃ ācariyena idha ceva aññattha ca majjhimāgamaṭīkādīsu ‘‘akkharacintakā hi īdisesu ṭhānesu yutte viya īdisaliṅgavacanāni icchanti, ayamettha ruḷhi yathā ‘aññatthāpi kurūsu viharati, aṅgesu viharatī’ti cā’’ti.
Here, ruḷhi (common usage) refers to the imputation of the plural form or plurality to the substratum (nissaya) when the plural is used with those who are dependent. Therefore, the Teacher said here and elsewhere, such as in the Majjhimāgamaṭīkā, that “grammarians desire such genders and numbers in such places, just as they would consider appropriate, and this is the common usage here, as in ‘he dwells in the Kurus elsewhere,’ and ‘he dwells in the Aṅgas,’ and so on.”
Ở đây, “ruḷhi” (cách dùng thông thường) là sự gán ghép số nhiều, hoặc sự đa dạng, vào một từ chỉ sự nương tựa, được dùng cho những đối tượng nương tựa. Do đó, vị Luận sư đã nói ở đây và ở những nơi khác, như trong Majjhimāgamaṭīkā, v.v.: “Thật vậy, các nhà ngữ pháp mong muốn những giới tính và số từ như vậy là hợp lý ở những trường hợp như thế này; đây là cách dùng thông thường ở đây, giống như ‘aññatthāpi kurūsu viharati, aṅgesu viharatī’ti cā” (cũng ở những nơi khác, Ngài trú tại xứ Kuru, Ngài trú tại xứ Aṅga).
Keci pana kosalanāmābhiniropanamicchanti, ayuttametaṃ puthuvacanassa appayujjitabbattā.
Some, however, desire the attribution of the name Kosala, but this is inappropriate because the plural form should not be used.
Tuy nhiên, một số người lại muốn gán ghép tên gọi Kosala, nhưng điều này không hợp lý vì không nên dùng số nhiều.
Nāmābhiniropanāya hi ekavacanampi bhavati yathā ‘‘sīho gāyatī’’ti.
For the attribution of a name, even the singular form is used, as in “the lion sings.”
Thật vậy, đối với sự gán ghép tên gọi, số ít cũng có thể được dùng, ví dụ như “sīho gāyatī” (con sư tử hát).
Tabbisesitepi janapadasadde jātisaddattā ekavacanameva.
Even when the word janapada (district) is specified by that (Kosala), it remains in the singular form because it is a generic term.
Ngay cả khi từ “janapada” được xác định bởi từ đó, nó vẫn là số ít vì là từ chỉ loài.
Tenāha ‘‘tasmiṃ kosalesu janapade’’ti, kosalanāmake tasmiṃ janapadeti attho.
Therefore, he said, “tasmiṃ kosalesu janapade” (in that district of Kosala), meaning in that district named Kosala.
Do đó, vị Luận sư đã nói: “tasmiṃ kosalesu janapade” (tại xứ sở Kosala đó), có nghĩa là tại xứ sở tên là Kosala đó.
Abhūtato hi vohāramattaṃ ruḷhi, bhūtatoyeva attho vinicchinitabbo.
For common usage (ruḷhi) is merely a conventional expression from what is unreal, but the meaning should be determined from what is real.
Thật vậy, “ruḷhi” chỉ là một cách gọi không có thật, ý nghĩa phải được xác định từ sự thật.
Yathā hi –
Just as—
Giống như –
Taṃputtasaṅkhātassa ekatthassa ruḷhivasena ‘‘puttā’’ti bahuvacanapayogo, tathā idhāpi tannivāsasaṅkhātassa ekatthassa ruḷhivasena ‘‘kosalesū’’ti bahuvacanapayogo hoti.
Here, the plural form “puttā” (sons) is used by convention for a single meaning, namely, "their son." Similarly, here too, the plural form “kosalesu” is used by convention for a single meaning, namely, "their dwelling place."
Ở đó, từ “puttā” (các con) được dùng ở số nhiều theo cách dùng thông thường cho một ý nghĩa duy nhất là “những người con đó”. Tương tự, ở đây, từ “kosalesu” (tại xứ Kosala) cũng được dùng ở số nhiều theo cách dùng thông thường cho một ý nghĩa duy nhất là “nơi cư trú của họ”.
Yathā ca ‘‘pāṇaṃ na haññe, na ca’dinnamādiye’’tiādīsu (a. ni. 8.42, 43, 45) jātivasena bahvatthānamekavacanapayogo, tathā idhāpi jātivasena avayavappabhedena bahvatthassa ‘‘janapade’’ti ekavacanapayogo hoti.
And just as in “One should not harm a living being, nor take what is not given,” and so on, the singular form is used for many meanings due to the generic sense, so too here, the singular form “janapade” (in the district) is used for a multitude of meanings due to specific parts in a generic sense.
Và giống như trong “pāṇaṃ na haññe, na ca’dinnamādiye” (không nên sát sinh, cũng không nên lấy của không cho) và những câu tương tự, từ số ít được dùng cho nhiều ý nghĩa theo cách chỉ chung loại; tương tự, ở đây, từ “janapade” (tại xứ sở) cũng được dùng ở số ít cho một ý nghĩa có nhiều phần tử theo cách chỉ chung loại.
Vuttañca ācariyena majjhimāgamaṭīkāyaṃ ‘‘tabbisesanepi janapadasadde jātisadde ekavacanameva.
And the Teacher said in the Majjhimāgamaṭīkā: “Even in the word janapada, which is specified by that, it is in the singular form because it is a generic word.
Vị Luận sư cũng đã nói trong Majjhimāgamaṭīkā: “Ngay cả khi từ ‘janapada’ được xác định bởi từ đó, nó vẫn là số ít vì là từ chỉ loài.
Tenāha ‘tasmiṃ aṅgesu janapade’ti’’.
Therefore, he said, ‘in that district of Aṅga’.”
Do đó, Ngài đã nói ‘tasmiṃ aṅgesu janapade’ (tại xứ sở Aṅga đó).”
Evaṃ ruḷhivasena bahumhi viya vattabbe bahuvacanaṃ dassetvā idāni bahvatthavasena bahumpi eva vattabbe bahuvacanaṃ dassento ‘‘porāṇā panāhū’’tiādimāha.
Having thus shown the plural form used as if for many by common usage, he now begins by saying “Porāṇā panāhū” (The ancients, however, said), and so on, to show the plural form used for many based on multiple meanings.
Sau khi trình bày cách dùng số nhiều theo cách dùng thông thường, như thể nói về nhiều thứ, bây giờ để trình bày cách dùng số nhiều khi thực sự nói về nhiều ý nghĩa, vị Luận sư đã nói: “porāṇā panāhū” (nhưng các vị cổ đức đã nói), v.v.
Pana-saddo cettha visesatthajotano, tena puthuatthavisayatāya evetaṃ puthuvacanaṃ, na ruḷhivasenāti vakkhamānaṃ visesaṃ joteti.
Here, the word “pana” indicates a special meaning. By it, it illuminates the special point to be stated, namely, that this plural form (Kosalesu) refers to multiple objects, not merely common usage.
Ở đây, từ “pana” làm sáng tỏ ý nghĩa đặc biệt, theo đó, nó làm rõ sự đặc biệt sẽ được nói đến, rằng từ số nhiều này là do có nhiều ý nghĩa khác nhau, chứ không phải do cách dùng thông thường.
So hi padeso tiyojanasataparimāṇatāya bahuppabhedoti, imasmiṃ pana naye tesu kosalesu janapadesūti attho veditabbo.
For that region, being three hundred yojanas in extent, had many divisions. In this approach, therefore, the meaning should be understood as “in those districts of the Kosalas.”
Thật vậy, xứ sở đó có nhiều loại khác nhau với diện tích ba trăm dojana, và theo cách này, cần hiểu rằng ý nghĩa là “tại những xứ sở Kosala đó”.
Mahāpanādanti mahāpanādajātaka (jā. 1.3.40, 41, 42) surucijātakesu (jā. 1.14.102 ādayo) āgataṃ surucino nāma videharañño puttaṃ mahāpanādanāmakaṃ rājakumāraṃ.
Mahāpanādaṃ refers to the prince named Mahāpanāda, the son of King Suruci of Videha, as mentioned in the Mahāpanāda Jātaka and Suruci Jātaka.
Mahāpanāda là hoàng tử tên Mahāpanāda, con trai của vua Videha tên Suruci, được đề cập trong Mahāpanāda Jātaka và Suruci Jātaka.
Nānānāṭakānīti bhaṇḍukaṇḍapaṇḍukaṇḍapamukhāni chasatasahassāni nānāvidhanāṭakāni, katthaci pana ādisaddopi diṭṭho, so jātakaṭṭhakathāyaṃ na dissati, yadi ca dissati, tena naṭalaṅghakādīnaṃ saṅgaho daṭṭhabbo.
Nānānāṭakānīti refers to six hundred thousand performers of various kinds of plays, with Bhaṇḍukaṇḍa and Paṇḍukaṇḍa as their leaders. In some texts, however, the word ādi is also seen. It is not found in the Jātaka Commentary, but if it is seen, then the inclusion of dancers, acrobats, and so forth should be understood by that*.
