Bhāṇavārato bhāṇavārasataṃ hoti.
In terms of recitation sections (bhāṇavāra), it comprises one hundred bhāṇavāras.
Về số lượng bhāṇavāra, có một trăm bhāṇavāra.
Tassa vaggesu sagāthāvaggo ādi, suttesu oghataraṇasuttaṃ.
Among its vaggas, the Sagāthāvagga is the beginning, and among the suttas, the Oghataraṇa Sutta is the first.
Trong các phẩm của nó, Sagāthāvagga là phẩm đầu tiên, và trong các bài kinh, Oghataraṇasutta là bài kinh đầu tiên.
Tassāpi ‘‘evaṃ me suta’’ntiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādi.
Even of that (sutta), the introductory passage beginning with “Evaṃ me sutaṃ” (Thus have I heard), spoken by Venerable Ānanda during the First Great Council, is the beginning.
Phần dẫn nhập bắt đầu bằng "Evaṃ me sutaṃ" (Như vầy tôi nghe) của bài kinh đó đã được Tôn giả Ānanda thuyết giảng trong kỳ Đại Kết Tập lần thứ nhất.
Sā panesā paṭhamamahāsaṅgīti sumaṅgalavilāsiniyā dīghanikāyaṭṭhakathāya ādimhi vitthāritā, tasmā sā tattha vitthāritanayeneva veditabbā.
And this First Great Council has been extensively described by me at the beginning of the Dīghanikāya Commentary, called Sumaṅgalavilāsinī; therefore, it should be understood according to the extensive description found there.
Kỳ Đại Kết Tập lần thứ nhất này đã được trình bày chi tiết ở phần đầu của bộ chú giải Dīghanikāya (Trường Bộ) tên là Sumaṅgalavilāsinī, do đó, cần phải hiểu theo cách đã được trình bày chi tiết ở đó.
Atthato pana evaṃsaddo tāva upamūpadesa-sampahaṃsana-garahaṇa-vacanasampaṭiggahākāranidassanāvadhāraṇādi-anekatthappabhedo.
However, in terms of meaning, the word evaṃ has many distinct meanings, such as simile, instruction, commendation, censure, acceptance of a statement, manner, exemplification, and ascertainment.
Về ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như so sánh, hướng dẫn, tán thán, khiển trách, chấp nhận lời nói, cách thức, minh họa, xác định.
Tathā hesa – ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti (dha. pa. 53) evamādīsu upamāyaṃ āgato.
For instance, in passages like “Evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu” (Thus, by one born as a mortal, much wholesome action should be done), it is used in the sense of a simile.
Chẳng hạn, từ này xuất hiện trong nghĩa so sánh trong các câu như: "Một người sinh ra như vậy, cần phải làm nhiều điều thiện" (Dhp. 53).
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In passages like “Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ” (Thus should you go forward, thus should you go back), it is used in the sense of instruction.
Trong nghĩa hướng dẫn: "Ngươi phải tiến lên như vậy, ngươi phải lùi lại như vậy" (A. IV, 122).
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In passages like “Evametaṃ bhagavā, evametaṃ sugatā” (So it is, Blessed One; so it is, Sugata), it is used in the sense of commendation.
Trong nghĩa tán thán: "Thưa Thế Tôn, đúng vậy; thưa Thiện Thệ, đúng vậy" (A. III, 66).
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In passages like “Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī” (So indeed this wretch, in whatever way, speaks in praise of that bald-headed ascetic), it is used in the sense of censure.
Trong nghĩa khiển trách: "Cũng như vậy, người phụ nữ hạ tiện này, dù trong bất cứ trường hợp nào, cũng tán thán vị Sa-môn đầu trọc đó" (S. I, 187).
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In passages like “Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ” (Yes, Venerable Sir, those bhikkhus assented to the Blessed One), it is used in the sense of acceptance of a statement.
Trong nghĩa chấp nhận lời nói: "Thưa Tôn giả, đúng vậy, các Tỳ-kheo ấy đã vâng lời Đức Thế Tôn" (M. I, 1).
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In passages like “Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī” (Indeed, Venerable Sir, I understand the Dhamma taught by the Blessed One in this manner), it is used in the sense of manner.
Trong nghĩa cách thức: "Thưa Tôn giả, tôi hiểu Pháp do Đức Thế Tôn thuyết giảng theo cách này" (M. I, 398).
‘‘Ehi tvaṃ māṇavaka, yena samaṇo ānando tenupasaṅkama; upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’ti.
In passages like “Come, young man, approach the recluse Ānanda; having approached, in my name, ask the recluse Ānanda if he is free from illness and affliction, robust, strong, and living comfortably.
Trong nghĩa minh họa: "Này thanh niên, hãy đi đến chỗ Sa-môn Ānanda; sau khi đến, hãy thay mặt ta hỏi thăm Sa-môn Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an trú của ngài – ‘Thanh niên Subha, con trai của Todeyya, hỏi thăm Tôn giả Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an trú’.
Evañca vadehi – ‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’ti’’ādīsu (dī. ni. 1.445) nidassane.
And say this: ‘It would be good, Venerable Ānanda, if you would approach the dwelling of the young man Subha, son of Todeyya, out of compassion’”, it is used in the sense of exemplification.
Và hãy nói như vầy: ‘Thưa Tôn giả Ānanda, xin ngài vui lòng đến nhà của thanh niên Subha, con trai của Todeyya, vì lòng từ bi’" (D. I, 445).
‘‘Taṃ kiṃ maññatha kālāmā, ime dhammā kusalā vā akusalā vāti?
“What do you think, Kālāmā, are these qualities wholesome or unwholesome?
"Này các Kālāma, các ông nghĩ sao, những pháp này là thiện hay bất thiện?
Akusalā, bhante.
Unwholesome, Venerable Sir.
Thưa Tôn giả, là bất thiện.
Sāvajjā vā anavajjā vāti?
Blameworthy or blameless?
Có lỗi hay không có lỗi?
Sāvajjā, bhante.
Blameworthy, Venerable Sir.
Thưa Tôn giả, có lỗi.
Viññugarahitā vā viññuppasatthā vāti?
Condemned by the wise or praised by the wise?
Bị người trí khiển trách hay được người trí tán thán?
Viññugarahitā, bhante.
Condemned by the wise, Venerable Sir.
Thưa Tôn giả, bị người trí khiển trách.
Samattā samādinnā ahitāya dukkhāya saṃvattanti vā no vā, kathaṃ vo ettha hotīti?
When undertaken and practiced, do they lead to harm and suffering, or not? How does it seem to you in this matter?
Nếu được thực hành và chấp nhận, chúng có dẫn đến bất lợi và khổ đau hay không? Các ông nghĩ sao về điều này?
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
When undertaken and practiced, Venerable Sir, they lead to harm and suffering; so it seems to us in this matter,” it is used in the sense of ascertainment.
Thưa Tôn giả, nếu được thực hành và chấp nhận, chúng dẫn đến bất lợi và khổ đau, chúng tôi nghĩ như vậy" (A. III, 66).
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Here, it should be understood in the senses of manner, exemplification, and ascertainment.
Ở đây, từ này cần được hiểu theo nghĩa cách thức, minh họa và xác định.
Tattha ākāratthena evaṃsaddena etamatthaṃ dīpeti – nānānayanipuṇaṃ anekajjhāsayasamuṭṭhānaṃ atthabyañjanasampannaṃ vividhapāṭihāriyaṃ dhammatthadesanā paṭivedhagambhīraṃ sabbasattānaṃ sakasakabhāsānurūpato sotapathamāgacchantaṃ tassa bhagavato vacanaṃ sabbappakārena ko samattho viññātuṃ?
Therein, by the word evaṃ in the sense of manner, this meaning is made clear: Who is capable of understanding in every way the Buddha’s discourse, which is subtle in various methods, arises from diverse intentions, is rich in meaning and expression, brings forth various wonders, is profound in Dhamma, meaning, teaching, and penetration, and reaches the ear of all beings according to their respective languages?
Trong đó, với nghĩa cách thức, từ evaṃ làm sáng tỏ ý nghĩa này: Ai có thể hoàn toàn hiểu được lời dạy của Đức Thế Tôn, vốn tinh vi với nhiều phương pháp, phát sinh từ nhiều ý định khác nhau, đầy đủ ý nghĩa và từ ngữ, có nhiều phép lạ, sâu sắc về giáo pháp và sự chứng ngộ, và đến tai tất cả chúng sinh theo ngôn ngữ riêng của họ?
Sabbathāmena pana sotukāmataṃ janetvāpi evaṃ me sutaṃ, mayāpi ekenākārena sutanti.
But, having aroused the desire to hear with all one’s might, “Thus have I heard,” meaning “I, too, have heard in one particular manner.”
Tuy nhiên, sau khi phát sinh ý muốn lắng nghe với tất cả sức lực, tôi đã nghe như vậy, và tôi cũng đã nghe theo một cách thức nào đó.
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.220-223) evaṃ bhagavatā – ‘‘āyasmā ānando atthakusalo dhammakusalo byañjanakusalo niruttikusalo pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti – ‘‘evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
With the meaning of ascertainment, the venerable Ānanda, showing his own power of retention in accordance with the praise bestowed by the Blessed One—"Monks, among my bhikkhu disciples who are greatly learned, Ānanda is the foremost; among those who are wise, mindful, resolute, and attendants, Ānanda is the foremost"—and by the General of the Dhamma—"Venerable Ānanda is skilled in purpose, skilled in Dhamma, skilled in expression, skilled in language, skilled in the sequence of what comes before and after"—generates the desire to listen in beings, by saying, "Thus have I heard, and that recollection is neither deficient nor excessive in meaning or wording; it should be understood exactly thus, and not otherwise."
Với ý nghĩa xác quyết – Đức Thế Tôn đã tán thán rằng: “Này các tỳ khưu, trong số các đệ tử tỳ khưu đa văn của Ta, người đứng đầu là Ānanda. Trong số những người có trí tuệ, có niệm, có kiên trì, có sự phục vụ, người đứng đầu là Ānanda.” Và vị Pháp tướng quân (Sāriputta) cũng đã tán thán rằng: “Tôn giả Ānanda là người thiện xảo về nghĩa (attha), thiện xảo về pháp (dhamma), thiện xảo về văn tự (byañjana), thiện xảo về ngữ nguyên (nirutti), thiện xảo về trước sau (pubbāpara).” Như vậy, để phù hợp với sự tán thán đó, Tôn giả Ānanda đã thể hiện sức mạnh ghi nhớ của mình, khiến chúng sinh phát sinh ý muốn lắng nghe, rằng: “Tôi đã nghe như vầy, và điều tôi đã nghe đó không thiếu không thừa, cả về nghĩa lẫn văn tự, phải được hiểu đúng như vậy, không được khác đi.”
Mesaddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me (tôi) được thấy có ba nghĩa.
Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho.
Indeed, in phrases like "What is sung for by verse is not to be eaten by me," the meaning is "by me."
Như trong câu: “Gāthābhigītaṃ me abhojaneyya” (Tôi không nên thọ dụng vật phẩm được cúng dường bằng cách xướng kệ), từ này có nghĩa là “mayā” (bởi tôi).
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū ’’ tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In phrases like "It would be good, venerable sir, if the Blessed One were to teach me the Dhamma in brief," the meaning is "to me."
Trong câu: “Sādhu me, bhante, Bhagavā saṃkhittena dhammaṃ desetū” (Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp tóm tắt cho con), từ này có nghĩa là “mayhaṃ” (cho tôi).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like "Be my heirs in the Dhamma, monks," the meaning is "my."
Trong câu: “Dhammadāyādā me, bhikkhave, bhavathā” (Này các tỳ khưu, hãy là những người thừa tự Pháp của Ta), từ này có nghĩa là “mama” (của tôi).
Idha pana ‘‘mayā suta’’nti ca ‘‘mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in both meanings: "I have heard" and "it was heard by me."
Ở đây, từ này được sử dụng với cả hai nghĩa: “mayā sutaṃ” (tôi đã nghe) và “mama sutaṃ” (điều tôi đã nghe).
Sutanti ayaṃ sutasaddo saupasaggo anupasaggo ca gamana-vissuta-kilinnaupacitānuyoga-sotaviññeyya-sotadvārānusāraviññātādianekatthappabhedo.
The word sutaṃ (heard) — this word suta (heard), both with and without a prefix, has many distinctions in meaning, such as going, renowned, soaked, accumulated, diligent, cognizable by ear-consciousness, and known by following the ear-door.
Từ sutaṃ (đã nghe) này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như: đi, nổi tiếng, bị ướt, tích lũy, chuyên tâm, được biết qua tai, được hiểu theo dòng chảy của cửa tai.
Tathā hissa – ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
Indeed, in phrases like "gone forth with the army," the meaning is "going."
Như trong câu: “Senāya pasuto” (đi cùng quân đội), từ này có nghĩa là “gacchanto” (đang đi).
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like "for one who has heard the Dhamma and seen," the meaning is "one who has heard the renowned Dhamma."
Trong câu: “Sutadhammassa passato” (của người đã nghe Pháp và thấy Pháp), từ này có nghĩa là “vissutadhammassa” (của người đã nghe Pháp nổi tiếng).
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho.
In phrases like "soaked for the one who is soaked," the meaning is "soaked for the one who is defiled."
Trong câu: “Avassutā avassutassā” (người nữ bị dâm dục làm ướt át đối với người nam bị dâm dục làm ướt át), từ này có nghĩa là “kilinnākilinnassa” (người bị ướt át đối với người bị ướt át).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like "You have accumulated not a little merit," the meaning is "accumulated."
Trong câu: “Tumhehi puññaṃ pasutaṃ anappaka” (Các người đã tích lũy công đức không ít), từ này có nghĩa là “upacitaṃ” (đã tích lũy).
‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like "Those wise ones who are diligent in jhāna," the meaning is "devoted to jhāna."
Trong câu: “Ye jhānapasutā dhīrā” (những bậc trí chuyên tâm vào thiền định), từ này có nghĩa là “jhānānuyuttā” (chuyên tâm vào thiền định).
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like "seen, heard, perceived," the meaning is "cognizable by ear-consciousness."
Trong câu: “Diṭṭhaṃ sutaṃ muta” (điều đã thấy, đã nghe, đã cảm nhận), từ này có nghĩa là “sotaviññeyyaṃ” (điều được biết qua tai).
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like "Dhamma-bearer, Dhamma-hoarder," the meaning is "bearer of what is known by following the ear-door."
Trong câu: “Sutadharo sutasannicayo” (người ghi nhớ điều đã nghe, người tích lũy điều đã nghe), từ này có nghĩa là “sotadvārānusāraviññātadharo” (người ghi nhớ điều đã được biết theo dòng chảy của cửa tai).
Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vā attho.
Here, however, its meaning is either "recollected by following the ear-door" or "recollection by following the ear-door."
Ở đây, từ này có nghĩa là “upadhāritaṃ” (đã được ghi nhớ) hoặc “upadhāraṇaṃ” (sự ghi nhớ) thông qua dòng chảy của cửa tai.
Me-saddassa hi mayāti atthe sati – ‘‘evaṃ mayā sutaṃ, sotadvārānusārena upadhārita’’nti yujjati.
For when the word me means "by me," then "thus it was heard by me, recollected by following the ear-door" is applicable.
Khi từ “me” có nghĩa là “mayā” (bởi tôi), thì câu “evaṃ mayā sutaṃ, sotadvārānusārena upadhāritaṃ” (như vậy tôi đã nghe, đã được ghi nhớ qua dòng chảy của cửa tai) là hợp lý.
Mamāti atthe sati – ‘‘evaṃ mama sutaṃ, sotadvārānusārena upadhāraṇa’’nti yujjati.
When the word me means "my," then "thus my hearing, recollection by following the ear-door" is applicable.
Khi từ “me” có nghĩa là “mama” (của tôi), thì câu “evaṃ mama sutaṃ, sotadvārānusārena upadhāraṇaṃ” (như vậy điều tôi đã nghe, sự ghi nhớ qua dòng chảy của cửa tai) là hợp lý.
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Thus, among these three terms, evaṃ indicates the function of consciousness, such as ear-consciousness.
Như vậy, trong ba từ này, evaṃ là sự chỉ rõ chức năng của thức (viññāṇa) như thính thức (sotaviññāṇa) và các thức khác.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me indicates the individual endowed with the aforementioned consciousness.
Me là sự chỉ rõ cá nhân có đầy đủ thức đã nói.
Sutanti assavanabhāvapaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Sutaṃ indicates a reception that is neither deficient nor excessive nor mistaken, by refuting the state of not having heard.
Sutaṃ là sự chỉ rõ sự nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Tathā evanti tassa sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ.
Likewise, evaṃ clarifies the manner in which the consciousness-process, arising through the ear-door, occurs in various ways with regard to the object.
Cũng vậy, evaṃ là sự công bố trạng thái vận hành của lộ trình thức (viññāṇavīthi) đã khởi lên theo dòng chảy của cửa tai, vận hành trên đối tượng theo nhiều cách khác nhau.
Meti attappakāsanaṃ.
Me is the expression of oneself.
Me là sự công bố về bản thân.
Sutanti dhammappakāsanaṃ.
Sutaṃ is the expression of the Dhamma.
Sutaṃ là sự công bố về Pháp.
Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
The summary here is: "By the consciousness-process occurring in various ways regarding the object, nothing else was done by me; but this was done; this Dhamma was heard."
Đây là tóm tắt ở đây: “Tôi không làm điều gì khác ngoài việc nghe Pháp này bằng lộ trình thức đã vận hành trên đối tượng theo nhiều cách khác nhau.”
Tathā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanagahaṇaṃ hoti, tassa nānākāraniddeso.
Likewise, evaṃ is the indication of the various modes of the mind-continuum, by the various modes of its occurrence, by which the grasping of various meanings and expressions takes place.
Cũng vậy, evaṃ là sự chỉ rõ các cách khác nhau của dòng tâm thức (cittasantāna) mà nhờ sự vận hành đa dạng của nó, sự nắm bắt các nghĩa và văn tự khác nhau xảy ra.
Evanti hi ayaṃ ākārapaññatti.
Indeed, evaṃ is a designation of mode.
Thật vậy, evaṃ là một sự chế định về cách thức.
Meti kattuniddeso.
Me is the designation of the agent.
Me là sự chỉ rõ người thực hiện.
Sutanti visayaniddeso.
Sutaṃ is the designation of the object.
Sutaṃ là sự chỉ rõ đối tượng.
Ettāvatā nānākārappavattena cittasantānena taṃsamaṅgino kattuvisaye gahaṇasanniṭṭhānaṃ kataṃ hoti.
By this much, it is affirmed that the grasping of the object of the agent, who is endowed with that mind-continuum that has occurred in various modes, has taken place.
Cho đến đây, sự quyết định về việc nắm bắt đối tượng của người thực hiện, người có dòng tâm thức vận hành theo nhiều cách khác nhau, đã được thực hiện.
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
In this context, both evaṃ and me are designations that do not exist in the ultimate sense of true reality.
Trong đó, evaṃ và me là những chế định không tồn tại theo nghĩa chân đế tuyệt đối.
Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha.
For what here truly exists in the ultimate sense that could be designated as "thus" or "by me"?
Thật vậy, cái gì ở đây tồn tại theo nghĩa tuyệt đối mà có thể được chỉ định là “evaṃ” hay “me”?
Sutanti vijjamānapaññatti.
Sutaṃ is an existing designation.
Sutaṃ là một chế định tồn tại.
Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For what was perceived here by the ear exists in the ultimate sense.
Vì điều đã được nhận biết bằng tai ở đây là tồn tại theo nghĩa tuyệt đối.
Tathā evanti ca meti ca taṃ taṃ upādāya vattabbato upādāpaññatti.
Likewise, both evaṃ and me are designations based on dependence, because they are spoken of by reference to various things.
Cũng vậy, evaṃ và me là những chế định nương tựa (upādāpaññatti), bởi vì chúng được nói ra dựa trên những điều đó.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a designation based on comparison, because it is spoken of by referring to what has been seen, and so on.
Sutaṃ là một chế định đối chiếu (upanidhāpaññatti), bởi vì nó được nói ra bằng cách so sánh với những điều đã thấy, v.v.
Ettha ca evanti vacanena asammohaṃ dīpeti.
Here, by the word evaṃ, he demonstrates non-confusion.
Ở đây, bằng lời nói evaṃ, Tôn giả Ānanda thể hiện sự không lầm lẫn.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For one who is confused is not capable of penetrating things in various ways.
Vì người lầm lẫn không thể thấu hiểu nhiều cách khác nhau.
Sutanti vacanena sutassa asammosaṃ dīpeti.
By the word sutaṃ, he demonstrates the non-forgetfulness of what was heard.
Bằng lời nói sutaṃ, Tôn giả thể hiện sự không quên lãng điều đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For if what a person has heard is forgotten, he does not later acknowledge, "I heard it."
Vì người mà điều đã nghe bị quên lãng thì sau này không thể xác nhận rằng “tôi đã nghe điều này.”
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, by his non-confusion, the attainment of wisdom is achieved; by his non-forgetfulness, the attainment of mindfulness is achieved.
Như vậy, nhờ sự không lầm lẫn mà trí tuệ được thành tựu, còn nhờ sự không quên lãng mà niệm được thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā.
In this, with mindfulness preceded by wisdom, there is the ability to ascertain the wording; with wisdom preceded by mindfulness, there is the ability to penetrate the meaning.
Trong đó, nhờ niệm có trí tuệ dẫn đầu mà có khả năng ghi nhớ văn tự, và nhờ trí tuệ có niệm dẫn đầu mà có khả năng thấu hiểu nghĩa.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
By being endowed with the ability in both, the attainment of being the Treasurer of the Dhamma is achieved, due to being capable of preserving the treasury of Dhamma, rich in both meaning and wording.
Nhờ khả năng kép này, và nhờ khả năng bảo vệ kho tàng Pháp (dhammakosa) đầy đủ cả nghĩa và văn tự, mà sự thành tựu của người giữ kho tàng Pháp (dhammabhaṇḍāgārika) được xác lập.
Aparo nayo – evanti vacanena yoniso manasikāraṃ dīpeti, ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
Another method: By the word evaṃ, he indicates proper attention, for there is no penetration in various ways for one who pays improper attention.
Một cách giải thích khác – bằng lời nói evaṃ, Tôn giả thể hiện sự tác ý đúng đắn (yoniso manasikāra), vì người tác ý sai lầm (ayoniso manasikāra) thì không có khả năng thấu hiểu nhiều cách khác nhau.
Sutanti vacanena avikkhepaṃ dīpeti vikkhittacittassa savanābhāvato.
By the word sutaṃ, he indicates non-distraction, for there is no hearing for one whose mind is distracted.
Bằng lời nói sutaṃ, Tôn giả thể hiện sự không xao nhãng, vì người có tâm xao nhãng thì không thể lắng nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Thus, indeed, even if a distracted person is spoken to with every perfection, he says, "I did not hear, please speak again."
Thật vậy, một người có tâm xao nhãng, dù được nói cho nghe tất cả mọi điều, vẫn nói: “Tôi chưa nghe, xin hãy nói lại.”
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Through proper attention, he accomplishes right aspiration for oneself and accumulated merit from previous existences, as it is absent in one who has not rightly aspired oneself or one who has not accumulated merit before.
Ở đây, nhờ tác ý đúng đắn mà Tôn giả thành tựu sự tự định hướng đúng đắn và công đức đã tạo trong quá khứ, vì người không tự định hướng đúng đắn hoặc chưa tạo công đức trong quá khứ thì không có những điều đó.
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti.
Through non-distraction, he accomplishes hearing the true Dhamma and associating with good people.
Nhờ không xao nhãng mà Tôn giả thành tựu việc lắng nghe Chánh pháp và sự nương tựa vào bậc thiện trí (sappurisūpanissaya).
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupanissayamānassa savanaṃ atthīti.
For a distracted person cannot hear, and there is no hearing for one who does not associate with good people.
Vì người có tâm xao nhãng không thể lắng nghe, và người không nương tựa vào bậc thiện trí thì không có sự lắng nghe.
Aparo nayo – yasmā ‘‘evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ, so ca evaṃ bhaddako ākāro na sammā appaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakena ākārena pacchimacakkadvayasampattimattano dīpeti.
Another method: Since it was stated, "by evaṃ is indicated the various modes of the mind-continuum, by the various modes of its occurrence, by which the grasping of various meanings and expressions takes place," and such an excellent mode does not occur for one who has not rightly aspired oneself or one who has not accumulated merit before, therefore, by this excellent mode of evaṃ, he indicates his own attainment of the two latter factors (right aspiration and accumulated merit).
Một cách giải thích khác – bởi vì đã nói rằng “evaṃ là sự chỉ rõ các cách khác nhau của dòng tâm thức mà nhờ sự vận hành đa dạng của nó, sự nắm bắt các nghĩa và văn tự khác nhau xảy ra,” và cách thức tốt đẹp này không có ở người không tự định hướng đúng đắn hoặc chưa tạo công đức trong quá khứ, do đó, bằng cách thức tốt đẹp này, Tôn giả thể hiện sự thành tựu của hai bánh xe cuối cùng.
Sutanti savanayogena purimacakkadvayasampattiṃ.
By sutaṃ (heard), he indicates the attainment of the two former factors (residing in a suitable place and associating with good people) through the act of hearing.
Sutaṃ thể hiện sự thành tựu của hai bánh xe đầu tiên thông qua sự lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no hearing for one who dwells in an unsuitable place or who is without the support of good people.
Vì người sống ở nơi không thích hợp hoặc người không nương tựa vào bậc thiện trí thì không có sự lắng nghe.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti, purimacakkadvayasiddhiyā payogasuddhi, tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
Thus, by the accomplishment of his two latter wheels, purity of aspiration is accomplished; by the accomplishment of his two former wheels, purity of application. And by that purity of aspiration, proficiency in attainment is accomplished; by purity of application, proficiency in learning is accomplished.
Do sự thành tựu của hai bánh xe sau, ý chí của vị ấy (Ānanda) được thanh tịnh; do sự thành tựu của hai bánh xe trước, sự tinh tấn được thanh tịnh. Và do sự thanh tịnh của ý chí đó, trí tuệ chứng đắc được thành tựu; do sự thanh tịnh của tinh tấn, trí tuệ về kinh điển được thành tựu.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato, yoniso manasikāro viya ca kusalakammassa, arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the utterance of such a venerable one, pure in application and aspiration, accomplished in learning and attainment, is fit to be a precursor to the Buddha’s word, just as the rising dawn is to the rising sun, and proper attention to wholesome kamma. Wishing to establish a prelude in the proper place, he said, " Thus have I heard," and so on.
Như vậy, lời nói của vị có tinh tấn và ý chí thanh tịnh, đầy đủ kinh điển và chứng đắc, xứng đáng làm tiền đề cho lời dạy của Đức Bhagavā, giống như bình minh là điềm báo mặt trời mọc, và sự tác ý đúng đắn (yoniso manasikāra) là điềm báo của nghiệp thiện. Do đó, muốn đặt lời dẫn nhập vào chỗ thích hợp, Ngài (Ānanda) đã nói câu mở đầu là “Như vầy tôi nghe” (Evaṃ me sutaṃ).
Aparo nayo – evanti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: With the word " Evaṃ" (Thus), which indicates the penetration of various kinds of meaning, he reveals the presence of his own accomplishment in the paṭisambhidās of meaning (attha-paṭisambhidā) and ready wit (paṭibhāna-paṭisambhidā).