Nānānāṭakānīti có nghĩa là sáu trăm ngàn loại hình biểu diễn khác nhau, do các diễn viên chính như Bhaṇḍukaṇḍa và Paṇḍukaṇḍa dẫn đầu. Ở một số bản, có thấy từ ādi (vân vân), nhưng trong Chú giải Jātaka thì không thấy. Nếu có thấy, thì nên hiểu rằng nó bao gồm cả các diễn viên nhào lộn và những người khác.
Sitamattampīti mihitamattampi.
Sitamattampīti means merely a smile.
Sitamattampīti có nghĩa là chỉ một nụ cười.
Tassa kira dibbanāṭakānaṃ anantarabhaveyeva diṭṭhattā manussanāṭakānaṃ naccaṃ amanuññaṃ ahosi.
It is said that because he had seen divine plays in his immediately preceding existence, human plays were not pleasing to him.
Nghe nói, vì hoàng tử ấy đã từng thấy các điệu múa của chư thiên trong kiếp sống ngay trước đó, nên điệu múa của con người trở nên không còn đẹp đẽ nữa.
Naṅgalānipi chaḍḍetvāti kasikammappahānavasena naṅgalāni pahāya, nidassanamattañcetaṃ.
Naṅgalānipi chaḍḍetvāti means by abandoning the act of tilling, having given up ploughs. This is merely an example.
Naṅgalānipi chaḍḍetvāti có nghĩa là từ bỏ cày bừa do từ bỏ công việc đồng áng. Đây chỉ là một ví dụ.
Na hi kevalaṃ kassakā eva, atha kho aññepi ubhayaraṭṭhavāsino manussā attano attano kiccaṃ pahāya tasmiṃ maṅgalaṭṭhāne sannipatiṃsu.
It was not only the farmers, but also other people residing in both countries who gave up their respective tasks and assembled at that auspicious place.
Không chỉ có những người nông dân, mà những người dân ở cả hai quốc gia khác cũng từ bỏ công việc của mình và tụ tập tại nơi lễ hội đó.
Tadā kira mahāpanādakumārassa pāsādamaṅgalaṃ, chattamaṅgalaṃ, āvāhamaṅgalanti tīṇi maṅgalāni ekato akaṃsu, kāsivideharaṭṭhavāsinopi tattha sannipatitvā atirekasattavassāni chaṇamanubhaviṃsūti, adhunā pana ‘‘naṅgalādīnī’’ti pāṭho dissati, so na porāṇapāṭho ṭīkāyamanuddhaṭattā.
At that time, it is said, three ceremonies—the ceremony of the palace, the ceremony of the parasol, and the wedding ceremony—were performed simultaneously for Prince Mahāpanāda. Even the residents of Kāsī and Videha assembled there and enjoyed the festival for more than seven years. Currently, however, the reading “naṅgalādīnī” (ploughs, etc.) is seen; this is not an ancient reading because it is not quoted in the Tīkā.
Khi đó, người ta đã tổ chức ba lễ hội cùng một lúc cho hoàng tử Mahāpanāda: lễ khánh thành cung điện, lễ đăng quang và lễ thành hôn. Người dân từ các xứ Kāsī và Videha cũng tụ tập ở đó và hưởng thụ lễ hội kéo dài hơn bảy năm. Hiện nay, có một bản đọc là "naṅgalādīnī" (cày bừa và những thứ khác), nhưng đó không phải là bản đọc cổ vì nó không được trích dẫn trong Chú giải.
Mahājanakāye sannipatiteti keci ‘‘pahaṃsanavidhiṃ dassetvā rājakumāraṃ hāsāpessāmā’’ti, keci ‘‘taṃ kīḷanaṃ passissāmā’’ti evaṃ mahājanasamūhe sannipatite.
Mahājanakāye sannipatiteti means when a large assembly of people had gathered, some thinking, “We will make the prince laugh by showing him entertaining displays,” and others thinking, “We will watch that performance.”
Mahājanakāye sannipatiteti có nghĩa là khi một đám đông lớn tụ tập, một số người nghĩ "chúng ta sẽ biểu diễn trò vui để làm hoàng tử cười", một số người nghĩ "chúng ta sẽ xem trò chơi đó".
Atulambābhiruhanadārucitakapavesanādi nānākīḷāyo dassetvā. Sakkapesito kira dibbanāṭako rājaṅgaṇe ākāse ṭhatvā upaḍḍhabhāgaṃ nāma dasseti, ekova hattho, eko pādo, ekaṃ akkhi, ekā dāṭhā naccati calati, upaḍḍhaṃ phandati, sesaṃ niccalamahosi, taṃ disvā mahāpanādo thokaṃ hasitamakāsi, imamatthaṃ sandhāya ‘‘so dibbanāṭakaṃ dassetvā hasāpesī’’ti vuttaṃ.
Nānākīḷāyo dassetvā means having shown various plays such as climbing an immensely tall mango tree and entering a wooden effigy. It is said that the divine dancer sent by Sakka stood in the sky in the royal courtyard and showed half of his body. Only one hand, one foot, one eye, and one tusk danced and moved; half of his body quivered, while the rest remained motionless. Seeing that, Mahāpanāda smiled slightly. Referring to this matter, it is said, “so dibbanāṭakaṃ dassetvā hasāpesī” (he made him laugh by showing him a divine play).
Nānākīḷāyo dassetvā (biểu diễn nhiều trò chơi khác nhau) như leo cây xoài cao vút, vào hình nộm gỗ, v.v. Nghe nói, diễn viên chư thiên do Sakkā (Đế Thích) phái đến đã đứng trên không trung tại sân hoàng cung và biểu diễn phần nửa thân: chỉ một tay, một chân, một mắt, một răng nanh cử động và nhảy múa; nửa thân còn lại bất động. Thấy vậy, Mahāpanāda đã cười một chút. Nhấn mạnh ý này, nên mới nói "so dibbanāṭakaṃ dassetvā hasāpesī" (người ấy đã làm cho cười bằng cách biểu diễn điệu múa của chư thiên).
Suhajjā nāma vissāsikā ‘‘suṭṭhu hadayametesa’’nti katvā.
Suhajjā are called intimate friends, because “they have good hearts” (suṭṭhu hadayametesaṃ).
Suhajjā là những người thân tín, vì "họ có trái tim tốt".
Ādisaddena ñātakaparijanādīnaṃ saṅgaho.
By the word ādi, relatives, attendants, and so forth are included.
Với từ Ādi (vân vân), bao gồm cả bà con, quyến thuộc, v.v.
Tasmāti tathā vacanato.
Tasmāti means because it was so (i.e., because of the aforementioned manner).
Tasmāti (do đó) là vì lý do ấy.
Taṃ kusalanti vacanaṃ upādāyāti ettha ‘‘kacci kusalaṃ?
Taṃ kusalanti vacanaṃ upādāyāti. In this regard, when asked, “Is all well (kacci kusalaṃ)?”
Taṃ kusalanti vacanaṃ upādāyāti (lấy lời "kusala" đó làm căn cứ), ở đây, khi hỏi "Kacci kusalaṃ?" (Có khỏe không?), họ đáp "Āma kusalaṃ" (Vâng, khỏe). Do sự trao đổi lời nói như vậy, những người ấy ban đầu đã được gọi là "kusalā" (người khỏe mạnh).
Āma kusala’’nti vacanapaṭivacanavasena pavattakusalavāditāya te manussā ādito ‘‘kusalā’’ti samaññaṃ labhiṃsu, tesaṃ kusalānaṃ issarāti rājakumārā kosalā nāma jātā, tesaṃ nivāsaṭṭhānatāya pana padeso kosalāti pubbe vuttanayameva.
and they replied, “Yes, all is well (āma kusalaṃ),” due to this exchange of words where they customarily used kusala, those people originally gained the designation “kusalā.” The princes, being the masters of these kusalā people, came to be known as Kosalā. And the region, being their dwelling place, was named Kosalā, in the manner explained previously.
Các hoàng tử là chủ nhân của những người kusala đó, nên họ được gọi là kosalā. Còn vùng đất đó được gọi là kosalā vì là nơi cư trú của họ, như đã nói trước đây.
Tenāha ‘‘so padeso kosalāti vuccatī’’ti.
Therefore, it is said, “So padeso kosalāti vuccati” (That region is called Kosalā).
Do đó, có câu "so padeso kosalāti vuccatī" (vùng đất đó được gọi là Kosalā).
Evaṃ majjhimāgamaṭīkāyaṃ ācariyeneva vuttaṃ.
Thus, it was stated by the venerable teacher in the Majjhimāgamaṭīkā.
Điều này đã được chính vị thầy nói trong Majjhimāgamaṭīkā.
Tatrāyamadhippāyo siyā – ‘‘so padeso kosalāti vuccatī’’ti saññīsaññā yathākkamaṃ ekavacanabahuvacanavasena vuttattā purimanaye viya idhāpi ruḷhivaseneva bahuvacanaṃ hoti.
The intention here might be: in "so padeso kosalāti vuccati," since the nominative and the predicated nouns are expressed in singular and plural respectively, the plural form is used due to common usage, as in the previous explanation.
Ở đây có thể có ý nghĩa là: "so padeso kosalāti vuccatī" (vùng đất đó được gọi là Kosalā) được nói với số ít và số nhiều theo thứ tự của danh từ và tên gọi, nên ở đây cũng dùng số nhiều theo cách dùng thông thường như trường hợp trước.