Một cách giải thích khác – Với lời nói “Như vầy” (Evaṃ), biểu thị sự thấu hiểu đa dạng, Ngài (Ānanda) biểu lộ sự thành tựu của mình về tuệ phân tích nghĩa (atthapaṭibhāna-paṭisambhidā).
Sutanti iminā sotabbabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
With the word " Sutaṃ" (heard), which indicates the penetration of the varieties of what is to be heard, he reveals the presence of his accomplishment in the paṭisambhidās of Dhamma (dhamma-paṭisambhidā) and language (nirutti-paṭisambhidā).
Với lời nói “tôi nghe” (sutaṃ), biểu thị sự thấu hiểu các loại điều đáng nghe, Ngài biểu lộ sự thành tựu của mình về tuệ phân tích pháp (dhamma-paṭisambhidā) và tuệ phân tích ngôn ngữ (nirutti-paṭisambhidā).
Evanti ca idaṃ yoniso manasikāradīpakavacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
Moreover, by uttering this word " Evaṃ," which indicates proper attention (yoniso manasikāra), he reveals, "These Dhammas have been reflected upon by me with the mind and well penetrated with wisdom (diṭṭhiyā suppaṭividdhā)."
Và khi nói lời “Như vầy” (Evaṃ), lời nói biểu thị sự tác ý đúng đắn (yoniso manasikāra), Ngài biểu lộ rằng: “Những pháp này đã được tôi quán xét bằng tâm, đã được tôi thấu hiểu rõ ràng bằng tuệ.”
Sutanti idaṃ savanayogadīpakavacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering this word " Sutaṃ," which indicates the suitability for listening, he reveals, "Many Dhammas have been heard by me, held in mind, and well-recited verbally."
Khi nói lời “tôi nghe” (sutaṃ), lời nói biểu thị sự thích hợp để nghe, Ngài biểu lộ rằng: “Nhiều pháp đã được tôi nghe, đã được tôi ghi nhớ, đã được tôi thực hành bằng lời nói.”
Tadubhayenapi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, he shows the completeness of meaning and expression, and thus generates respect for listening.
Bằng cả hai điều đó, Ngài biểu lộ sự viên mãn về nghĩa và văn, và khơi dậy lòng kính trọng đối với việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabboti.
Indeed, one who does not listen respectfully to Dhamma complete with meaning and expression is excluded from great benefit. Therefore, generating respect, the Dhamma should be listened to with care.
Vì người không lắng nghe Giáo Pháp đầy đủ nghĩa và văn một cách kính trọng sẽ bị thiếu mất lợi ích lớn lao; do đó, sau khi khơi dậy lòng kính trọng, Ngài muốn nói rằng Giáo Pháp cần được lắng nghe một cách cẩn trọng.
Evaṃ me sutanti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati, sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
Furthermore, by this entire phrase, " Evaṃ me sutaṃ," Venerable Ānanda, by not attributing the Dhamma proclaimed by the Tathāgata to himself, transcends the stage of a bad person, and by declaring himself a disciple, he enters the stage of a good person.
Tuy nhiên, với toàn bộ lời nói “Như vầy tôi nghe” (Evaṃ me sutaṃ), Tôn giả Ānanda không tự nhận mình là người đã tạo ra Giáo Pháp do Đức Như Lai thuyết giảng, Ngài vượt qua địa vị của kẻ không phải bậc thiện nhân. Ngài tự nhận mình là một đệ tử, Ngài bước vào địa vị của bậc thiện nhân.
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Similarly, he causes the mind to rise from false Dhamma and establishes the mind in true Dhamma.
Cũng vậy, Ngài đưa tâm thoát khỏi tà pháp và đặt tâm vững chắc vào chánh pháp.
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva pana bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By indicating, "This was merely heard by me; it is indeed the word of the Bhagavā," he frees himself, points to the Teacher, sets forth the word of the Conqueror, and establishes the guiding principle of the Dhamma.
Ngài biểu lộ: “Đây chỉ là điều tôi đã nghe, là lời dạy của chính Đức Bhagavā đó,” Ngài tự giải thoát mình, Ngài chỉ rõ Đức Đạo Sư, Ngài trình bày lời dạy của Đức Phật, Ngài thiết lập con đường của Giáo Pháp.
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto – ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kattabbā’’ti sabbadevamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādetīti.
Moreover, by not claiming that the Dhamma was produced by himself, but rather by revealing the former statement, " Evaṃ me sutaṃ" ("This word was received by me directly from that Bhagavā, who is fearless through the four kinds of self-confidence, endowed with the ten powers, established in the state of the Chief Bull, roaring the lion's roar, supreme among all beings, the lord of Dhamma, the King of Dhamma, the master of Dhamma, the lamp of Dhamma, the refuge of Dhamma, the noble universal monarch of the True Dhamma, the Perfectly Self-Enlightened One. There should be no doubt or indecision concerning the meaning, the Dhamma, the word, or the letter herein"), he dispels the lack of faith in this Dhamma among all devas and humans, and generates the accomplishment of faith.
Hơn nữa, khi nói “Như vầy tôi nghe” (Evaṃ me sutaṃ), Ngài không tự nhận là mình đã tạo ra, mà Ngài giải thích lời nói trước đó rằng: “Lời dạy này đã được tôi tiếp nhận trực tiếp từ Đức Bhagavā, bậc đã thông suốt bốn sự vô úy, bậc nắm giữ mười lực, bậc đứng vững ở vị trí tối thượng, bậc rống tiếng sư tử hống, bậc tối thượng trong tất cả chúng sanh, bậc chủ tể của Pháp, bậc Pháp vương, bậc lãnh đạo của Pháp, ngọn đèn của Pháp, nơi nương tựa của Pháp, bậc Chuyển luân vương tối thượng của Chánh pháp, bậc Chánh Đẳng Giác. Không có sự nghi ngờ hay hoài nghi nào cần phải có về nghĩa, về Pháp, về từ ngữ hay về văn tự trong lời dạy này.” Như vậy, Ngài tiêu diệt sự bất tín của tất cả chư thiên và loài người đối với Giáo Pháp này, và tạo ra sự thành tựu về niềm tin.
Tenetaṃ vuccati –
Therefore, it is said:
Vì thế, điều này được nói:
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Thus, in passages like "Perhaps tomorrow we might approach, having regard for the time and the occasion," the meaning is concurrence.
“Được thấy trong sự tụ hội, khoảnh khắc, thời gian, tập hợp, nguyên nhân, quan điểm,
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
In passages like "There is indeed, bhikkhus, only one moment, one occasion for the practice of the holy life," the meaning is moment.
Trong sự đạt được, sự từ bỏ, và sự thấu hiểu.”
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In passages like "Hot season, oppressive season," the meaning is time.
Thật vậy, đối với từ này, trong các câu như “Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ” (Dī. Ni. 1.447), nghĩa là sự tụ hội.
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In passages like "A great assembly in the forest," the meaning is assembly.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc và một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nghĩa là khoảnh khắc.
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati – ‘bhaddāli, nāma bhikkhu satthusāsane sikkhāya aparipūrakārī’ti.
In passages like "But, Bhaddāli, that occasion was not fully understood by you. The Bhagavā is dwelling at Sāvatthī. The Bhagavā will know me: ‘The bhikkhu named Bhaddāli is one who is not fulfilling the training in the Teacher’s Dispensation.’ This occasion, too, Bhaddāli, was not fully understood by you," the meaning is cause.
Trong các câu như “Mùa nóng, mùa oi bức” (Pāci. 358), nghĩa là thời gian.
Ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
In passages like "At that time, the wandering ascetic Uggāhamāno, son of Samaṇamuṇḍikā, was residing in the Tindukācīra, in a single hall in Mallikā's park, where disputants on views (samayappavādaka) gathered," the meaning is view.
Trong các câu như “Đại hội trong rừng” (Dī. Ni. 2.332), nghĩa là tập hợp.
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In passages like "Then, at that time, the wandering ascetic Uggāhamāno, son of Samaṇamuṇḍikā, was residing in a single hall with a tinduka-tree enclosure in Mallikā's park, where those who proclaim views (samayappavādake) gathered," the meaning is view.
Trong các câu như “Này Bhaddāli, nguyên nhân đó cũng không được ông thấu hiểu. Đức Bhagavā đang trú tại Sāvatthī, Đức Bhagavā sẽ biết ta – ‘Tỳ khưu tên Bhaddāli là người không hoàn thành giới luật trong giáo pháp của Đức Đạo Sư.’ Này Bhaddāli, nguyên nhân này cũng không được ông thấu hiểu” (Ma. Ni. 2.135), nghĩa là nguyên nhân.
Ādīsu (saṃ. ni. 1.129) paṭilābho.
In passages like these, the meaning is attainment.
Được gọi là bậc hiền trí, cả về lợi ích hiện tại và lợi ích mai sau.”
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.28) pahānaṃ.
In passages like "Through the right abandonment of conceit, he made an end of suffering," the meaning is abandonment.
Trong các câu như trên (Saṃ. Ni. 1.129), nghĩa là sự đạt được.
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 2.8) paṭivedho.
In passages like "Suffering has the meaning of affliction, the meaning of being conditioned, the meaning of torment, the meaning of change, the meaning of penetration," the meaning is penetration.
Trong các câu như “Do thấu hiểu đúng đắn sự kiêu mạn, đã chấm dứt khổ đau” (Ma. Ni. 1.28), nghĩa là sự từ bỏ.
Idha panassa kālo attho.
But here, its meaning is time.
Trong các câu như “Nghĩa của khổ là bị bức bách, là được tạo tác, là bị thiêu đốt, là biến đổi, là được thấu hiểu” (Paṭi. Ma. 2.8), nghĩa là sự thấu hiểu.
Tena saṃvacchara-utu-māsaḍḍhamāsa-ratti-diva-pubbaṇha-majjhanhika-sāyanha-paṭhamamajjhimapacchimayāma-muhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Thereby, it indicates one occasion among the various divisions of time, such as years, seasons, months, half-months, nights, days, forenoons, mid-days, evenings, first, middle, and last watches of the night, and moments.
Ở đây, nghĩa của từ đó là thời gian.
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Even though the Elder knew well and had perfectly comprehended with wisdom every Sutta that was spoken in any particular year, season, month, fortnight, night-part, or day-part among these times—years and so on—
Do đó, từ này biểu thị “một lúc” trong các thời điểm phân loại theo thời gian như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
However, since it would be difficult to memorize, recite, or have others recite if it were stated, "This Sutta was heard by me in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a night-part, or in such and such a day-part," and it would involve much to say, therefore, he summarized that meaning with a single word and said, " Ekaṃ samayaṃ."
Trong đó, mặc dù Tôn giả Ānanda đã biết rõ và phân định rõ ràng bằng tuệ về năm, mùa, tháng, nửa tháng, phần đêm hay phần ngày mà mỗi bài kinh được thuyết giảng; nhưng vì nếu nói “Như vầy tôi nghe vào năm này, mùa này, tháng này, nửa tháng này, phần đêm này, hoặc phần ngày này” thì không thể dễ dàng ghi nhớ, hoặc tự học, hoặc dạy người khác học, và sẽ phải nói rất nhiều; do đó, Ngài đã tóm tắt ý nghĩa đó chỉ bằng một từ và nói “Ekaṃ samayaṃ” (Một lúc).
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya suppakāsā anekakālappabhedā eva samayā.
Or there are these many diverse times of the Bhagavā, which are extremely well-known among devas and humans: the time of conception, the time of birth, the time of spiritual urgency, the time of renunciation, the time of severe ascetic practices, the time of Māra's defeat, the time of full enlightenment, the time of dwelling in present happiness, the time of teaching, and the time of parinibbāna.
Hoặc những thời điểm như thời điểm nhập thai, thời điểm đản sanh, thời điểm khởi phát cảm hứng, thời điểm xuất gia, thời điểm khổ hạnh, thời điểm chiến thắng Ma vương, thời điểm giác ngộ tối thượng, thời điểm an trú hạnh phúc trong hiện tại, thời điểm thuyết pháp, thời điểm nhập Niết Bàn – những thời điểm này của Đức Bhagavā rất rõ ràng đối với chư thiên và loài người, và chính là những phân loại thời gian đa dạng.
Tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Among these times, he indicates one time, specifically the time of teaching.
Trong những thời điểm đó, Ngài biểu thị “một lúc” là thời điểm thuyết pháp.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
Referring to one of these times also—the time of the duty of compassion among the times of the duties of knowledge and compassion, the time of practice for the welfare of others among the times of practice for one's own welfare and the welfare of others, the time of Dhamma talk among the times of the two duties for those who have gathered, and the time of teaching among the times of teaching and practice—he said, " Ekaṃ samayaṃ."
Và trong các thời điểm của công việc trí tuệ và công việc từ bi, đó là thời điểm của công việc từ bi; trong các thời điểm thực hành lợi ích cho mình và lợi ích cho người khác, đó là thời điểm thực hành lợi ích cho người khác; trong các thời điểm của hai việc cần làm của các vị đã tụ hội, đó là thời điểm thuyết pháp; trong các thời điểm thuyết pháp và thực hành, đó là thời điểm thuyết pháp; trong những thời điểm đó, Ngài cũng đề cập đến một trong số đó và nói “Ekaṃ samayaṃ” (Một lúc).
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti ca ito aññesu suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacanena niddeso katoti.
Why is it that here, unlike in the Abhidhamma where "in which time, kāma-realm..." and in other Sutta passages where "in which time, bhikkhus, a bhikkhu secluded from sense pleasures..." are stated with the locative case, and in the Vinaya where "at that time, the Buddha, the Bhagavā..." is stated with the instrumental case, here it is stated with the accusative case " ekaṃ samayaṃ"?
Tại sao ở đây không dùng cách chỉ định bằng cách dùng cách nói vị trí (locative case) như trong Abhidhamma “Yasmiṃ samaye kāmāvacara…” (Vào lúc nào, thuộc về cõi dục…) và trong các bài kinh khác “Yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī…” (Này các tỳ khưu, vào lúc nào, một tỳ khưu ly dục…), và trong Vinaya dùng cách nói công cụ (instrumental case) “Tena samayena buddho bhagavā…” (Vào lúc đó, Đức Phật, Đức Bhagavā…), mà lại dùng cách nói đối cách (accusative case) “Ekaṃ samayaṃ” (Một lúc)?
Tattha tathā, idha ca aññathā atthasambhavato.
Because the meaning is thus in those cases, and otherwise here.
Ở đó là như vậy, và ở đây là khác, do sự khác biệt về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvenabhāvalakkhaṇattho ca sambhavati.
For in the Abhidhamma and in other suttas besides this, the meaning of location (adhikaraṇa) and the meaning of characteristic of being (bhāvenabhāvalakkhaṇa) are possible.
Trong tạng Abhidhamma và trong các đoạn kinh khác ngoài (kinh này), ý nghĩa của túc từ (adhikaraṇa) và ý nghĩa của dấu hiệu hành động (bhāvenabhāvalakkhaṇa) đều có thể xảy ra.
Adhikaraṇañhi kālattho samūhattho ca samayo, tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati.
For the term 'samaya' signifies time and collection (samūha), and in it, the existence of the phenomena such as contact (phassa) that are mentioned is characterized by the existence of the samaya, which refers to the moment (khaṇa), concomitance (samavāya), and cause (hetu).
Quả thật, từ ‘samaya’ (thời) có nghĩa là thời gian (kāla) hoặc tập hợp (samūha) là túc từ cho các pháp như xúc (phassa) đã được nói đến trong đó. Và do sự hiện hữu của ‘samaya’ được gọi là sát-na (khaṇa), sự đồng thời (samavāya) và nhân (hetu), sự hiện hữu của các pháp ấy được nhận biết.
Tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
Therefore, to illuminate that meaning, the locative case (bhummavacana) is used there.
Vì vậy, để làm rõ ý nghĩa đó, cách dùng từ ở thể sở thuộc (bhummavacana) đã được sử dụng ở đó.
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ dassento bhagavato dhammasarīraṃ paccakkhaṃ karoti.
Thus far, with the words "Evaṃ me sutaṃ" (Thus have I heard), Ananda, by showing the Dhamma as it was heard, makes the Dhamma-body of the Blessed One manifest.
Cho đến đây, với câu “ Evaṃ me sutaṃ” (Như vầy tôi nghe), Tôn giả A-nan-đà đã trình bày Giáo Pháp như đã được nghe, làm cho Pháp thân của Đức Thế Tôn trở nên hiện tiền.
Tena ‘‘nayidaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
Thereby, he reassures the people who are distressed by the absence of the Teacher, saying, "This teaching is not without a Teacher who has passed away; this Dhamma is your Teacher."
Điều này an ủi những người đang buồn rầu vì không thấy Đức Bổn Sư, rằng: “Giáo pháp này không phải là không có Bổn Sư. Đây là Bổn Sư của quý vị.”
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti.
By the words "Ekaṃ samayaṃ Bhagavā" (At one time the Blessed One), Ananda, by showing the non-existence of the Blessed One's physical form at that time, establishes His Parinibbāna in the rūpakāya (physical body).
Với câu “ Ekaṃ samayaṃ Bhagavā” (Một thời Đức Thế Tôn), Tôn giả A-nan-đà đã chứng minh sự nhập Niết-bàn của sắc thân Đức Thế Tôn, bằng cách cho thấy sự vắng mặt của Ngài vào thời điểm đó.
Tena ‘‘evaṃvidhassa nāma ariyadhammassa desako dasabaladharo vajirasaṅghātasamānakāyo sopi bhagavā parinibbuto, kena aññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
Thereby, he inspires fear in people intoxicated by the pride of life, by saying, "The Dasabala-holder, whose body is like a diamond cluster, the teacher of such noble Dhamma, even that Blessed One has attained Parinibbāna; by whom else should hope for life be generated?" and he generates enthusiasm for the Dhamma in them.
Điều này làm cho những người say đắm vào sự sống phải xúc động, rằng: “Ngay cả Đức Thế Tôn, bậc thuyết giảng Chánh pháp cao quý như vậy, bậc có mười lực, thân thể kiên cố như kim cương, Ngài cũng đã nhập Niết-bàn. Ai khác có thể hy vọng vào sự sống nữa?” Và điều này cũng tạo ra sự nhiệt tâm trong Chánh pháp cho họ.
Evanti ca bhaṇanto desanāsampattiṃ niddisati.
And by stating "Evaṃ" (Thus), he indicates the perfection of the teaching.
Và khi nói “ Evaṃ” (Như vầy), Tôn giả A-nan-đà chỉ ra sự viên mãn của bài thuyết pháp.
Me sutanti sāvakasampattiṃ.
By "Me sutaṃ" (I heard), the perfection of the disciple.
“ Me sutaṃ” (tôi nghe) chỉ ra sự viên mãn của thính chúng.
Ekaṃ samayanti kālasampattiṃ.
By "Ekaṃ samayaṃ" (At one time), the perfection of the time.
“ Ekaṃ samayaṃ” (một thời) chỉ ra sự viên mãn của thời gian.
Bhagavāti desakasampattiṃ.
By "Bhagavā" (the Blessed One), the perfection of the teacher.
“ Bhagavā” (Đức Thế Tôn) chỉ ra sự viên mãn của bậc thuyết pháp.
Sāvatthiyanti evaṃnāmake nagare.
Sāvatthiyaṃ means "in the city so named."
Sāvatthiyaṃ (Tại Xá-vệ) nghĩa là tại thành phố có tên như vậy.
Samīpatthe cetaṃ bhummavacanaṃ.
And this is a locative case (bhummavacana) in the sense of proximity.
Đây là cách dùng từ ở thể sở thuộc với ý nghĩa gần kề.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgīparidīpanametaṃ.
Viharati (resides) is a general indication of being endowed with one of the postures (iriyāpatha), divine abidings (dibbavihāra), Brahma-abidings (brahmavihāra), or noble abidings (ariyavihāra).
Viharatī (trú) là sự trình bày về việc đầy đủ một trong các tư thế oai nghi (iriyāpatha), trú xứ thiên thượng (dibbavihāra), trú xứ phạm thiên (brahmavihāra), hoặc trú xứ thánh nhân (ariyavihāra) một cách không phân biệt.
Idha pana ṭhānagamananisajjāsayanappabhedesu iriyāpathesu aññatarairiyāpathasamāyogaparidīpanaṃ, tena ṭhitopi gacchantopi nisinnopi sayānopi bhagavā viharaticceva veditabbo.
Here, however, it is an indication of being endowed with one of the postures, which are standing, walking, sitting, and lying down. Therefore, it should be understood that whether the Blessed One is standing, walking, sitting, or lying down, He is said to be "viharati."
Tuy nhiên, ở đây, nó trình bày sự kết hợp với một trong các tư thế oai nghi như đứng, đi, ngồi, nằm. Vì vậy, phải hiểu rằng Đức Thế Tôn trú dù Ngài đang đứng, đang đi, đang ngồi hay đang nằm.
So hi ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā ‘‘viharatī’’ti vuccati.
For He sustains and maintains His body, preventing it from falling, by interrupting the discomfort of one posture with another; therefore, He is called "viharati."
Quả thật, Ngài đã chấm dứt sự khó chịu của một tư thế oai nghi bằng một tư thế oai nghi khác, duy trì và tiếp tục thân thể của mình không bị suy sụp, vì vậy Ngài được gọi là “viharatī”.
Jetavaneti jetassa rājakumārassa vane.
Jetavane means "in the park of Prince Jeta."
Jetavane (Tại Kỳ-đà-lâm) nghĩa là trong khu vườn của hoàng tử Jeta.
Tañhi tena ropitaṃ saṃvaḍḍhitaṃ paripālitaṃ ahosi, tasmā ‘‘jetavana’’nti saṅkhaṃ gataṃ.
For it was planted, cultivated, and protected by him; therefore, it became known as "Jetavana."
Khu vườn đó đã được hoàng tử trồng, nuôi dưỡng và bảo vệ, vì vậy nó được gọi là “Jetavana”.
Tasmiṃ jetavane.
In that Jetavana.
Tại Kỳ-đà-lâm đó.
Anāthapiṇḍikassa ārāmeti anāthapiṇḍikena gahapatinā catupaññāsahiraññakoṭipariccāgena buddhappamukhassa bhikkhusaṅghassa niyyātitattā ‘‘anāthapiṇḍikassa ārāmo’’ti saṅkhaṃ gate ārāme.
Anāthapiṇḍikassa ārāme (in Anāthapiṇḍika’s monastery) means "in the monastery that became known as 'Anāthapiṇḍika’s monastery' because it was dedicated by the householder Anāthapiṇḍika to the Saṅgha of bhikkhus, headed by the Buddha, with the sacrifice of fifty-four crores of gold."
Anāthapiṇḍikassa ārāme (Trong tịnh xá của Cấp Cô Độc) nghĩa là trong tịnh xá được gọi là “tịnh xá của Cấp Cô Độc” vì gia chủ Anāthapiṇḍika đã cúng dường 540 triệu đồng vàng cho Tăng đoàn do Đức Phật đứng đầu.
Ayamettha saṅkhepo, vitthāro pana papañcasūdaniyā majjhimaṭṭhakathāya sabbāsavasuttavaṇṇanāyaṃ (ma. ni. aṭṭha. 1.14) vutto.
This is the brief explanation here; the detailed explanation is given in the Papañcasūdanī, the Majjhima Commentary, in the commentary on the Sabbāsava Sutta.
Đây là phần tóm tắt, phần chi tiết đã được nói đến trong phần giải thích kinh Sabbāsava trong Trung Bộ Chú Giải (Papañcasūdanī).
Nanu avocumha ‘‘samīpatthe bhummavacana’’nti.
Did we not say that "the locative case is used in the sense of proximity"?
Chẳng phải chúng ta đã nói “thể sở thuộc với ý nghĩa gần kề” sao?
Tasmā yathā gaṅgāyamunādīnaṃ samīpe goyūthāni carantāni ‘‘gaṅgāyaṃ caranti, yamunāyaṃ carantī’’ti vuccati, evamidhāpi yadidaṃ sāvatthiyā samīpe jetavanaṃ, tattha viharanto vuccati ‘‘sāvatthiyaṃ viharati jetavane’’ti.
Therefore, just as herds of cattle grazing near the Gaṅgā and Yamunā rivers are said to "graze in the Gaṅgā, graze in the Yamunā," so too here, when one resides in Jetavana, which is near Sāvatthī, it is said, "He resides in Sāvatthī, in Jetavana."
Vì vậy, giống như việc đàn bò đang ăn cỏ gần sông Hằng, sông Yamunā được nói là “đang ăn cỏ trên sông Hằng, đang ăn cỏ trên sông Yamunā”, thì ở đây cũng vậy, Đức Thế Tôn trú tại Kỳ-đà-lâm, nơi gần Xá-vệ, được nói là “trú tại Xá-vệ, tại Kỳ-đà-lâm”.
Gocaragāmanidassanatthaṃ hissa sāvatthivacanaṃ, pabbajitānurūpanivāsaṭṭhānanidassanatthaṃ sesavacanaṃ.
For the mention of Sāvatthī is to indicate His alms-round village, and the remaining mention is to indicate a suitable dwelling place for renunciants.
Việc nói đến Xá-vệ là để chỉ ra nơi khất thực của Ngài, còn việc nói đến phần còn lại là để chỉ ra nơi trú ngụ phù hợp cho các vị xuất gia.
Aññatarā devatāti nāmagottavasena apākaṭā ekā devatāti attho.
Aññatarā devatā (a certain deity) means "a certain deity whose name and clan are not well-known."
Aññatarā devatā (Một vị thiên nhân nào đó) nghĩa là một vị thiên nhân không rõ tên họ.
‘‘Abhijānāti no, bhante, bhagavā ahu ñātaññatarassa mahesakkhassa yakkhassa saṃkhittena taṇhāsaṅkhayavimuttiṃ bhāsitā’’ti ettha pana abhiññāto sakkopi devarājā ‘‘aññataro’’ti vutto.
However, in the passage, “Does the Blessed One know, venerable sir, that to a certain powerful yakkha, a concise liberation through the destruction of craving was taught?”, even Sakka, the king of devas, who is well-known, is referred to as “a certain one.”
Tuy nhiên, trong câu “Bạch Thế Tôn, Đức Thế Tôn có biết không, rằng Ngài đã thuyết giảng vắn tắt về sự giải thoát khỏi sự đoạn tận tham ái cho một vị Dạ-xoa có đại oai lực đã biết trước?” thì ngay cả Sakka, vua chư thiên, cũng được gọi là “aññataro” (một vị nào đó) dù đã được biết rõ.
‘‘Devatā’’ti ca idaṃ devānampi devadhītānampi sādhāraṇavacanaṃ.
And this word "devatā" is common to both male devas and female devas (devadhītā).
Và từ “ devatā” là từ chung cho cả chư thiên nam và chư thiên nữ.
Imasmiṃ panatthe devo adhippeto, so ca kho rūpāvacarānaṃ devānaṃ aññataro.
In this context, however, a male deva is intended, and indeed, he is one of the devas of the Rūpāvacara realm.
Nhưng trong ngữ cảnh này, ý muốn nói đến một vị thiên nam, và vị đó là một trong các vị Phạm thiên thuộc cõi sắc giới.
Abhikkantāya rattiyāti ettha abhikkanta-saddo khayasundarābhirūpaabbhānumodanādīsu dissati.
In Abhikkantāya rattiyā (when the night was far spent), the word 'abhikkanta' is seen in meanings such as completion, beauty, comeliness, and approval.