Rājakumārānaṃ nāmalābhahetumattañhettha visesoti.
The distinctive point here is merely the cause for the princes' gaining their name.
Sự khác biệt ở đây chỉ là nguyên nhân của việc các hoàng tử có được tên gọi.
Idha pana ācariyena evaṃ vuttaṃ so padesoti padesasāmaññato vuttaṃ, vacanavipallāsena vā, te padesāti attho.
However, here it is stated by the teacher, “so padeso” is said in a general sense of region, or due to a change in number (vacanavipallāsena vā), meaning "those regions."
Tuy nhiên, ở đây vị thầy đã nói như sau: so padeso được nói theo nghĩa chung của vùng đất, hoặc do sự đảo ngữ, có nghĩa là "những vùng đất đó".
Kosalāti vuccati kusalā eva kosalāti katvā’’ti (dī. ni. ṭī. 1.254) tatrāyamadhippāyo siyā – so padesoti jātisaddavasena, vacanavipallāsena vā vuttattā puthuatthavisayatāya eva bahuvacanaṃ hoti.
Kosalāti vuccati means "Kosalā are indeed Kusalā" (kusalā eva kosalāti katvā). The intention here might be: so padeso is said in the sense of a class-noun, or due to a change in number, hence the plural form is used precisely because it refers to multiple distinct entities.
Kosalāti vuccati (được gọi là Kosalā) vì "chính những người kusala là kosala". Ở đây có thể có ý nghĩa là: so padeso được nói theo nghĩa của danh từ chỉ chủng loại, hoặc do sự đảo ngữ, nên số nhiều xảy ra chỉ do sự đa dạng về ý nghĩa.
Padesassa nāmalābhahetu hettha visesoti.
The distinctive point here is the reason for the region's gaining its name.
Sự khác biệt ở đây là nguyên nhân của việc vùng đất có được tên gọi.
‘‘Kusala’’nti hi vacanamupādāya ruḷhināmavasena vuttanayena kosalā yathā ‘‘yevāpanakaṃ, natumhākavaggo’’ti.
The term "Kosalā" is derived from the word "kusala," signifying a common usage, similar to "yevāpanakaṃ, na tumhākavaggo."
Thật vậy, lấy từ "kusala" làm căn cứ, theo cách dùng thông thường, các Kosala cũng như "yevāpanakaṃ, natumhākavaggo" (chỉ là những thứ vặt vãnh, không phải nhóm của các người).
Apica vacanapaṭivacanavasena ‘‘kusala’’nti vadanti etthāti kosalā. Vicitrā hi taddhitavuttīti.
Furthermore, they are called Kosalā because they say "kusala" in their exchange of words. For, indeed, the formation of secondary derivatives (taddhitavutti) is diverse.
Hơn nữa, ở đây người ta nói "kusala" qua lại trong đối thoại, nên gọi là kosalā. Thật vậy, cách dùng của taddhita (hậu tố phái sinh) rất đa dạng.
Kusalanti ca ārogyaṃ ‘‘kacci nu bhoto kusalaṃ, kacci bhoto anāmaya’’ntiādīsu (jā. 1.15.145; jā. 2.20.129) viya, kacci tumhākaṃ ārogyaṃ hotīti attho, chekaṃ vā ‘‘kusalā naccagītassa, sikkhitā cāturitthiyo’’tiādīsu (jā. 2.22.94) viya, kacci tesaṃ nāṭakānaṃ chekatā hotīti attho.
And kusala means health, as in phrases like “kacci nu bhoto kusalaṃ, kacci bhoto anāmayaṃ” (is Master well, is Master healthy?), meaning, “Is health for you, Master?” Or it means skillful, as in “kusalā naccagītassa, sikkhitā cāturitthiyo” (the four trained women are skilled in dancing and singing), meaning, “Are those dancers skillful?”
Và kusala có nghĩa là sức khỏe, như trong các câu "kacci nu bhoto kusalaṃ, kacci bhoto anāmaya" (Thưa ngài có khỏe không, thưa ngài có bình an không?) có nghĩa là "ngài có khỏe không?". Hoặc có nghĩa là khéo léo, như trong các câu "kusalā naccagītassa, sikkhitā cāturitthiyo" (bốn người phụ nữ khéo léo trong ca múa) có nghĩa là "họ có khéo léo trong các điệu múa đó không?".
Caraṇaṃ cārikā, caraṇaṃ vā cāro, so eva cārikā, tayidaṃ maggagamanameva idhādhippetaṃ, na cuṇṇikagamanamattanti dassetuṃ ‘‘addhānagamana’’nti vuttaṃ, bhāvanapuṃsakañcetaṃ, addhānagamanasaṅkhātāya cārikāya caramānoti vuttaṃ hoti, abhedepi vā bhedavohārena vuttaṃ yathā ‘‘divāvihāraṃ nisīdī’’ti, (ma. ni. 1.256) addhānagamanasaṅkhātaṃ cārikaṃ caramāno, caraṇaṃ karontoti attho.
Moving about (caraṇaṃ) is cārikā; or moving about (caraṇaṃ) is cāra, and that very cāra is cārikā. To show that only travelling on a path is intended here, not just moving about gently, it is said “addhānagamanaṃ.” This is a gerundive in the neuter gender. Thus, it is said that he wanders on a pilgrimage (cārikā) which is called travelling a long distance. Or it is said by way of a distinction of speech where there is no distinction, as in “divāvihāraṃ nisīdī” (he sat down for a day's rest). Cārikaṃ caramāno means performing the act of wandering, which is called travelling a long distance.
Hành trình cārikā, hoặc hành trình là cāro, chính là cārikā đó. Để chỉ ra rằng ở đây ý muốn nói về việc đi đường dài, chứ không phải chỉ là việc đi lại nhẹ nhàng, đã nói "addhānagamanaṃ" (đi đường dài). Đây là danh từ hành động trung tính, có nghĩa là "đang đi trên con đường dài được gọi là cārikā". Hoặc, trong trường hợp không có sự phân biệt, được nói bằng cách dùng từ phân biệt, như "divāvihāraṃ nisīdī" (ngồi nghỉ ban ngày). Cārikaṃ caramāno (đang đi cārikā) là "đang thực hiện hành trình được gọi là đi đường dài", có nghĩa là "đang đi".
Sabbatthako hi karabhūdhātūnamatthoti.
For the root kar and bhū have meaning everywhere.
Thật vậy, các động từ kara và bhū có ý nghĩa bao quát.
‘‘Addhānamagga’’ntipi katthaci pāṭho, so na sundaro.
In some places, the reading is also “addhānamaggaṃ,” but that is not good.
Ở một số nơi, cũng có bản đọc là "addhānamaggaṃ", nhưng đó không phải là bản tốt.
Na hi cārikāsaddo maggavācakoti.
For the word cārikā does not denote a path.
Vì từ cārikā không có nghĩa là con đường.
Idāni taṃ vibhāgena dassetvā idhādhippetaṃ niyamento ‘‘cārikā ca nāmesā’’tiādimāha.
Now, showing it by way of distinction and specifying what is intended here, he states “cārikā ca nāmesā” and so forth.
Bây giờ, để trình bày rõ ràng điều đó và xác định ý nghĩa được mong muốn ở đây, đã nói "cārikā ca nāmesā" (và đây được gọi là cārikā), v.v.
Sāvakānampi ruḷhivasena cārikāya sambhavato tato viseseti ‘‘bhagavato’’ti iminā.
Since wandering (cārikā) can also apply to disciples by common usage, it is distinguished from that by the word “bhagavato.”
Vì các đệ tử cũng có thể đi cārikā theo nghĩa thông thường, nên đã phân biệt bằng từ "bhagavato" (của Đức Thế Tôn).
Tathā hi majjhimāgamaṭṭhakathāyaṃ vuttaṃ ‘‘cārikaṃ caramānoti ettha kiñcāpi ayaṃ cārikā nāma mahājanasaṅgahatthaṃ buddhānaṃyeva labbhati, buddhe upādāya pana ruḷhisaddena sāvakānampi vuccati kilañjādīhi katabījanīpi tālavaṇṭaṃ viyā’’ti.
Thus, it is stated in the Majjhimāgamaṭṭhakathā: “Regarding ‘cārikaṃ caramāno,’ although this wandering (cārikā) is available only to Buddhas for the purpose of benefiting many people, by conventional usage, it is also applied to disciples, just as a fan made of grass, etc., is also called a palm-leaf fan.”
Thật vậy, trong Majjhimāgamaṭṭhakathā đã nói: "Trong câu 'cārikaṃ caramāno' (đang đi cārikā), mặc dù cārikā này chỉ được dùng cho các vị Phật với mục đích giáo hóa chúng sinh, nhưng theo cách dùng thông thường, nó cũng được nói cho các đệ tử, giống như chiếc quạt được làm từ lá cây kilanja, v.v., cũng được gọi là quạt lá cọ."
Dūrepīti ettha pi-saddena, api-saddena vā nātidūrepīti sampiṇḍanaṃ tatthāpi cārikāsambhavato.
In dūrepīti, by the particle pi or api, it comprehensively indicates “not too far either,” since wandering is also possible there.
Trong câu Dūrepīti (ngay cả ở xa), với từ pi hoặc api, bao gồm cả "không quá xa", vì cārikā cũng có thể xảy ra ở đó.
Bodhaneyyapuggalanti catusaccapaṭivedhavasena bodhanārahapuggalaṃ.
Bodhaneyyapuggalaṃ means a person worthy of awakening through the penetration of the Four Noble Truths.
Bodhaneyyapuggalaṃ (người có thể được giác ngộ) là người xứng đáng được giác ngộ bằng cách thấu hiểu Tứ Thánh Đế.
Sahasā gamananti sīghagamanaṃ.
Sahasā gamanaṃ means swift going.
Sahasā gamanaṃ (đi nhanh) là đi mau lẹ.
‘‘Mahākassapassa paccuggamanādīsū’’ti vuttameva sarūpato dasseti ‘‘bhagavā hī’’tiādinā.
He graphically illustrates what was already stated in brief as “Mahākassapassa paccuggamanādīsu” (in the instances of going forth to meet Mahākassapa, etc.) with “bhagavā hī” and so forth.
Những điều đã nói như "Mahākassapassa paccuggamanādīsū" (việc đi đón Mahākassapa, v.v.) được trình bày chi tiết bằng cách bắt đầu bằng "bhagavā hī" (Thật vậy, Đức Thế Tôn), v.v.
Paccuggacchantoti paṭimukhaṃ gacchanto, paccuṭṭhahantoti attho.
Paccuggacchantoti means going forth to meet, that is, going to receive.
Paccuggacchantoti có nghĩa là "đi đối mặt", tức là "đi đón tiếp".
‘‘Tathā’’ti iminā ‘‘tiṃsayojana’’nti padamanukaḍḍhati.
By “Tathā,” the word “tiṃsayojana” (thirty yojanas) is drawn in.
Với từ "Tathā" (như vậy), kéo theo từ "tiṃsayojana" (ba mươi dojana).
Pakkusāti nāma gandhārarājā.
Pakkusāti is the name of the king of Gandhāra.
Pakkusāti là tên của vua Gandhāra.
Mahākappino nāma kukkuṭavatīrājā.
Mahākappino is the name of the king of Kukkuṭavatī.
Mahākappino là tên của vua Kukkuṭavatī.
Dhaniyo nāma koraṇḍaseṭṭhiputto gopo.
Dhaniyo is the name of the cowherd, the son of the treasurer Koraṇḍa.
Dhaniyo là người chăn bò, con trai của phú hộ Koraṇḍa.
Evaṃ dhammagarutākittanamukhena mahākassapapaccuggamanādīni (saṃ. ni. aṭṭha. 2.154) ekadesena dassetvā idāni vanavāsitissasāmaṇerassa vatthuṃ vitthāretvā cārikaṃ dassetuṃ ‘‘ekadivasa’’ntiādi āraddhaṃ.
Having thus shown the instances of going forth to meet Mahākassapa and so forth in part, by way of proclaiming respect for the Dhamma, he now begins with “ekadivasa” (one day) and so forth, to elaborate on the story of the novice Tissa of Vanavāsa and to explain the meaning of cārikā.
Sau khi trình bày một phần các sự kiện như việc đi đón Mahākassapa, v.v., thông qua việc tán dương sự tôn kính Pháp, bây giờ để trình bày cārikā bằng cách kể chi tiết câu chuyện về Tissa sāmaṇera sống trong rừng, đã bắt đầu bằng "ekadivasa" (một ngày nọ), v.v.
Ko panesa tissasāmaṇero nāma?
Who, then, is this novice Tissa?
Vậy Tissa sāmaṇera này là ai?
Sāvatthiyaṃ dhammasenāpatino upaṭṭhākakule jāto mahāpuñño ‘‘piṇḍapātadāyakatisso, kambaladāyakatisso’’ti ca pubbe laddhanāmo pacchā ‘‘vanavāsitisso’’ti pākaṭo khīṇāsavasāmaṇero.
He was a very meritorious arahant-novice who was born in Sāvatthī in the family of the lay supporter of the General of the Dhamma (Sāriputta Thera), previously named Piṇḍapātadāyaka Tissa and Kambaladāyaka Tissa, and later became famous as Vanavāsa Tissa.
Vị ấy là một sāmaṇera đã diệt tận lậu hoặc (khīṇāsava) nổi tiếng, sinh ra trong gia đình hộ độ của Pháp tướng (Dhammasenāpati) ở Sāvatthī, có phước báu lớn, trước đây được gọi là "Piṇḍapātadāyaka Tissa" (Tissa người cúng dường vật thực khất thực) và "Kambaladāyaka Tissa" (Tissa người cúng dường chăn mền), sau này được biết đến là "Vanavāsī Tissa" (Tissa người sống trong rừng).
Vitthāro dhammapade (dha. pa. aṭṭha. 1.74 vanavāsītissasāmaṇeravatthu).
The full account is in the Dhammapada.
Chi tiết được tìm thấy trong Dhammapada (Dhammapada Aṭṭhakathā 1.74, câu chuyện về Vanavāsī Tissa Sāmaṇera).
Ākāsagāmīhi saddhiṃ ākāseneva gantukāmo bhagavā ‘‘chaḷabhiññānaṃ ārocehī’’ti avoca.
The Blessed One, desiring to go by air with those who could travel through the air, said, “Inform those with the six supernormal powers.”
Đức Thế Tôn, vì muốn đi trên không trung cùng với các vị có thần thông (ākāsagāmī), đã nói: "Hãy báo cho các vị có sáu thắng trí (chaḷabhiññā) biết."
Tassāti tissasāmaṇerassa.
Tassāti means of the novice Tissa.
Tassā là của Tissa sāmaṇera.
Tanti bhagavantaṃ saddhiṃ bhikkhusaṅghena cīvaraṃ pārupantaṃ.
“That” refers to the Blessed One, together with the community of bhikkhus, wearing the robe.
Ta (nghĩa là) Đức Thế Tôn đang đắp y cùng với Tăng đoàn tỳ khưu.
No thero no oramattako vatāti sambandho, guṇena lāmakappamāṇiko no hotīti attho.
“Not an elder, not one of mean measure” is the connection; the meaning is that he is not an elder of base standing in terms of virtue.
Có sự liên kết là: “Vị Trưởng lão của chúng ta không phải là người thấp kém”. Ý nghĩa là: Ngài không phải là một Trưởng lão có phẩm hạnh thấp kém.
Tāyāti araññasaññāya.
“With that” means with the perception of a forest.
Tāyā (nghĩa là) với tưởng về rừng.
Saṅghakammavasena sijjhamānāpi upasampadā satthu āṇāvasena sijjhanato ‘‘buddhadāyajjaṃ te dassāmī’’ti vuttanti vadanti.
They say that even though the Higher Ordination is accomplished by way of a Saṅgha Kamma, it is accomplished by the power of the Teacher’s command, hence it was said, “‘I will give you the Buddha’s inheritance.’”
Các vị nói rằng: “Dù sự thọ giới (upasampadā) được thực hiện theo nghi thức của Tăng đoàn, nhưng vì nó được thành tựu theo mệnh lệnh của Đức Đạo Sư, nên lời nói ‘Ta sẽ trao cho con di sản của Đức Phật’ đã được nói.”
Apare pana ‘‘aparipuṇṇavīsativassasseva tassa upasampadaṃ anujānanto satthā ‘buddhadāyajjaṃ te dassāmī’ti avocā’’ti vadanti.
Others say that the Teacher, allowing his Higher Ordination even though he had not yet completed twenty years, said, “‘I will give you the Buddha’s inheritance.’”
Những người khác lại nói rằng: “Đức Đạo Sư đã nói ‘Ta sẽ trao cho con di sản của Đức Phật’ khi Ngài cho phép vị ấy thọ giới dù chưa đủ hai mươi tuổi.”
Dhammasenāpatinā upajjhāyena upasampādetvā, tatoyevesa dhammasenāpatino saddhivihārikoti aṭṭhakathāsu vutto.
Having ordained him with the Dhammasenāpati as his preceptor, it is stated in the commentaries that he was indeed a co-resident of the Dhammasenāpati from that point on.
Trong các bản Chú giải, vị ấy được nói là đệ tử cùng học với Đức Pháp Quân (Dhammasenāpati) là vị Hòa thượng của mình, sau khi được Đức Pháp Quân thọ giới cho.
Dhammapadaṭṭhakathāyaṃ pana dhammasenāpatiāditherānaṃ cattālīsabhikkhusahassaparivārānaṃ attano attano parivārehi saddhiṃ paccekaṃ gamanaṃ, bhagavato ca ekakasseva gamanaṃ khuddakabhāṇakānaṃ matena vuttaṃ, idha, pana majjhimāgamaṭṭhakathāyañca (ma. ni. aṭṭha. 2.65) aññathā gamanaṃ dīghabhāṇakamajjhimabhāṇakānaṃ matenāti daṭṭhabbaṃ.
However, in the Dhammapada Commentary, the separate departure of the elder Dhammasenāpati and others, surrounded by forty thousand bhikkhus, each with his own retinue, and the departure of the Blessed One alone, is stated according to the view of the Khuddakabhāṇakas. Here, and in the Majjhimāgama Commentary, their departure is described differently, according to the view of the Dīghabhāṇakas and Majjhimabhāṇakas, which should be understood.