Trong cụm từ Abhikkantāya rattiyā (khi đêm đã quá nửa), từ ‘abhikkanta’ được thấy trong các ý nghĩa như chấm dứt, đẹp đẽ, khả ái, hoan hỷ, v.v.
Tattha ‘‘abhikkantā, bhante, ratti, nikkhanto paṭhamo yāmo, ciranisinno bhikkhusaṅgho, uddisatu, bhante, bhagavā bhikkhūnaṃ pātimokkha’’nti evamādīsu (a. ni. 8.20; cūḷava. 383) khaye dissati.
There, in passages such as “The night is far spent, venerable sir; the first watch is gone; the Saṅgha of bhikkhus has been seated for a long time; let the Blessed One recite the Pātimokkha to the bhikkhus,” it refers to completion.
Trong các đoạn như “Bạch Thế Tôn, đêm đã qua, canh đầu đã hết, Tăng chúng đã ngồi lâu, xin Thế Tôn hãy đọc Pātimokkha cho các Tỳ-khưu” thì nó được thấy với ý nghĩa chấm dứt.
‘‘Ayaṃ imesaṃ catunnaṃ puggalānaṃ abhikkantataro ca paṇītataro cā’’ti evamādīsu (a. ni. 4.100) sundare.
In passages such as “This one is more excellent and more distinguished than these four types of individuals,” it refers to beauty.
Trong các đoạn như “Vị này trong bốn hạng người này là ưu việt và thù thắng hơn” thì nó được thấy với ý nghĩa đẹp đẽ.
Evamādīsu (vi. va. 857) abhirūpe.
In passages such as these, it refers to comeliness.
Với sắc tướng khả ái, chiếu sáng khắp mọi phương?”
‘‘Abhikkantaṃ bho gotama, abhikkantaṃ bho gotamā’’ti evamādīsu (pārā. 15) abbhānumodane.
In passages such as “Excellent, venerable Gotama! Excellent, venerable Gotama!”, it refers to approval.
Trong các đoạn như vậy, nó được thấy với ý nghĩa khả ái.
Idha pana khaye.
Here, however, it means completion.
Trong các đoạn như “Thật tuyệt vời, thưa Gotama! Thật tuyệt vời, thưa Gotama!” thì nó được thấy với ý nghĩa hoan hỷ.
Tena abhikkantāya rattiyā, parikkhīṇāya rattiyāti vuttaṃ hoti.
Therefore, "abhikkantāya rattiyā" means "when the night was completely spent."
Ở đây, nó có nghĩa là chấm dứt. Do đó, “abhikkantāya rattiyā” có nghĩa là khi đêm đã chấm dứt, khi đêm đã tàn.
Tatthāyaṃ devaputto majjhimayāmasamanantare āgatoti veditabbo.
It should be understood that this devaputta arrived immediately after the middle watch.
Cần phải hiểu rằng vị thiên tử này đã đến ngay sau canh giữa.
Niyāmo hi kiresa devatānaṃ yadidaṃ buddhānaṃ vā buddhasāvakānaṃ vā upaṭṭhānaṃ āgacchantā majjhimayāmasamanantareyeva āgacchanti.
Indeed, it is a rule for devas that when they come to attend upon the Buddhas or the disciples of the Buddhas, they arrive immediately after the middle watch.
Thật vậy, đây là quy luật của chư thiên: khi đến hầu Phật hay các đệ tử của Phật, họ luôn đến ngay sau canh giữa.
Abhikkantavaṇṇāti idha abhikkanta-saddo abhirūpe, vaṇṇa-saddo pana chavithuti-kulavagga-kāraṇa-saṇṭhānappamāṇa-rūpāyatanādīsu dissati.
Here, regarding Abhikkantavaṇṇā, the word abhikkanta is understood in the sense of 'beautiful', while the word vaṇṇa is seen in the sense of 'skin', 'praise', 'class or lineage', 'reason', 'form or shape', 'measure', 'visual object', and so on.
Abhikkantavaṇṇā (sắc đẹp thù thắng): Ở đây, từ abhikkanta được dùng với nghĩa “đẹp đẽ”, còn từ vaṇṇa thì được thấy trong các nghĩa như da thịt, tán thán, chủng tộc, nguyên nhân, hình dáng, kích thước, sắc xứ, v.v.
Tattha ‘‘suvaṇṇavaṇṇosi bhagavā’’ti evamādīsu (su. ni. 553) chaviyā.
There, in phrases like "Bhagavā, you are golden-skinned," it refers to skin.
Trong các trường hợp như ‘‘Bạch Thế Tôn, ngài có sắc da vàng ròng’’ thì có nghĩa là da thịt.
‘‘Kadā saññūḷhā pana te, gahapati, ime samaṇassa vaṇṇā’’ti evamādīsu (ma. ni. 2.77) thutiyaṃ.
In phrases like "Householder, when were these qualities of the ascetic Gotama thoroughly known to you?", it refers to praise.
Trong các trường hợp như ‘‘Này gia chủ, những lời tán thán vị Sa-môn này đã được ông ghi nhớ từ bao giờ?’’ thì có nghĩa là tán thán.
‘‘Cattārome, bho gotama, vaṇṇā’’ti evamādīsu (dī. ni. 3.115) kulavagge.
In phrases like "There are these four classes, venerable Gotama," it refers to class or lineage.
Trong các trường hợp như ‘‘Này tôn giả Gotama, có bốn loại chủng tộc này’’ thì có nghĩa là chủng tộc.
‘‘Atha kena nu vaṇṇena, gandhathenoti vuccatī’’ti evamādīsu (saṃ. ni. 1.234) kāraṇe.
In phrases like "Then by what reason is one called a 'thief of scent'?", it refers to reason.
Trong các trường hợp như ‘‘Vậy do nguyên nhân nào mà tôi được gọi là kẻ trộm hương?’’ thì có nghĩa là nguyên nhân.
‘‘Mahantaṃ hatthirājavaṇṇaṃ abhinimminitvā’’ti evamādīsu (saṃ. ni. 1.138) saṇṭhāne.
In phrases like "Having created the magnificent form of a king elephant," it refers to shape.
Trong các trường hợp như ‘‘Sau khi hóa hiện hình dáng một vị vua voi to lớn’’ thì có nghĩa là hình dáng.
‘‘Tayo pattassa vaṇṇā’’ti evamādīsu (pārā. 602) pamāṇe.
In phrases like "Three measures of the bowl," it refers to measure.
Trong các trường hợp như ‘‘Ba loại kích thước bát’’ thì có nghĩa là kích thước.
‘‘Vaṇṇo gandho raso ojā’’ti evamādīsu rūpāyatane.
In phrases like "Color, smell, taste, nutritive essence," it refers to visual object.
Trong các trường hợp như ‘‘Sắc, hương, vị, oja’’ thì có nghĩa là sắc xứ.
So idha chaviyā daṭṭhabbo.
Here, it should be understood in the sense of skin.
Ở đây, từ đó cần được hiểu là da thịt.
Tena abhikkantavaṇṇā abhirūpacchavi, iṭṭhavaṇṇā manāpavaṇṇāti vuttaṃ hoti.
Thus, it is said that "abhikkantavaṇṇā" means 'of beautiful skin', 'of pleasing appearance', 'of lovely hue'.
Do đó, abhikkantavaṇṇā có nghĩa là có sắc da đẹp đẽ, có sắc da khả ái, có sắc da đáng hài lòng.
Devatā hi manussalokaṃ āgacchamānā pakativaṇṇaṃ pakatiiddhiṃ jahitvā oḷārikaṃ attabhāvaṃ katvā atirekavaṇṇaṃ atirekaiddhiṃ māpetvā naṭasamajjādīni gacchantā manussā viya abhisaṅkhatena kāyena āgacchanti.
For when devas come to the human world, they abandon their natural appearance and natural power, assume a gross body, create a superior appearance and superior power, and arrive with an artificially created body, like humans going to a theatrical performance.
Khi chư thiên đến cõi người, họ từ bỏ sắc thân và thần thông tự nhiên của mình, tạo ra một sắc thân thô thiển hơn, hóa hiện sắc đẹp và thần thông vượt trội, và đến với thân đã được tạo tác, giống như con người đi xem hội hè.
Tattha kāmāvacarā anabhisaṅkhatenapi āgantuṃ sakkonti, rūpāvacarā pana na sakkonti.
Among them, Kāma-world devas can also come without creating such, but Rūpa-world devas cannot.
Trong số đó, chư thiên cõi Dục có thể đến mà không cần tạo tác, nhưng chư thiên cõi Sắc thì không thể.
Tesañhi atisukhumo attabhāvo, na tena iriyāpathakappanaṃ hoti.
Their body is extremely subtle; it is not possible to assume postures with it.
Vì thân của họ rất vi tế, không thể thực hiện các oai nghi cử chỉ với thân đó.
Tasmā ayaṃ devaputto abhisaṅkhateneva āgato.
Therefore, this devaputta came with an artificially created body.
Do đó, vị thiên tử này đã đến với thân đã được tạo tác.
Tena vuttaṃ ‘‘abhikkantavaṇṇā’’ti.
Thus, it is said "abhikkantavaṇṇā".
Vì vậy, đã nói là ‘‘abhikkantavaṇṇā’’ (sắc đẹp thù thắng).
Kevalakappanti ettha kevala-saddo anavasesa-yebhuyyābyāmissānatirekadaḷhatthavisaṃyogādianekattho.
Here, in kevalakappaṃ, the word kevala has many meanings, such as 'without remainder', 'mostly', 'unmixed', 'not excessive', 'firm', 'disjunction', and so on.
Kevalakappaṃ: Ở đây, từ kevala có nhiều nghĩa như không còn sót lại, phần lớn, không pha trộn, không quá mức, kiên cố, không liên kết, v.v.
Tathā hissa ‘‘kevalaparipuṇṇaṃ parisuddhaṃ brahmacariya’’nti evamādīsu (pārā. 1) anavasesatthamattho.
Thus, in phrases like "a completely full, utterly pure holy life," its meaning is 'without remainder'.
Thật vậy, trong các trường hợp như ‘‘Phạm hạnh hoàn toàn viên mãn, thanh tịnh’’ thì có nghĩa là không còn sót lại.
‘‘Kevalakappā ca aṅgamagadhā pahūtaṃ khādanīyabhojanīyaṃ ādāya upasaṅkamissantī’’ti evamādīsu (mahāva. 43) yebhuyyatā.
In phrases like "The majority of Anga and Magadha will come bringing abundant solid and soft food," it means 'mostly'.
Trong các trường hợp như ‘‘Phần lớn dân chúng xứ Aṅga và Magadha sẽ mang theo nhiều đồ ăn thức uống mà đến’’ thì có nghĩa là phần lớn.
‘‘Kevalassa dukkhakkhandhassa samudayo hotī’’ti evamādīsu (vibha. 225) abyāmissatā.
In phrases like "the arising of the entire mass of suffering takes place," it means 'unmixed'.
Trong các trường hợp như ‘‘Toàn bộ khối khổ đau này phát sinh’’ thì có nghĩa là không pha trộn.
‘‘Kevalaṃ saddhāmattakaṃ nūna ayamāyasmā’’ti evamādīsu (mahāva. 244) anatirekatā.
In phrases like "Indeed, this Venerable One has only faith," it means 'not excessive'.
Trong các trường hợp như ‘‘Chắc chắn vị Tôn giả này chỉ có niềm tin mà thôi’’ thì có nghĩa là không quá mức.
‘‘Āyasmato, bhante, anuruddhassa bāhiyo nāma saddhivihāriko kevalakappaṃ saṅghabhedāya ṭhito’’ti evamādīsu (a. ni. 4.243) daḷhatthatā.
In phrases like "Venerable sir, the Venerable Anuruddha's co-resident, named Bāhiya, was firmly intent on causing a schism in the Sangha," it means 'firm'.
Trong các trường hợp như ‘‘Bạch Thế Tôn, vị đệ tử đồng phạm hạnh tên Bāhiya của Tôn giả Anuruddha đã kiên cố đứng về phía phá hòa hợp Tăng’’ thì có nghĩa là kiên cố.
‘‘Kevalī vusitavā uttamapurisoti vuccatī’’ti evamādīsu (saṃ. ni. 3.57) visaṃyogo attho.
In phrases like "One who is perfect, one who has lived the holy life, is called a supreme person," it means 'disjunction'.
Trong các trường hợp như ‘‘Vị đã hoàn tất (Phạm hạnh), đã sống Phạm hạnh được gọi là bậc tối thượng nhân’’ thì có nghĩa là không liên kết.
Idha panassa anavasesattho adhippeto.
Here, however, the meaning 'without remainder' is intended.
Ở đây, nghĩa được muốn nói là không còn sót lại.
Kappa-saddo panāyaṃ abhisaddahana-vohāra-kāla-paññatti-chedana-vikappa-lesasamantabhāvādianekattho.
This word kappa also has many meanings, such as 'belief', 'custom', 'time', 'designation', 'cutting', 'alternative', 'slight indication', 'all-around presence', and so on.
Còn từ kappa này có nhiều nghĩa như niềm tin, tục lệ, thời gian, chế định, cắt tỉa, tùy nghi, cách thức, toàn diện, v.v.
Tathā hissa ‘‘okappaniyametaṃ bhoto gotamassa, yathā taṃ arahato sammāsambuddhassā’’ti evamādīsu (ma. ni. 1.387) abhisaddahanamattho.
Thus, in phrases like "This is appropriate for the venerable Gotama, as he is an Arahant, a Fully Enlightened One," its meaning is 'belief'.
Thật vậy, trong các trường hợp như ‘‘Lời dạy này của Tôn giả Gotama là đáng tin cậy, như lời của một bậc A-la-hán, Chánh Đẳng Giác’’ thì có nghĩa là niềm tin.
‘‘Anujānāmi, bhikkhave, pañcahi samaṇakappehi phalaṃ paribhuñjitu’’nti evamādīsu (cūḷava. 250) vohāro.
In phrases like "Monks, I allow you to partake of fruit in five ways permitted to ascetics," it means 'custom'.
Trong các trường hợp như ‘‘Này các Tỳ-khưu, Ta cho phép thọ dụng trái cây với năm tục lệ của Sa-môn’’ thì có nghĩa là tục lệ.
‘‘Yena sudaṃ niccakappaṃ viharāmī’’ti evamādīsu (ma. ni. 1.387) kālo.
In phrases like "By which I always dwell," it means 'time'.
Trong các trường hợp như ‘‘Nhờ đó tôi thường an trú mọi lúc’’ thì có nghĩa là thời gian.
‘‘Iccāyasmā kappo’’ti evamādīsu paññatti.
In phrases like "So, Venerable Kappa," it means 'designation'.
Trong các trường hợp như ‘‘Vị Tôn giả Kappa này’’ thì có nghĩa là chế định.
‘‘Alaṅkato kappitakesamassū’’ti evamādīsu (vi. va. 1094, 1101) chedanaṃ.
In phrases like "Adorned, with hair and beard trimmed," it means 'cutting'.
Trong các trường hợp như ‘‘Đã trang điểm, tóc râu đã được cắt tỉa’’ thì có nghĩa là cắt tỉa.
‘‘Kappati dvaṅgulakappo’’ti evamādīsu (cūḷava. 446) vikappo.
In phrases like "A two-finger length shadow is permissible," it means 'alternative'.
Trong các trường hợp như ‘‘Được phép tùy nghi hai ngón tay’’ thì có nghĩa là tùy nghi.
‘‘Ātthi kappo nipajjitu’’nti evamādīsu (a. ni. 8.80) leso.
In phrases like "Is there an occasion to lie down?", it means 'slight indication'.
Trong các trường hợp như ‘‘Có cách nào để nằm xuống không?’’ thì có nghĩa là cách thức.
‘‘Kevalakappaṃ veḷuvanaṃ obhāsetvā’’ti evamādīsu (saṃ. ni. 1.94) samantabhāvo.
In phrases like "Having illuminated the entire Veḷuvana," it means 'all-around presence'.
Trong các trường hợp như ‘‘Chiếu sáng toàn bộ rừng Trúc Lâm’’ thì có nghĩa là toàn diện.
Idha panassa samantabhāvattho adhippeto.
Here, however, the meaning 'all-around presence' is intended for it.
Ở đây, nghĩa được muốn nói là toàn diện.
Tasmā kevalakappaṃ jetavananti ettha ‘‘anavasesaṃ samantato jetavana’’nti evamattho daṭṭhabbo.
Therefore, in the phrase kevalakappaṃ Jetavanaṃ, the meaning should be understood as "the entire Jetavana, all around, without remainder."
Do đó, trong câu kevalakappaṃ jetavana (toàn bộ tinh xá Jetavana), cần hiểu là ‘‘toàn bộ tinh xá Jetavana không còn sót lại, khắp mọi nơi’’.
Yenāti bhummatthe karaṇavacanaṃ.
Yenā is an instrumental case word in the locative sense.
Yenā (nơi mà): là một từ chỉ công cụ được dùng với nghĩa vị trí (locative).
Yena bhagavā tenupasaṅkamīti tasmā ‘‘yattha bhagavā, tattha upasaṅkamī’’ti evamettha attho daṭṭhabbo.
Therefore, in the phrase Yena Bhagavā tenupasaṅkamī, the meaning here should be understood as "where the Bhagavā was, there he approached."
Do đó, trong câu Yena Bhagavā tenupasaṅkamī (đến nơi Thế Tôn ngự), cần hiểu là ‘‘đến nơi Thế Tôn đang ngự’’.
Yena vā kāraṇena bhagavā devamanussehi upasaṅkamitabbo, tena kāraṇena upasaṅkamīti evamettha attho daṭṭhabbo.
Or, the meaning here should be understood as "by which reason the Bhagavā should be approached by devas and humans, by that reason he approached."
Hoặc, cần hiểu rằng vị thiên tử này đã đến vì lý do mà chư thiên và loài người nên đến gần Thế Tôn.
Kena ca kāraṇena bhagavā upasaṅkamitabbo?
And by what reason should the Bhagavā be approached?
Và vì lý do nào mà chư thiên và loài người nên đến gần Thế Tôn?
Nānappakāraguṇavisesādhigamādhippāyena, sāduphalūpabhogādhippāyena dijagaṇehi niccaphalitamahārukkho viya.
With the intention of attaining various special qualities, like a great tree always bearing fruit which is approached by flocks of birds with the intention of enjoying delicious fruits.
Với ý định đạt được các phẩm chất đặc biệt khác nhau, giống như đàn chim luôn đến cây đại thụ sai trái ngọt với ý định hưởng thụ trái cây ngon lành.
Upasaṅkamīti ca gatāti vuttaṃ hoti.
And upasaṅkamī means he went.
Upasaṅkamī (đến gần) có nghĩa là đã đến.
Upasaṅkamitvāti upasaṅkamanapariyosānadīpanaṃ.
Upasaṅkamitvā indicates the completion of the approach.
Upasaṅkamitvā (sau khi đến gần): chỉ sự kết thúc của hành động đến gần.
Atha vā evaṃ gatā tato āsannataraṃ ṭhānaṃ bhagavato samīpasaṅkhātaṃ gantvātipi vuttaṃ hoti.
Or, it means having gone to a place closer than that, a place called "near the Bhagavā."
Hoặc, cũng có nghĩa là sau khi đã đến như vậy, vị thiên tử này đã đến một nơi gần hơn, tức là đến gần Thế Tôn.
Idāni yenatthena loke aggapuggalassa upaṭṭhānaṃ āgatā, taṃ pucchitukāmā dasanakhasamodhānasamujjalaṃ añjuliṃ sirasi patiṭṭhapetvā ekamantaṃ aṭṭhāsi.
Now, desiring to ask the purpose for which he had come to attend upon the foremost person in the world, he placed his resplendent añjali, shining with ten fingernails pressed together, on his head and stood to one side.
Bấy giờ, vì muốn hỏi về mục đích mà vị thiên tử đã đến hầu bậc tối thượng trong thế gian, vị ấy đã chắp tay cung kính, mười móng tay sáng chói đặt trên đỉnh đầu, rồi đứng sang một bên.
Ekamantanti bhāvanapuṃsakaniddeso – ‘‘visamaṃ candimasūriyā parivattantī’’tiādīsu (a. ni. 4.70) viya.
Ekamantaṃ is a designation of a neuter noun in the sense of state or manner—as in phrases like "the sun and moon revolve unevenly."
Ekamantaṃ (sang một bên): là một cách diễn đạt ở thể trung tính, chỉ trạng thái, giống như trong các câu ‘‘Mặt trăng và mặt trời xoay chuyển không đều’’.
Tasmā yathā ṭhitā ekamantaṃ ṭhitā hoti, tathā aṭṭhāsīti evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as "he stood in such a manner that he was standing to one side."
Do đó, ở đây cần hiểu là vị ấy đã đứng theo cách mà một người đứng sang một bên.
Bhummatthe vā etaṃ upayogavacanaṃ.
Or, this is an accusative case word in the locative sense.
Hoặc, đây là một từ chỉ công cụ được dùng với nghĩa vị trí (locative).
Aṭṭhāsīti ṭhānaṃ kappesi.
Aṭṭhāsī means he established a standing position.
Aṭṭhāsi (đứng): có nghĩa là giữ vị trí.
Paṇḍitā hi devamanussā garuṭṭhāniyaṃ upasaṅkamitvā āsanakusalatāya ekamantaṃ tiṭṭhanti, ayañca devo tesaṃ aññataro, tasmā ekamantaṃ aṭṭhāsi.
For wise devas and humans, having approached a venerable one, stand to one side, being skilled in choosing a proper sitting/standing place, and this deva was one of them; therefore, he stood to one side.
Thật vậy, chư thiên và loài người có trí tuệ khi đến gần bậc đáng kính, do khéo léo chọn chỗ ngồi, họ đứng sang một bên; và vị thiên tử này là một trong số đó, vì vậy đã đứng sang một bên.
Kathaṃ ṭhito pana ekamantaṃ ṭhito hotīti?
And how does one stand so as to be standing to one side?
Vậy, đứng như thế nào thì được gọi là đứng sang một bên?
Cha ṭhānadose vajjetvā.
By avoiding six faults of position.
Là tránh sáu lỗi về vị trí.
Seyyathidaṃ – atidūraṃ, accāsannaṃ, uparivātaṃ, unnatappadesaṃ, atisammukhaṃ, atipacchāti.
Namely: too far, too near, upwind, on higher ground, directly in front, and too far behind.
Đó là: quá xa, quá gần, ngược gió, ở chỗ cao hơn, quá đối diện, và quá phía sau.
Atidūre ṭhito hi sace kathetukāmo hoti, uccāsaddena kathetabbaṃ hoti.
If one stands too far away and wishes to speak, one must speak in a loud voice.
Nếu đứng quá xa mà muốn nói chuyện, thì phải nói bằng giọng lớn.
Accāsanne ṭhito saṅghaṭṭanaṃ karoti.
If one stands too near, one causes a disturbance.
Nếu đứng quá gần, sẽ gây va chạm.
Uparivāte ṭhito sarīragandhena bādhati.
If one stands upwind, one offends with one's body odor.
Nếu đứng ngược gió, sẽ làm phiền bằng mùi cơ thể.
Unnatappadese ṭhito agāravaṃ pakāseti.
If one stands on higher ground, one displays disrespect.
Nếu đứng ở chỗ cao hơn, sẽ thể hiện sự bất kính.
Atisammukhā ṭhito sace daṭṭhukāmo hoti, cakkhunā cakkhuṃ āhacca daṭṭhabbaṃ hoti.
If one stands directly in front and wishes to see, one must look eye-to-eye.
Nếu đứng quá đối diện mà muốn nhìn, thì phải nhìn thẳng vào mắt.
Atipacchā ṭhito sace daṭṭhukāmo hoti, gīvaṃ pasāretvā daṭṭhabbaṃ hoti.
If one stands too far behind and wishes to see, one must crane one's neck to look.
Nếu đứng quá phía sau mà muốn nhìn, thì phải rướn cổ ra để nhìn.
Tasmā ayampi ete cha ṭhānadose vajjetvā aṭṭhāsi.
Therefore, this deva also stood, avoiding these six faults of position.
Vì vậy, vị thiên tử này cũng đã tránh sáu lỗi về vị trí này mà đứng.
Tena vuttaṃ ‘‘ekamantaṃ aṭṭhāsī’’ti.
Thus, it is said, "ekamantaṃ aṭṭhāsi."
Do đó, đã nói là ‘‘ekamantaṃ aṭṭhāsi’’ (đứng sang một bên).
Mārisāti devatānaṃ piyasamudācāravacanametaṃ.
Mārisa is a loving address of devas.
Mārisa là lời xưng hô thân ái của chư thiên.
Niddukkhāti vuttaṃ hoti.
It means "one free from suffering."
Nghĩa là không có khổ.
Yadi evaṃ ‘‘yadā kho te, mārisa, saṅkunā saṅku hadaye samāgaccheyya, atha naṃ tvaṃ jāneyyāsi ‘vassasahassaṃ me niraye paccamānassā’’’ti (ma. ni. 1.512) idaṃ virujjhati.
If that is so, then this statement: ‘‘When, Mārisa, a stake meets a stake in your heart, then you will know, ‘I have been tormented in hell for a thousand years’’’ contradicts it.
Nếu vậy, câu nói “Này Mārisa, khi một cái cọc đâm vào tim ngươi, thì ngươi sẽ biết ‘ta đã bị nung nấu trong địa ngục một ngàn năm’” sẽ mâu thuẫn.
Na hi nerayikasatto niddukkho nāma hoti.
For a being in hell is certainly not free from suffering.
Vì chúng sinh trong địa ngục không thể nào không có khổ.
Kiñcāpi na niddukkho, ruḷhīsaddena pana evaṃ vuccati.
Even though he is not free from suffering, it is said thus by conventional usage.
Mặc dù không không khổ, nhưng từ ngữ này được dùng theo nghĩa thông thường.
Pubbe kira paṭhamakappikānaṃ niddukkhānaṃ sukhasamappitānaṃ esa vohāro, aparabhāge dukkhaṃ hotu vā mā vā, ruḷhīsaddena ayaṃ vohāro vuccateva nippadumāpi nirudakāpi vā pokkharaṇī pokkharaṇī viya.
Indeed, this expression was formerly used by the first beings of the kalpa, who were free from suffering and endowed with happiness. Later, whether there is suffering or not, this expression is used conventionally, just as a pond is called a pond even if it has no lotuses or no water.
Xưa kia, đây là cách xưng hô của những người sống trong thời sơ kiếp, những người không có khổ và tràn đầy hạnh phúc. Về sau, dù có khổ hay không, cách xưng hô này vẫn được dùng theo nghĩa thông thường, giống như một hồ sen vẫn được gọi là hồ sen dù không có sen hay không có nước.
Oghamatarīti ettha cattāro oghā, kāmogho bhavogho diṭṭhogho avijjoghoti.
Here in the phrase crossed the flood, there are four floods: the flood of sensual desire (kāmogha), the flood of existence (bhavogha), the flood of wrong views (diṭṭhogha), and the flood of ignorance (avijjogha).
Ở đây, các dòng thác (Ogha) đã vượt qua (Oghamatarī) có bốn loại dòng thác: dục lưu (kāmogha), hữu lưu (bhavogha), kiến lưu (diṭṭhogha), và vô minh lưu (avijjogha).
Tattha pañcasu kāmaguṇesu chandarāgo kāmogho nāma.
Among these, passionate desire for the five strands of sensual pleasure is called the flood of sensual desire.
Trong đó, tham ái đối với năm dục cảnh được gọi là dục lưu.
Rūpārūpabhavesu chandarāgo jhānanikanti ca bhavogho nāma.