Tuy nhiên, trong Chú giải Pháp Cú, việc các Trưởng lão như Đức Pháp Quân cùng với bốn mươi ngàn tỳ khưu tùy tùng của mỗi vị đi riêng rẽ, và Đức Thế Tôn đi một mình, được nói theo quan điểm của các Tiểu Bộ Sư (Khuddakabhāṇaka). Còn ở đây và trong Chú giải Trung Bộ (Majjhimāgamaṭṭhakathā), việc đi lại khác được nói theo quan điểm của các Trường Bộ Sư (Dīghabhāṇaka) và Trung Bộ Sư (Majjhimabhāṇaka) thì nên hiểu như vậy.
Ayanti mahākassapādīnamatthāya cārikā.
“This” refers to the journey for the benefit of Mahākassapa and others.
Aya (nghĩa là) chuyến du hành này là vì lợi ích của các vị như Đại Ca Diếp.
Yaṃ pana anuggaṇhantassa bhagavato gamanaṃ, ayaṃ aturitacārikā nāmāti sambandho.
And the journey of the Blessed One, who wishes to bestow his compassion, this is called a slow journey.
Có sự liên kết là: “Việc Đức Thế Tôn du hành để giúp đỡ (các chúng sinh) được gọi là chuyến du hành không vội vã.”
Imaṃ pana cārikanti aturitacārikaṃ.
“This journey” refers to the slow journey.
Imaṃ pana cārikaṃ (nghĩa là) chuyến du hành không vội vã.
Mahāmaṇḍalanti majjhimadesapariyāpanneneva bāhirimena pamāṇena paricchinnattā mahantataraṃ maṇḍalaṃ.
“Large district” means a larger district, being delimited by the outer boundary that is included in the Middle Country.
Mahāmaṇḍala (nghĩa là) một vòng tròn rất lớn, vì nó được giới hạn bởi kích thước bên ngoài thuộc về vùng Trung Ấn.
Majjhimamaṇḍalanti itaresaṃ ubhinnaṃ vemajjhe pavattaṃ maṇḍalaṃ.
“Middle district” means the district located in the middle of the other two.
Majjhimamaṇḍala (nghĩa là) vòng tròn nằm giữa hai vòng tròn còn lại.
Antomaṇḍalanti itarehi khuddakaṃ maṇḍalaṃ, itaresaṃ vā antogadhattā antimaṃ maṇḍalaṃ, abbhantarimaṃ maṇḍalanti vuttaṃ hoti.
“Inner district” means a smaller district compared to the others, or it means the innermost district, being included within the others.
Antomaṇḍala (nghĩa là) vòng tròn nhỏ hơn so với hai vòng tròn kia, hoặc là vòng tròn cuối cùng vì nó nằm trong hai vòng tròn kia, tức là vòng tròn bên trong.
Kiṃ panimesaṃ pamāṇanti āha ‘‘katthā’’tiādi.
Then he asks, “What is the measure of these?” with the words “‘Where…’” and so forth.
Thế thì kích thước của chúng là bao nhiêu? (Vị ấy) nói “Katthā” v.v.
Tattha navayojanasatikatā majjhimadesapariyāpannavaseneva gahetabbā tato paraṃ aturitacārikāya agamanato.
There, the extent of nine hundred yojanas should be understood as falling within the Middle Country itself, because the slow journey does not extend beyond that.
Trong đó, việc có chín trăm dojana nên được hiểu là chỉ trong phạm vi vùng Trung Ấn, vì sau đó Ngài không du hành một cách không vội vã.
Taduttari hi turitacārikāya eva tathāgato gacchati, na aturitacārikāya.
Indeed, beyond that, the Tathāgata travels only with a swift journey, not with a slow journey.
Quả thực, sau đó Đức Như Lai chỉ du hành một cách vội vã, chứ không du hành một cách không vội vã.
Pavāretvāva cārikācaraṇaṃ buddhāciṇṇanti vuttaṃ ‘‘mahāpavāraṇāya pavāretvā’’tiādi.
It is said that undertaking a journey only after the Pavāraṇā is a practice of the Buddhas, as stated in “‘having performed the great Pavāraṇā…’” and so forth.
Việc du hành sau khi đã mãn hạ được nói là truyền thống của các Đức Phật, như trong lời “sau khi mãn đại Pavāraṇā” v.v.
Pāṭipadadivaseti paṭhamakattikapuṇṇamiyā anantare pāṭipadavase.
“On the first day of the fortnight” means on the first day of the fortnight immediately following the full moon of the first Kattika month.
Pāṭipadadivase (nghĩa là) vào ngày mùng một sau ngày trăng tròn đầu tiên của tháng Kattika.
Samantāti gatagataṭṭhānassa catūsu passesu samantato.
“All around” means from all four sides of the place visited.
Samantā (nghĩa là) khắp bốn phía của nơi đã đến.
Mahājanakāyassa sannipatanato purimaṃ purimaṃ āgatā nimantetuṃ labhanti.
Because a large crowd gathers, “those who arrive first are able to invite.”
Do sự tụ tập của đông đảo quần chúng, những người đến trước được phép thỉnh mời.
Tathā sannipatanameva dassetuṃ ‘‘itaresū’’tiādi vuttaṃ.
To show such a gathering, the phrase beginning with “‘among the others…’” was stated.
Để chỉ ra sự tụ tập như vậy, lời “itaresū” v.v. đã được nói.
Samathavipassanā taruṇā hontīti ettha samathassa taruṇabhāvo upacārasamādhivasena, vipassanāya pana saṅkhāraparicchedañāṇaṃ, kaṅkhāvitaraṇañāṇaṃ, sammasanañāṇaṃ, maggāmaggañāṇanti catunnaṃ ñāṇānaṃ vasena veditabbo.
In “calm and insight are fresh,” the freshness of calm is to be understood in terms of access concentration; the freshness of insight, however, is to be understood in terms of the four knowledges: knowledge of discerning formations, knowledge of overcoming doubt, knowledge of comprehension, and knowledge of the path and not the path.
Ở đây, trong câu “samathavipassanā taruṇā hontī” (tức là thiền chỉ và thiền quán còn non trẻ), sự non trẻ của thiền chỉ nên được hiểu theo nghĩa định cận hành (upacārasamādhi), còn sự non trẻ của thiền quán nên được hiểu theo bốn loại tuệ: tuệ phân biệt hành (saṅkhāraparicchedañāṇa), tuệ thoát nghi (kaṅkhāvitaraṇañāṇa), tuệ quán sát (sammasanañāṇa), và tuệ phân biệt đạo và phi đạo (maggāmaggañāṇa).
Taruṇavipassanāti hi tesaṃ catunnaṃ ñāṇānamadhivacanaṃ.
Indeed, “fresh insight” is a term for these four knowledges.
Quả thực, taruṇavipassanā (thiền quán non trẻ) là tên gọi chung cho bốn loại tuệ đó.
Pavāraṇāsaṅgahaṃ datvāti anumatidānavasena datvā.
“Having given the Pavāraṇā allowance” means having given it by way of granting permission.
Pavāraṇāsaṅgahaṃ datvā (nghĩa là) sau khi cho phép theo ý muốn của các tỳ khưu.
Kattikapuṇṇamāyanti pacchimakattikapuṇṇamiyaṃ.
“On the Kattika full moon” means on the last Kattika full moon.
Kattikapuṇṇamāyaṃ (nghĩa là) vào ngày trăng tròn cuối cùng của tháng Kattika.
‘‘Migasirassa paṭhamapāṭipadadivase’’ti idaṃ majjhimadesavohāravasena migasiramāsassa paṭhamaṃ pāṭipadadivasaṃ sandhāya vuttaṃ, etarahi pavattavohāravasena pana pacchimakattikamāsassa kāḷapakkhapāṭipadadivaso veditabbo.
“On the first day of the fortnight of Migasira” was stated referring to the first day of the fortnight of the Migasira month according to the regional usage of the Middle Country. However, according to the current usage, it should be understood as the first day of the dark half of the last Kattika month.
Câu “Migasirassa paṭhamapāṭipadadivase” này được nói để chỉ ngày mùng một đầu tiên của tháng Migasira theo cách gọi thông thường ở vùng Trung Ấn. Tuy nhiên, theo cách gọi thông thường hiện nay, nên hiểu đó là ngày mùng một của nửa tối tháng Kattika cuối cùng.
Aññenapi kāraṇenāti bhikkhūnaṃ samathavipassanātaruṇabhāvato aññenapi majjhimamaṇḍale veneyyānaṃ ñāṇaparipākādikāraṇena.
“For another reason also” means for another reason, such as the ripeness of the knowledge of those who are to be disciplined in the Middle Region, in addition to the freshness of the bhikkhus’ calm and insight.
Aññenapi kāraṇenā (nghĩa là) ngoài lý do thiền chỉ và thiền quán của các tỳ khưu còn non trẻ, còn có những lý do khác như sự trưởng thành của tuệ giác của những chúng sinh có thể được giáo hóa ở vùng Trung Ấn.
Catumāsanti āsaḷhīpuṇṇamiyā pāṭipadato yāva pacchimakattikapuṇṇamī, tāva catumāsaṃ.
“Four months” means the four months from the first day of the fortnight of the Āsaḷhi full moon until the full moon of the last Kattika month.
Catumāsaṃ (nghĩa là) bốn tháng, từ ngày mùng một của tháng Āsaḷhī đến ngày trăng tròn cuối cùng của tháng Kattika.
‘‘Samantā yojanasata’’ntiādinā vuttanayeneva.
By the method stated, such as “a hundred yojanas all around.”
Theo cách đã nói trong câu “Samantā yojanasata” v.v.
Vasanaṃ vassaṃ, vasanakiriyā, vutthaṃ vasitaṃ vassamassāti vutthavasso, tassa.
vasanaṃ vassaṃ, living (is) the rains retreat; the act of living. vutthaṃ vasitaṃ vassamassāti vutthavasso, tassa. The rains retreat has been lived by him, so he is one who has completed the rains retreat; of him.
Vasanaṃ là an cư, vassaṃ là an cư. Vutthavasso là người đã an cư, của người ấy.
Tathāgatena vinetabbattā ‘‘bhagavato veneyyasattā’’ti sāminiddeso vutto, kattuniddeso vā esa.
Because they are to be disciplined by the Tathāgata, “the Blessed One’s disciples” is stated as a genitive of possession, or it is a genitive of the agent.
Vì các chúng sinh có thể được Đức Như Lai giáo hóa, nên “bhagavato veneyyasattā” được nói là sở hữu cách, hoặc đó là chủ cách.
Veneyyasattāti ca caritānurūpaṃ vinetabbasattā.
And “disciples” means beings who are to be disciplined according to their temperaments.
Veneyyasattā (nghĩa là) những chúng sinh có thể được giáo hóa phù hợp với bản chất của họ.
Indriyaparipākaṃ āgamayamānoti saddhādiindriyānaṃ vimuttiparipācanabhāvena paripakkaṃ paṭimānento.
“Awaiting the ripening of the faculties” means expecting the ripening of the faculties such as faith, by means of their bringing about the ripening of liberation.
Indriyaparipākaṃ āgamayamāno (nghĩa là) chờ đợi sự trưởng thành của các căn như tín căn, với ý nghĩa là sự trưởng thành giúp giải thoát khỏi phiền não.
Phussamāghaphagguṇacittamāsānaṃ aññataramāsassa paṭhamadivase nikkhamanato māsaniyamo ettha na katoti daṭṭhabbaṃ.
It should be understood that no definite month was specified here for the departure, since it occurred on the first day of one of the months of Phussa, Māgha, Phagguṇa, or Citta.
Nên hiểu rằng ở đây không có quy định về tháng, vì Ngài du hành vào ngày đầu tiên của một trong các tháng Phussa, Māgha, Phagguṇa, Citta.
Tenāha ‘‘ekamāsaṃ vā dviticatumāsaṃ vā tattheva vasitvā’’ti.
Therefore, it is said, “having stayed there for one month, or two, three, or four months.”
Vì vậy (vị ấy) nói “ekamāsaṃ vā dviticatumāsaṃ vā tattheva vasitvā”.
Tatthevāti vassūpagamanaṭṭhāne eva.
“Therein” means at the very place where the rains retreat was observed.
Tattheva (nghĩa là) ngay tại nơi an cư.
‘‘Sattahi vā’’tiādi ‘‘ekamāsaṃ vā’’tiādinā yathākkamaṃ yojetabbaṃ – yadi aparampi ekamāsaṃ tattheva vasati, sattahi māsehi cārikaṃ pariyosāpeti.
“Or by seven” and so forth should be connected in order with “for one month or” and so forth: if he stays there for another month, he completes the journey in seven months.
“Sattahi vā” v.v. nên được kết hợp tuần tự với “ekamāsaṃ vā” v.v. – Nếu Ngài an cư thêm một tháng ở đó, thì Ngài kết thúc chuyến du hành trong bảy tháng.
Yadi dvimāsaṃ chahi, yadi timāsaṃ pañcahi, yadi catumāsaṃ tattheva vasati, catūhi māsehi cārikaṃ pariyosāpetīti.
If he stays two months, he completes it in six; if three months, in five; if four months, he completes the journey in four months.
Nếu an cư hai tháng thì sáu tháng, nếu an cư ba tháng thì năm tháng, nếu an cư bốn tháng ở đó, thì Ngài kết thúc chuyến du hành trong bốn tháng.
Kasmā pana cārikāgamananti āsaṅkānivattanatthaṃ ‘‘itī’’tiādi vuttaṃ.
The phrase beginning with “‘Thus…’” was stated to remove the doubt about why there is a journey.
Để giải tỏa nghi ngờ về lý do du hành, lời “itī” v.v. đã được nói.
Atirekaṃ jarādubbalo bāḷhajiṇṇo.
“Very old” means excessively infirm with old age.
Bāḷhajiṇṇo (nghĩa là) người rất già yếu, suy nhược do tuổi già.
Te kadā passissanti, na passissanti eva.
“When will they see?” They will not see him at all.
Te kadā passissanti (nghĩa là) họ sẽ thấy khi nào? Họ sẽ không thấy được.
Lokānukampakāyāti lokānukampakāya eva.
“Out of compassion for the world” means indeed out of compassion for the world.
Lokānukampakāyā (nghĩa là) vì lòng từ bi đối với thế gian.
Tena vuttaṃ ‘‘na cīvarādihetū’’ti.
Therefore it was said, “not for robes and so forth.”
Vì vậy (vị ấy) nói “không phải vì y phục” v.v.
Jaṅghavihāravasenāti jaṅghāhi vicaraṇavasena, jaṅghāhi vicaritvā tattha tattha katipāhaṃ nivasanavasena vā.
“By way of walking about” means by way of wandering on foot, or by way of wandering on foot and staying in various places for a few days.
Jaṅghavihāravasenā (nghĩa là) bằng cách đi bộ, hoặc bằng cách đi bộ và ở lại đó vài ngày.
Sabbiriyāpathasādhāraṇañhi vihāravacanaṃ.
Indeed, the word vihāra is common to all postures.
Thật vậy, từ vihāra (an trú) là chung cho mọi oai nghi.
Sarīraphāsukatthāyāti ekasmiṃyeva ṭhāne nibaddhavāsavasena ussannadhātukassa sarīrassa vicaraṇena phāsubhāvatthāya.
“For the physical comfort” means for the physical comfort of a body with abundant elements by moving about, rather than staying in one fixed place.
Sarīraphāsukatthāyā (nghĩa là) vì sự thoải mái của thân thể, một thân thể có nhiều yếu tố (dhātu) dồi dào, bằng cách đi lại thay vì ở một chỗ cố định.
Aṭṭhuppattikālābhikaṅkhanatthāyāti aggikkhandhopamasutta (a. ni. 7.72) maghadevajātakādi (jā. 1.1.9) desanānaṃ viya dhammadesanāya abhikaṅkhitabbaaṭṭhuppattikālatthāya, aṭṭhuppattikālassa vā abhikaṅkhanatthāya, aṭṭhuppattikāle dhammadesanatthāyāti vuttaṃ hoti.
“For the sake of longing for the opportune moment of arising” means for the sake of the opportune moment for a Dhamma discourse, just like the discourses of the Aggikkhandhopama Sutta and the Maghadeva Jātaka and so forth, or for the sake of longing for the opportune moment of arising, or it is stated as for the sake of teaching the Dhamma at the opportune moment of arising.
Aṭṭhuppattikālābhikaṅkhanatthāyā (nghĩa là) vì thời điểm thích hợp để thuyết pháp, giống như các bài thuyết pháp như kinh Aggikkhandhopama (A.N. 7.72) và Maghadevajātakādi (Jā. 1.1.9), hoặc vì mong muốn có thời điểm thích hợp, tức là để thuyết pháp vào thời điểm thích hợp.
Sikkhāpadapaññāpanatthāyāti surāpānasikkhāpadādi (pāci. 327, 328, 329) paññāpane viya sikkhāpadānaṃ paññāpanatthāya.
“For the sake of establishing training rules” means for the sake of establishing training rules, as in the establishment of the rule concerning intoxicating drinks and so forth.
Sikkhāpadapaññāpanatthāyā (nghĩa là) để chế định các giới luật, giống như việc chế định giới luật về uống rượu (pāci. 327, 328, 329) v.v.
Bodhanatthāyāti aṅgulimālādayo (ma. ni. 2.347) viya bodhaneyyasatte catusaccabodhanatthāya.
“For the sake of awakening” means for the sake of awakening the beings to be disciplined to the Four Noble Truths, like Aṅgulimāla and others.
Bodhanatthāyā (nghĩa là) để giác ngộ chúng sinh có thể được giác ngộ về Tứ Diệu Đế, giống như Angulimāla v.v.
Mahatāti mahatiyā.
“Great” means extensive.
Mahatā (nghĩa là) với số lượng lớn.
Kañci, katipaye vā puggale uddissa cārikā nibaddhacārikā. Tadaññā sambahule uddissa gāmanigamanagarapaṭipāṭiyā cārikā anibaddhacārikā. Tenāha ‘‘tatthā’’tiādi.
A nibaddhacārikā (fixed wandering) is a journey undertaken with a specific individual or a few individuals in mind. An anibaddhacārikā (unfixed wandering) is a journey undertaken, without specific individuals in mind, through villages, towns, and cities in sequence. Therefore, it is said, " tatthā" (there) and so on.