Passionate desire for existences in the form and formless realms, and delight in jhānas, are called the flood of existence.
Tham ái đối với các cõi sắc và vô sắc, cùng với sự ưa thích thiền định, được gọi là hữu lưu.
Dvāsaṭṭhi diṭṭhiyo diṭṭhogho nāma.
The sixty-two wrong views are called the flood of wrong views.
Sáu mươi hai tà kiến được gọi là kiến lưu.
Catūsu saccesu aññāṇaṃ avijjogho nāma.
Ignorance of the four noble truths is called the flood of ignorance.
Sự vô tri đối với bốn sự thật được gọi là vô minh lưu.
Tattha kāmogho aṭṭhasu lobhasahagatesu cittuppādesu uppajjati, bhavogho catūsu diṭṭhigatavippayuttalobhasahagatesu cittuppādesu uppajjati, diṭṭhogho catūsu diṭṭhigatasampayuttesu cittuppādesu uppajjati, avijjogho sabbākusalesu uppajjati.
Among these, the kāmogha arises in the eight states of consciousness accompanied by greed; the bhavogha arises in the four states of consciousness accompanied by greed that are disconnected from wrong views; the diṭṭhogha arises in the four states of consciousness associated with wrong views; the avijjogha arises in all unwholesome states.
Trong đó, dục lưu phát sinh trong tám tâm sở tham hợp; hữu lưu phát sinh trong bốn tâm sở tham hợp không liên quan đến tà kiến; kiến lưu phát sinh trong bốn tâm sở tham hợp có liên quan đến tà kiến; vô minh lưu phát sinh trong tất cả các tâm bất thiện.
Sabbopi cesa avahananaṭṭhena rāsaṭṭhena ca oghoti veditabbo.
All of this should be understood as a flood by virtue of its sweeping away and by virtue of its vastness.
Tất cả những điều này phải được hiểu là dòng thác (Ogha) theo nghĩa cuốn trôi (avahananaṭṭhena) và theo nghĩa tích tụ (rāsaṭṭhena).
Avahananaṭṭhenāti adhogamanaṭṭhena.
By virtue of sweeping away means by virtue of leading downwards.
Theo nghĩa cuốn trôi (Avahananaṭṭhenā) là theo nghĩa kéo xuống thấp.
Ayañhi attano vasaṃ gate satte adho gameti, nirayādibhedāya duggatiyaṃyeva nibbatteti, uparibhāvaṃ vā nibbānaṃ gantuṃ adento adho tīsu bhavesu catūsu yonīsu pañcasu gatīsu sattasu viññāṇaṭṭhitīsu navasu sattāvāsesu ca gametītipi attho.
For this sweeps down beings who have fallen under its power, giving rise to them only in miserable states such as hell, or it means that it leads them downwards through the three existences, the four wombs, the five destinations, the seven stations of consciousness, and the nine abodes of beings, not allowing them to attain the higher state of Nibbāna.
Vì dòng thác này kéo những chúng sinh bị nó chi phối xuống thấp, chỉ tái sinh vào các khổ cảnh như địa ngục, v.v., hoặc không cho đi lên Nibbāna, mà kéo xuống ba cõi, bốn loài, năm đường, bảy trú xứ của thức, và chín trú xứ của chúng sinh; đây cũng là ý nghĩa.
Rāsaṭṭhenāti mahantaṭṭhena.
By virtue of vastness means by virtue of its immensity.
Theo nghĩa tích tụ (Rāsaṭṭhenā) là theo nghĩa rộng lớn.
Mahā heso kilesarāsi avīcito paṭṭhāya yāva bhavaggā patthaṭo, yadidaṃ pañcasu kāmaguṇesu chandarāgo nāma.
Indeed, this mass of defilements is immense, spread from Avīci up to the highest existence, which is passionate desire for the five strands of sensual pleasure.
Thật vậy, khối phiền não này rất lớn, trải dài từ địa ngục Avīci cho đến đỉnh hữu (Bhavagga), đó là tham ái đối với năm dục cảnh.
Sesesupi eseva nayo.
The same principle applies to the remaining floods.
Đối với các loại còn lại cũng vậy.
Evamayaṃ rāsaṭṭhenāpi oghoti veditabbo.
Thus, this should be understood as a flood by virtue of its vastness.
Như vậy, điều này cũng phải được hiểu là dòng thác theo nghĩa tích tụ.
Atarīti imaṃ catubbidhampi oghaṃ kena nu tvaṃ, mārisa, kāraṇena tiṇṇoti pucchati.
Crossed means, “By what means, Mārisa, did you cross this fourfold flood?” the devatā asks.
Atarī (đã vượt qua) là hỏi: “Này Mārisa, Ngài đã vượt qua bốn dòng thác này bằng nguyên nhân nào?”
Athassā bhagavā pañhaṃ vissajjento appatiṭṭhaṃ khvāhantiādimāha.
Then the Blessed One, answering her question, began with without standing still (appatiṭṭhaṃ khvāhaṃ).
Bấy giờ, Thế Tôn đã trả lời câu hỏi của vị thiên nhân ấy bằng cách nói appatiṭṭhaṃ khvāhaṃ (ta không đứng lại) và những lời tiếp theo.
Tattha appatiṭṭhanti appatiṭṭhahanto.
Here, without standing still means not resting.
Trong đó, appatiṭṭhaṃ có nghĩa là không đứng lại.
Anāyūhanti anāyūhanto, avāyamantoti attho.
Without striving means not exerting, not making an effort.
Anāyūhaṃ có nghĩa là không nỗ lực, không cố gắng; đây là ý nghĩa.
Iti bhagavā gūḷhaṃ paṭicchannaṃ katvā pañhaṃ kathesi.
Thus, the Blessed One spoke the answer in a hidden, concealed manner.
Như vậy, Thế Tôn đã trả lời câu hỏi một cách ẩn mật, che giấu.
Devatāpi naṃ sutvā ‘‘bāhirakaṃ tāva oghaṃ tarantā nāma ṭhātabbaṭṭhāne tiṭṭhantā taritabbaṭṭhāne āyūhantā taranti, ayaṃ pana avīcito yāva bhavaggā patthaṭaṃ kilesoghaṃ kilesarāsiṃ appatiṭṭhahanto anāyūhanto atarinti āha.
The devatā, hearing him, thought: "Those who cross an external flood, for instance, cross it by stopping at a place where they can rest and exerting themselves at a place where they should cross. But this one says he crossed the flood of defilements, the mass of defilements, which extends from Avīci up to the highest existence, without stopping and without striving.
Vị thiên nhân ấy nghe xong cũng nghĩ: “Những người vượt qua dòng sông bên ngoài thì phải đứng lại ở chỗ có thể đứng và nỗ lực ở chỗ có thể nỗ lực mới vượt qua được. Còn vị này lại nói rằng Ngài đã vượt qua dòng thác phiền não, khối phiền não trải dài từ Avīci cho đến Bhavagga mà không đứng lại, không nỗ lực.
Kiṃ nu kho etaṃ?
What can this mean?
Điều này là gì?
Kathaṃ nu kho eta’’nti?
How can this be?"
Điều này là như thế nào?”
Vimatiṃ pakkhantā pañhassa atthaṃ na aññāsi.
She fell into doubt and did not understand the meaning of the question.
Vị ấy rơi vào nghi ngờ và không hiểu ý nghĩa của câu hỏi.
Kiṃ pana bhagavatā yathā sattā na jānanti, evaṃ kathanatthāya pāramiyo pūretvā sabbaññutā paṭividdhāti?
Did the Blessed One, then, fulfill the perfections and attain omniscience so that beings would not understand, as he spoke?
Phải chăng Thế Tôn đã hoàn thành các ba-la-mật và chứng đắc Nhất thiết trí để thuyết pháp theo cách mà chúng sinh không thể hiểu được?
Na etadatthāya paṭividdhā.
He did not attain it for that purpose.
Ngài không chứng đắc vì mục đích đó.
Dve pana bhagavato desanā niggahamukhena ca anuggahamukhena ca.
But the Blessed One's teachings are twofold: through admonition and through encouragement.
Thế Tôn có hai cách thuyết pháp: một là theo cách khiển trách (niggahamukhena), hai là theo cách khuyến khích (anuggahamukhena).
Tattha ye paṇḍitamānino honti aññātepi ñātasaññino pañcasatā brāhmaṇapabbajitā viya, tesaṃ mānaniggahatthaṃ yathā na jānanti, evaṃ mūlapariyāyādisadisaṃ dhammaṃ deseti.
Among these, to those who are conceited and consider themselves wise even when they are ignorant, like the five hundred brahmins and ascetics, he teaches the Dhamma like the Mūlapariyāya Sutta to admonish their conceit, so that they do not understand.
Trong đó, đối với những người tự cho mình là thông thái, dù không biết nhưng lại nghĩ mình đã biết, như năm trăm vị Bà-la-môn xuất gia, Ngài thuyết pháp như Mūlapariyāya Sutta, v.v., theo cách mà họ không thể hiểu được, để khiển trách sự kiêu mạn của họ.
Ayaṃ niggahamukhena desanā.
This is teaching through admonition.
Đây là cách thuyết pháp theo lối khiển trách.
Vuttampi cetaṃ ‘‘niggayha niggayhāhaṃ, ānanda, vakkhāmi, pavayha pavayha, ānanda, vakkhāmi, yo sāro, so ṭhassatī’’ti (ma. ni. 3.196).
It was also said: "I will admonish and admonish you, Ānanda; I will encourage and encourage you, Ānanda. What is the essence will remain."
Điều này cũng đã được nói: “Này Ānanda, Ta sẽ khiển trách và khiển trách, Ta sẽ khuyến khích và khuyến khích. Điều cốt lõi sẽ còn lại.”
Ye pana ujukā sikkhākāmā, tesaṃ suviññeyyaṃ katvā ākaṅkheyyasuttādisadisaṃ dhammaṃ deseti, ‘‘abhirama, tissa, abhirama, tissa, ahamovādena ahamanuggahena ahamanusāsaniyā’’ti (saṃ. ni. 3.84) ca ne samassāseti.
But to those who are upright and desirous of learning, he teaches the Dhamma, making it easy to understand, like the Ākaṅkheyya Sutta, and he comforts them, saying: "Delight, Tissa, delight, Tissa. I am here to advise you, to encourage you, to instruct you."
Còn đối với những người chân thật, muốn học hỏi, Ngài thuyết pháp như Ākaṅkheyya Sutta, v.v., làm cho dễ hiểu, và an ủi họ rằng: “Này Tissa, hãy an vui, hãy an vui! Ta sẽ giáo huấn, Ta sẽ khuyến khích, Ta sẽ chỉ dạy.”
Ayaṃ anuggahamukhena desanā.
This is teaching through encouragement.
Đây là cách thuyết pháp theo lối khuyến khích.
Ayaṃ pana devaputto mānatthaddho paṇḍitamānī, evaṃ kirassa ahosi – ahaṃ oghaṃ jānāmi, tathāgatassa oghatiṇṇabhāvaṃ jānāmi, ‘‘iminā pana kāraṇena tiṇṇo’’ti ettakamattaṃ na jānāmi.
But this devaputta was stiff with conceit, conceited that he was wise. He thought: "I know the flood, I know that the Tathāgata has crossed the flood. But I do not know just by what means he crossed.
Còn vị thiên tử này thì kiêu mạn và tự cho mình là thông thái. Vị ấy đã nghĩ như vầy: “Ta biết các dòng thác (Ogha). Ta biết Thế Tôn đã vượt qua các dòng thác. Ta chỉ không biết nguyên nhân Ngài đã vượt qua.
Iti mayhaṃ ñātameva bahu, appaṃ aññātaṃ, tamahaṃ kathitamattameva jānissāmi.
Thus, what I know is much, and what I do not know is little. I will know that little just by being told.
Như vậy, điều ta đã biết thì nhiều, điều ta chưa biết thì ít. Ta sẽ biết ngay khi Ngài nói ra.
Kiñhi nāma taṃ bhagavā vadeyya, yassāhaṃ atthaṃ na jāneyyanti.
For what could the Blessed One say, the meaning of which I would not know?"
Làm sao Thế Tôn có thể nói điều gì mà ta không hiểu được?”
Atha satthā ‘‘ayaṃ kiliṭṭhavatthaṃ viya raṅgajātaṃ abhabbo imaṃ mānaṃ appahāya desanaṃ sampaṭicchituṃ, mānaniggahaṃ tāvassa katvā puna nīcacittena pucchantassa pakāsessāmī’’ti paṭicchannaṃ katvā pañhaṃ kathesi.
Then the Teacher thought: "This devatā is like a dirty cloth that is unfit to receive dye; he is unfit to receive the teaching without abandoning this conceit. Having first admonished his conceit, I will then reveal it to him when he asks with a humble mind." So, he gave a concealed answer to the question.
Bấy giờ, Đạo Sư nghĩ: “Vị thiên nhân này giống như một mảnh vải dơ đã nhuộm màu, không thể nhận thêm thuốc nhuộm. Nếu không từ bỏ sự kiêu mạn này, vị ấy không thể tiếp nhận giáo pháp. Ta sẽ khiển trách sự kiêu mạn của vị ấy trước, sau đó khi vị ấy hỏi với tâm khiêm hạ, Ta sẽ giải thích.” Thế Tôn đã trả lời câu hỏi một cách ẩn mật.
Sopi nihatamāno ahosi, sā cassa nihatamānatā uttaripañhapucchaneneva veditabbā.
And he became one whose conceit was struck down; that state of his struck-down conceit should be understood by his asking a further question.
Vị thiên nhân ấy cũng đã từ bỏ sự kiêu mạn. Việc vị ấy từ bỏ sự kiêu mạn có thể được biết qua việc vị ấy hỏi thêm câu hỏi.