Việc du hành đến một số ít người, hoặc một vài người nào đó, được gọi là nibaddhacārikā (du hành có mục đích cố định). Việc du hành đến nhiều người khác, theo thứ tự làng, thị trấn, thành phố, được gọi là anibaddhacārikā (du hành không có mục đích cố định). Vì vậy, (Luận sư) đã nói (từ) “tatthā” và các từ tiếp theo.
Yaṃ caratīti kiriyāparāmasanaṃ.
" Yaṃ carati" (what one wanders) is a reference to the action.
“Yaṃ carati” (điều gì Ngài du hành) là sự đề cập đến hành động.
‘‘Esā idha adhippetā’’ti vuttameva vitthārato dassetuṃ ‘‘tadā kirā’’tiādi vuttaṃ.
In order to explain in detail what has been stated as "This is intended here," the passage beginning with " tadā kirā" (then indeed) was stated.
Để giải thích chi tiết hơn điều đã nói “Điều này được đề cập ở đây”, (Luận sư) đã nói (từ) “tadā kirā” và các từ tiếp theo.
Dasasahassilokadhātuyāti jātikkhettabhūtaṃ dasasahassacakkavāḷaṃ sandhāya vuttaṃ.
Dasasahassilokadhātuyā (in the ten-thousand world-system) is stated with reference to the ten-thousand world-cycles, which are the field of birth.
“Trong mười ngàn thế giới” được nói để chỉ mười ngàn cõi giới là trường sanh.
Kasmāti ce?
Why so?
Tại sao vậy?
Tattheva bhabbasattānaṃ sambhavato.
Because capable beings exist only there.
Vì chỉ ở đó mới có sự xuất hiện của những chúng sanh có thể được giác ngộ.
Tattha hi satte bhabbe paripakkindriye passituṃ buddhañāṇaṃ abhinīharitvā ṭhito bhagavā ñāṇajālaṃ pattharatīti vuccati, idañca devabrahmānaṃ vasena vuttaṃ.
It is said that in that place, the Blessed One, having focused his Buddha-knowledge to see the capable beings with mature faculties, spreads the net of knowledge. This is stated with reference to devas and Brahmas.
Ở đó, Đức Thế Tôn, đã an trú sau khi hướng trí tuệ Phật của Ngài để thấy những chúng sanh có thể được giác ngộ, với các căn đã chín muồi, được nói là đã trải rộng mạng lưới trí tuệ, và điều này được nói theo phương diện chư thiên và Phạm thiên.
Manussā pana imasmiṃyeva cakkavāḷe, imasmiṃyeva ca saparivāre jambudīpe bodhaneyyā honti.
Humans, however, are capable of being enlightened only in this world-system and only in this Jambudīpa with its retinue.
Còn con người thì chỉ có thể được giác ngộ trong cõi giới này, và chỉ trong cõi Diêm Phù Đề này cùng với quyến thuộc của nó.
Bodhaneyyabandhaveti bodhaneyyasattasaṅkhāte bhagavato bandhave.
Bodhaneyyabandhave means the relatives of the Blessed One, who are considered capable of enlightenment.
“Bodhaneyyabandhave” (bà con có thể được giác ngộ) là những người bà con của Đức Thế Tôn, tức là những chúng sanh có thể được giác ngộ.
Gottādisambandhā viya hi saccapaṭivedhasambandhā veneyyā bhagavato bandhavā nāmāti.
Indeed, just as there are relatives by lineage and so forth, those who are trainable (veneyya) are called the Buddha's relatives because they are related through the penetration of the Truths.
Vì những người có thể được giác ngộ là bà con của Đức Thế Tôn do mối liên hệ giác ngộ Chân Lý, giống như mối liên hệ huyết thống và các mối liên hệ khác.
Gocarabhāvūpagamanaṃ sandhāya ‘‘sabbaññutaññāṇajālassa anto paviṭṭho’’ti vuttaṃ.
Referring to the entering into the state of being an object of knowledge, it is said, "entered into the net of omniscience."
“Đi vào trong mạng lưới trí tuệ Nhất Thiết Trí” được nói để chỉ sự đi vào phạm vi của trí tuệ.
Bhagavā kira mahākaruṇāsamāpattiṃ samāpajjitvā tato vuṭṭhāya ‘‘ye sattā bhabbā paripakkañāṇā, te mayhaṃ ñāṇassa upaṭṭhahantū’’ti cittaṃ adhiṭṭhāya samannāharati, tassa sahasamannāhārā eko vā dve vā sambahulā vā tadā vinayūpagā veneyyā ñāṇassa āpāthamāgacchanti, ayamettha buddhānubhāvo.
It is said that the Blessed One, having entered into the attainment of great compassion, arose from it and, resolving his mind with the thought, "May those beings who are capable and whose faculties are mature appear to my knowledge," he attends to them. At that moment of his attention, one, two, or many trainable (veneyya) beings, who are fit for discipline, come within the range of his knowledge. This is the Buddha's power in this matter.
Đức Thế Tôn, sau khi nhập Đại Bi Định và xuất định, đã quyết tâm trong tâm rằng “Nguyện cho những chúng sanh có khả năng giác ngộ, với trí tuệ đã chín muồi, hiện ra trong trí tuệ của Ta”, rồi Ngài quán sát. Nhờ sự quán sát tức thì đó, một, hai, hoặc nhiều chúng sanh có thể được giáo hóa, có khả năng được thuần hóa, liền hiện ra trong tầm nhìn của trí tuệ. Đây là uy lực của chư Phật trong trường hợp này.
Evamāpāthagatānaṃ pana nesaṃ upanissayaṃ pubbacariyaṃ, pubbahetuṃ, sampati vattamānañca paṭipattiṃ oloketi.
Having thus brought them within the range of his knowledge, he then observes their supporting conditions (upanissaya), past conduct, past causes, and their present practice.
Đối với những người đã hiện ra trong tầm nhìn như vậy, Ngài quán sát duyên lành của họ, hành vi trong quá khứ, nhân duyên trong quá khứ, và thực hành hiện tại của họ.
Veneyyasattapariggaṇhanatthañhi samannāhāre kate paṭhamaṃ nesaṃ veneyyabhāvena upaṭṭhānaṃ hoti, atha ‘‘kiṃ nu kho bhavissatī’’ti saraṇagamanādivasena kañci nipphattiṃ vīmaṃsamāno pubbūpanissayādīni oloketi.
When attention is given for the purpose of gathering trainable beings, first, their state as trainable beings becomes apparent. Then, pondering "what will become of them?", he examines their past supporting conditions and so forth, with a view to some accomplishment such as taking refuge.
Thật vậy, khi sự quán sát được thực hiện để thâu tóm những chúng sanh có thể được giáo hóa, trước tiên, họ hiện ra với tư cách là những người có thể được giáo hóa. Sau đó, Ngài quán sát các duyên lành trong quá khứ và những điều khác, tự hỏi “Điều gì sẽ xảy ra?” và tìm kiếm một thành tựu nào đó, chẳng hạn như sự quy y.
Tenāha ‘‘atha bhagavā’’tiādi.
Therefore, it is said, "Then the Blessed One," and so on.
Vì vậy, (Luận sư) đã nói (từ) “atha bhagavā” (rồi Đức Thế Tôn) và các từ tiếp theo.
Soti ambaṭṭho.
"So" refers to Ambaṭṭha.
“So” (người đó) là Ambhaṭṭha.
Vādapaṭivādaṃ katvāti ‘‘evaṃ nu te ambaṭṭhā’’tiādinā (dī. ni. 1.262) mayā vuttavacanassa ‘‘ye ca kho te bho gotama muṇḍakā samaṇakā’’tiādinā (dī. ni. 1.263) paṭivacanaṃ datvā, asabbhivākyanti asappurisavācaṃ, tikkhattuṃ ibbhavādanipātanavasena nānappakāraṃ sādhusabhāvāya vācāya vattumayuttaṃ vākyaṃ vakkhatīti vuttaṃ hoti.
"Having engaged in debate and counter-debate" means that, in response to the words spoken by me, such as "Is it so, Ambaṭṭha?", he gave a reply with words like "But those shaven-headed ascetics, good Gotama," and so on. "Unworthy speech" means speech of ignoble persons, words that are improper to utter with noble speech in various ways, by thrice casting down the term "ibbha" (low-born), which means he will speak words unfit to be spoken with noble speech, in various ways, by thrice uttering the term "ibbha" (low-born) due to pride and arrogance.
“Vādapaṭivādaṃ katvā” (sau khi tranh luận qua lại) có nghĩa là sau khi đưa ra câu trả lời cho lời nói của Ta, như “Này Ambhaṭṭha, có phải ông nghĩ vậy không?” (Dī. Ni. 1.262), bằng lời nói như “Này Gotama, những vị sa-môn đầu trọc của ông…” (Dī. Ni. 1.263), và “asabbhivākyaṃ” (lời nói bất thiện) có nghĩa là lời nói của kẻ không phải bậc thiện nhân, tức là lời nói không nên nói bằng ngôn ngữ thiện lành, theo cách ba lần hạ thấp bằng lời lẽ thô tục.
Nibbisevananti vigatatudanaṃ, mānadappavasena apagataparinipphandananti attho.
"Nibbisevana" means free from abuse, meaning free from mental agitation due to pride and arrogance.
“Nibbisevanaṃ” (không bị kích động) có nghĩa là không còn sự chọc ghẹo, tức là không còn sự dao động của tâm do kiêu mạn và ngạo mạn.
Avasaritabbanti upagantabbaṃ.
"Avasaritabbaṃ" means to be approached.
“Avasaritabbaṃ” (nên đến) có nghĩa là nên tiếp cận.
Tassa gāmassa idaṃ nāmamattaṃ, kimettha atthapariyesanāyāti vuttaṃ ‘‘ijjhānaṅgalantipi pāṭho’’ti.
This is merely the name of that village; what is the point of seeking meaning here? Thus it is said, "Ijjhānaṅgalanti is also a reading."
Để nói rằng đây chỉ là tên của ngôi làng đó, không cần tìm kiếm ý nghĩa ở đây, (Luận sư) đã nói “ijjhānaṅgalantipi pāṭho” (cũng có bản đọc là Ijjhānaṅgala).
‘‘Yena disābhāgenā’’ti karaṇaniddesānurūpaṃ karaṇatthe upayogavacananti dasseti ‘‘tena avasarī’’ti iminā.
"By which direction" indicates that it is a word used in the instrumental sense, corresponding to an instrumental indication, as shown by "tena avasarī" (he approached by that*).
“Tena avasarī” (Ngài đã đến bằng cách đó) cho thấy rằng “yena disābhāgenā” (bằng hướng đó) là một từ được sử dụng trong ý nghĩa công cụ, phù hợp với cách chỉ định công cụ.
‘‘Yasmiṃ padese’’ti pana bhummaniddesānurūpaṃ ‘‘taṃ vā avasarī’’ti vuttaṃ.
"In which place" is said as "taṃ vā avasarī" (or he approached that*), corresponding to a locative indication.
Còn “taṃ vā avasarī” (hoặc Ngài đã đến đó) được nói phù hợp với cách chỉ định vị trí, tức là “yasmiṃ padese” (ở nơi nào).
Tadubhayamevatthaṃ vivarati ‘‘tena disābhāgenā’’tiādinā.
Both meanings are explained by "tena disābhāgenā" and so on.
Cả hai ý nghĩa đó được giải thích bằng (cụm từ) “tena disābhāgenā” và các từ tiếp theo.
Gatoti upagato, agamāsīti attho.
"Gato" means approached, arrived.
“Gato” (đã đi) có nghĩa là đã đến, tức là đã đi tới.
Puna gatoti sampatto, sampāpuṇīti attho.
Again, "gato" means reached, attained.
Lại nữa, “gato” (đã đi) có nghĩa là đã tới, tức là đã đến nơi.
‘‘Icchānaṅgale’’ti idaṃ tadā bhagavato gocaragāmanidassanaṃ, samīpatthe cetaṃ bhummaṃ.
"Icchānaṅgale" here indicates the Blessed One's going for alms at that time, and this locative case is in the sense of proximity.
“Icchānaṅgale” (ở Icchānaṅgala) là sự chỉ dẫn về ngôi làng đi khất thực của Đức Thế Tôn vào thời điểm đó, và đây là một từ ở thể vị trí với ý nghĩa gần kề.
‘‘Icchānaṅgalavanasaṇḍe’’ti idaṃ pana nivāsaṭṭhānadassanaṃ, nippariyāyato adhikaraṇe cetaṃ bhummanti tadubhayampi padaṃ visesatthadassanena vivaranto ‘‘icchānaṅgalaṃ upanissāyā’’tiādimāha.
"Icchānaṅgalavanasaṇḍe" indicates the place of residence, and this locative case is directly in the sense of location. Thus, wishing to explain both words by showing their specific meanings, he said, "upanissāya Icchānaṅgalaṃ" (residing near Icchānaṅgala) and so on.
Còn “Icchānaṅgalavanasaṇḍe” (trong rừng Icchānaṅgala) là sự chỉ dẫn về nơi cư trú, và đây là một từ ở thể vị trí theo nghĩa sở y trực tiếp. Do đó, để giải thích cả hai từ này bằng cách chỉ ra ý nghĩa đặc biệt, (Luận sư) đã nói “icchānaṅgalaṃ upanissāyā” (nương tựa Icchānaṅgala) và các từ tiếp theo.
‘‘Sīlakhandhāvāra’’ntiādi vuttanayena veneyyahitasamapekkhanavaseneva bhagavato vihāradassanaṃ.
The Blessed One's dwelling, as described by "Sīlakhandhāvāra" and so on, is solely out of consideration for the welfare of those who are trainable.
Sự chỉ dẫn về nơi Đức Thế Tôn cư trú, như đã nói trong “Sīlakhandhāvāra” (trại quân giới luật) và các từ tiếp theo, chỉ là do Ngài quán sát lợi ích của những người có thể được giáo hóa.
Tattha dhammarājassa bhagavato sabbaso adhammaniggaṇhanaparā eva paṭipatti, sā ca sīlasamādhipaññāvasenāti sīlādittayasseva gahaṇaṃ.
In that context, the practice of the Dhamma-king, the Blessed One, is entirely devoted to suppressing unrighteousness, and that is through sīla, samādhi, and paññā. Thus, only the triad of sīla and so forth is taken.
Trong đó, sự thực hành của Đức Thế Tôn, vị vua Pháp, hoàn toàn là để chế ngự mọi điều phi pháp, và điều đó được thực hiện thông qua giới, định, tuệ. Vì vậy, chỉ ba điều giới, định, tuệ được đề cập.
Sīlakhandhāvāranti cakkavattirañño dāruiṭṭhakādikataṃ khandhāvārasadisaṃ sīlasaṅkhātaṃ khandhāvāraṃ bandhitvā viharatīti sambandho.
"Sīlakhandhāvāra" is to be connected as: "He dwells having established a fortress (khandhāvāra) called sīla, similar to the fortress made of wood, bricks, etc., of a Wheel-turning Monarch."
“Sīlakhandhāvāraṃ” (trại quân giới luật) có liên hệ đến việc Ngài an trú sau khi dựng lên một “trại quân” gọi là giới, giống như trại quân làm bằng gỗ, gạch của một vị Chuyển Luân Vương.
Dārukkhandhādīhi āsamantato varanti parikkhipanti etthāti hi khandhāvāro a-kārassa dīghaṃ katvā, rājūnaṃ aciranivāsaṭṭhānaṃ.
Indeed, "khandhāvāro" is where they surround and enclose all around with logs of wood and so forth, making the 'a' long; it is a temporary dwelling place for kings.
Thật vậy, khandhāvāro (trại quân) là nơi mà các thân cây gỗ và những thứ khác bao quanh, được tạo thành bằng cách kéo dài chữ ‘a’, là nơi cư trú tạm thời của các vị vua.
Tattha pana bhagavato aciranivasanakiriyāsambandhamattena bhayanivāraṇaṭṭhena taṃsadisatāya sīlampi tathā vuccati.
But in that context, sīla is also called that due to its similarity, in the sense of averting danger, merely by its connection to the Blessed One's act of dwelling temporarily.
Tuy nhiên, giới cũng được gọi như vậy vì sự tương đồng với nơi đó, chỉ do mối liên hệ với hành động cư trú tạm thời của Đức Thế Tôn và với ý nghĩa ngăn chặn sợ hãi.
Samādhikontanti sammāsamādhisaṅkhātaṃ maṅgalasattiṃ.
"Samādhikontaṃ" means the auspicious spear called sammāsamādhi.
“Samādhikontaṃ” (mũi giáo định) là mũi giáo may mắn gọi là chánh định.
Sabbaññutaññāṇapadanti sabbaññutaññāṇasaṅkhātaṃ jayamantapadaṃ.
"Sabbaññutaññāṇapadaṃ" means the victorious mantra-word called omniscience.
“Sabbaññutaññāṇapadaṃ” (từ trí tuệ Nhất Thiết Trí) là từ thần chú chiến thắng gọi là trí tuệ Nhất Thiết Trí.
Parivattayamānoti parijappamāno.
"Parivattayamāno" means reciting repeatedly.
“Parivattayamāno” (xoay chuyển) có nghĩa là niệm đi niệm lại.
‘‘Sabbaññutaññāṇasara’’ntipi pāṭho, sabbaññutaññāṇavajiraggasaraṃ aparāparaṃ samparivattamānoti attho.
"Sabbaññutaññāṇasaraṃ" is also a reading, meaning repeatedly turning the arrow-point of the vajra of omniscience.
Cũng có bản đọc là “Sabbaññutaññāṇasaraṃ” (mũi tên trí tuệ Nhất Thiết Trí), có nghĩa là xoay chuyển đi xoay chuyển lại mũi tên có đầu kim cương là trí tuệ Nhất Thiết Trí.
Yathābhirucitena vihārenāti sabbavihārasādhāraṇadassanaṃ, dibbavihārādīsu yena yena attanā abhirucitena vihārena viharatīti attho.
"Yathābhirucitena vihārenā" indicates a general presentation of all abodes, meaning he dwells in whatever abode he prefers among the divine abodes and so on.
“Yathābhirucitena vihārenā” (với cách an trú tùy thích) là sự chỉ dẫn chung cho tất cả các cách an trú, có nghĩa là Ngài an trú bằng cách an trú nào mà Ngài tự mình ưa thích, trong số các cách an trú như thiên trú (dibbavihāra) và các cách khác.