Tassa pana pañhapucchanassa ayamattho – kathaṃ pana tvaṃ, mārisa, appatiṭṭhaṃ anāyūhaṃ oghamatari, yathāhaṃ jānāmi, evaṃ me kathehīti.
The meaning of his question was: "How, Mārisa, did you cross the flood without standing still and without striving? Tell me, so that I may understand."
Ý nghĩa của câu hỏi đó là: “Thưa Thế Tôn, Ngài đã vượt qua các dòng thác mà không đứng lại, không nỗ lực như thế nào? Xin Ngài hãy giải thích cho con để con hiểu rõ.”
Athassa bhagavā kathento yadāsvāhantiādimāha.
Then the Blessed One, answering him, began with when I (yadāsvāhaṃ).
Bấy giờ, Thế Tôn đã giải thích cho vị ấy bằng cách nói yadāsvāhaṃ (khi ta) và những lời tiếp theo.
Tattha yadā svāhanti yasmiṃ kāle ahaṃ.
Here, when I means at what time I.
Trong đó, yadā svāhaṃ có nghĩa là “vào lúc nào ta”.
Sukāro nipātamattaṃ.
The particle su is merely an expletive.
Âm “su” chỉ là một giới từ.
Yathā ca ettha, evaṃ sabbapadesu.
And as here, so in all passages.
Ở đây như vậy, và ở tất cả các đoạn khác cũng vậy.
Saṃsīdāmīti paṭicchannaṃ katvā ataranto tattheva osīdāmi.
I would sink means, if I were to cross by concealing, I would sink right there.
Saṃsīdāmi (ta chìm xuống) có nghĩa là ta chìm xuống ngay tại đó khi không vượt qua, che giấu.
Nibbuyhāmīti ṭhātuṃ asakkonto ativattāmi.
I would be swept away means, being unable to stay, I would be carried past.
Nibbuyhāmi (ta trôi đi) có nghĩa là ta bị cuốn trôi khi không thể đứng vững.
Iti ṭhāne ca vāyāme ca dosaṃ disvā atiṭṭhanto avāyamanto oghamatarinti evaṃ bhagavatā pañho kathito.
Thus, seeing fault in both stopping and striving, the Blessed One answered the question by saying that he crossed the flood without stopping and without striving.
Như vậy, Thế Tôn đã trả lời câu hỏi rằng Ngài đã vượt qua các dòng thác mà không đứng lại và không nỗ lực, vì Ngài đã thấy lỗi lầm trong việc đứng lại và nỗ lực.
Devatāyapi paṭividdho, na pana pākaṭo, tassa pākaṭīkaraṇatthaṃ satta dukā dassitā.
The devatā understood it, but it was not clear to him; to make it clear, seven pairs of explanations are given.
Vị thiên nhân ấy cũng đã hiểu, nhưng chưa rõ ràng. Để làm cho rõ ràng, bảy cặp đối lập đã được trình bày.
Kilesavasena hi santiṭṭhanto saṃsīdati nāma, abhisaṅkhāravasena āyūhanto nibbuyhati nāma.
Indeed, one who stands still due to defilements is said to sink, and one who strives due to volitional formations (abhisaṅkhāra) is said to be swept away.
Thật vậy, khi đứng lại theo nghiệp phiền não, người ta chìm xuống; khi nỗ lực theo nghiệp tạo tác, người ta trôi đi.
Taṇhādiṭṭhīhi vā santiṭṭhanto saṃsīdati nāma, avasesakilesānañceva abhisaṅkhārānañca vasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to craving (taṇhā) and views (diṭṭhi) is said to sink, and one who strives due to the remaining defilements and volitional formations is said to be swept away.
Hoặc khi đứng lại bởi tham ái và tà kiến, người ta chìm xuống; khi nỗ lực bởi các phiền não còn lại và các nghiệp tạo tác, người ta trôi đi.
Taṇhāvasena vā santiṭṭhanto saṃsīdati nāma, diṭṭhivasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to craving is said to sink, and one who strives due to views is said to be swept away.
Hoặc khi đứng lại bởi tham ái, người ta chìm xuống; khi nỗ lực bởi tà kiến, người ta trôi đi.
Sassatadiṭṭhiyā vā santiṭṭhanto saṃsīdati nāma, ucchedadiṭṭhiyā āyūhanto nibbuyhati nāma.
Or, one who stands still due to eternalism (sassatadiṭṭhi) is said to sink, and one who strives due to annihilationism (ucchedadiṭṭhi) is said to be swept away.
Hoặc khi đứng lại bởi thường kiến, người ta chìm xuống; khi nỗ lực bởi đoạn kiến, người ta trôi đi.
Olīyanābhinivesā hi bhavadiṭṭhi, atidhāvanābhinivesā vibhavadiṭṭhi.
For the attachment to existence (bhavadiṭṭhi) is an inclination to cling, and the attachment to non-existence (vibhavadiṭṭhi) is an inclination to rush forward.
Vì chấp thủ hữu kiến là sự bám víu vào sự trì trệ, còn chấp thủ vô hữu kiến là sự bám víu vào sự phóng dật.
Līnavasena vā santiṭṭhanto saṃsīdati nāma, uddhaccavasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to lethargy (līna) is said to sink, and one who strives due to restlessness (uddhacca) is said to be swept away.
Hoặc khi đứng lại bởi sự lười biếng, người ta chìm xuống; khi nỗ lực bởi sự phóng dật, người ta trôi đi.
Tathā kāmasukhallikānuyogavasena santiṭṭhanto saṃsīdati nāma, attakilamathānuyogavasena āyūhanto nibbuyhati nāma.
Similarly, one who stands still due to indulgence in sensual pleasures is said to sink, and one who strives due to devotion to self-mortification is said to be swept away.
Tương tự, khi đứng lại bởi sự tận hưởng dục lạc, người ta chìm xuống; khi nỗ lực bởi sự khổ hạnh ép xác, người ta trôi đi.
Sabbākusalābhisaṅkhāravasena santiṭṭhanto saṃsīdati nāma, sabbalokiyakusalābhisaṅkhāravasena āyūhanto nibbuyhati nāma.
By standing firm due to all unwholesome volitional formations, one is said to sink; by striving due to all worldly wholesome volitional formations, one is said to be carried away.
Khi an trú theo mọi hành bất thiện (apuññābhisaṅkhāra) thì gọi là chìm đắm, khi nỗ lực theo mọi hành thiện thế gian (puññābhisaṅkhāra) thì gọi là bị cuốn trôi.
Vuttampi cetaṃ – ‘‘seyyathāpi, cunda, ye keci akusalā dhammā, sabbe te adhobhāgaṅgamanīyā, ye keci kusalā dhammā, sabbe te uparibhāgaṅgamanīyā’’ti (ma. ni. 1.86).
And this was also stated: ‘Just as, Cunda, whatever unwholesome states there are, all of them lead to the lower realms; whatever wholesome states there are, all of them lead to the higher realms.’
Điều này cũng đã được nói: “Này Cunda, phàm những pháp bất thiện nào, tất cả đều đưa đến phần hạ; phàm những pháp thiện nào, tất cả đều đưa đến phần thượng.”
Imaṃ pañhavissajjanaṃ sutvāva devatā sotāpattiphale patiṭṭhāya tuṭṭhā pasannā attano tuṭṭhiñca pasādañca pakāsayantī cirassaṃ vatāti gāthamāha.
Having heard this answer to the question, the deity, having established herself in the fruition of stream-entry, delighted and pleased, expressing her delight and pleasure, spoke the verse, " It has been a long time!"
Sau khi nghe lời giải đáp vấn nạn này, vị thiên nhân ấy đã an trú vào quả Dự lưu, hoan hỷ và tịnh tín, bày tỏ sự hoan hỷ và tịnh tín của mình, đã nói bài kệ “Đã lâu lắm rồi”.
Tattha cirassanti cirassa kālassa accayenāti attho.
Here, " cirassaṃ" means after a long time.
Trong đó, cirassaṃ có nghĩa là sau khi một thời gian dài đã trôi qua.
Ayaṃ kira devatā kassapasammāsambuddhaṃ disvā tassa parinibbānato paṭṭhāya antarā aññaṃ buddhaṃ na diṭṭhapubbā, tasmā ajja bhagavantaṃ disvā evamāha.
It is said that this deity, having seen the Perfectly Enlightened Buddha Kassapa, had not seen another Buddha in between, from the time of his Parinibbāna, and therefore spoke thus today upon seeing the Blessed One.
Vị thiên nhân này đã từng thấy Đức Phật Chánh Đẳng Giác Kassapa, và kể từ khi Ngài nhập Niết Bàn, vị ấy chưa từng thấy một vị Phật nào khác. Do đó, hôm nay khi thấy Đức Thế Tôn, vị ấy đã nói như vậy.
Kiṃ panimāya devatāya ito pubbe satthā na diṭṭhapubboti.
"But had this deity not seen the Teacher before this?"
Há vị thiên nhân này chưa từng thấy Đức Đạo Sư trước đây sao?
Diṭṭhapubbo vā hotu adiṭṭhapubbo vā, dassanaṃ upādāya evaṃ vattuṃ vaṭṭati.
Whether he had been seen before or not, it is fitting to speak thus based on the seeing.
Dù đã từng thấy hay chưa từng thấy, việc nói như vậy là thích hợp dựa trên sự thấy hiện tại.
Brāhmaṇanti bāhitapāpaṃ khīṇāsavabrāhmaṇaṃ.
" Brāhmaṇaṃ" means a brāhmaṇa whose defilements have been cast out, one whose taints are destroyed.
Brāhmaṇaṃ là một vị Bà-la-môn đã loại bỏ tội lỗi, một vị A-la-hán đã diệt trừ các lậu hoặc.
Parinibbutanti kilesanibbānena nibbutaṃ.
" Parinibbutaṃ" means one who is extinguished by the extinguishment of defilements.
Parinibbutaṃ là đã tịch diệt bằng sự tịch diệt phiền não.
Loketi sattaloke.
" Loke" means in the world of beings.
Loke là trong thế giới chúng sinh.
Visattikanti rūpādīsu ārammaṇesu āsattavisattatādīhi kāraṇehi visattikā vuccati taṇhā, taṃ visattikaṃ appatiṭṭhamānaṃ anāyūhamānaṃ tiṇṇaṃ nittiṇṇaṃ uttiṇṇaṃ cirassaṃ vata khīṇāsavabrāhmaṇaṃ passāmīti attho.
" Visattikaṃ" means craving is called visattikā due to reasons such as attachment and entanglement in sense objects like visible forms; the meaning is, "Oh, it has been a long time since I have seen a brāhmaṇa whose taints are destroyed, who does not cling (to visattikā), who does not strive, who has crossed over (the three defilements), who has truly crossed over (the four floods), and who has thoroughly crossed over."
Visattikaṃ là tham ái được gọi là visattikā do các nguyên nhân như sự bám víu và dính mắc vào các đối tượng như sắc pháp, v.v. Có nghĩa là: “Đã lâu lắm rồi, ta mới thấy một vị Bà-la-môn đã diệt trừ các lậu hoặc, không bám víu, không nỗ lực, đã vượt qua, đã hoàn toàn vượt qua, đã siêu việt khỏi ba cõi (tham ái, tà kiến, phiền não bám víu).”
2. Idāni dutiyasuttato paṭṭhāya paṭhamamāgatañca uttānatthañca pahāya yaṃ yaṃ anuttānaṃ, taṃ tadeva vaṇṇayissāma.
Now, starting from the second sutta, we will comment only on what is not clear, omitting what has appeared previously and what is obvious.
2. Bây giờ, bắt đầu từ bài kinh thứ hai, chúng ta sẽ chỉ giải thích những gì không rõ ràng, bỏ qua những gì đã được giải thích trước đó và những gì có nghĩa rõ ràng.
Jānāsi noti jānāsi nu.
" Jānāsi no" means "Do you know?"
Jānāsi no có nghĩa là jānāsi nu (ngài có biết không?).
Nimokkhantiādīni maggādīnaṃ nāmāni.
" Nimokkha" and so forth are names for the path and so on.
Nimokkha và các từ khác là tên gọi của Đạo và các quả.
Maggena hi sattā kilesabandhanato nimuccanti, tasmā maggo sattānaṃ nimokkhoti vutto.
For by means of the path, beings are freed from the bondage of defilements; therefore, the path is called " nimokkha" (liberation) for beings.
Thật vậy, nhờ Đạo mà chúng sinh được giải thoát khỏi sự trói buộc của phiền não, do đó Đạo được gọi là nimokkha của chúng sinh.
Phalakkhaṇe pana te kilesabandhanato pamuttā, tasmā phalaṃ sattānaṃ pamokkhoti vuttaṃ.
At the moment of fruition (phala), they are completely liberated from the bondage of defilements; therefore, fruition is called " pamokkha" (complete liberation) for beings.
Đến lúc chứng quả, họ được giải thoát hoàn toàn khỏi sự trói buộc của phiền não, do đó Quả được gọi là pamokkha của chúng sinh.
Nibbānaṃ patvā sattānaṃ sabbadukkhaṃ viviccati, tasmā nibbānaṃ vivekoti vuttaṃ.
Having attained Nibbāna, all suffering is separated from beings; therefore, Nibbāna is called " viveka" (seclusion).
Khi đạt đến Nibbāna, mọi khổ đau của chúng sinh đều được chấm dứt, do đó Nibbāna được gọi là viveka.
Sabbāni vā etāni nibbānasseva nāmāni.
Alternatively, all these are names for Nibbāna itself.
Hoặc tất cả những điều này đều là tên gọi của Nibbāna.
Nibbānañhi patvā sattā sabbadukkhato nimuccanti pamuccanti viviccanti, tasmā tadeva ‘‘nimokkho pamokkho viveko’’ti vuttaṃ.
For having attained Nibbāna, beings are liberated, completely liberated, and secluded from all suffering; therefore, Nibbāna itself is called "nimokkha, pamokkha, viveka."
Thật vậy, khi đạt đến Nibbāna, chúng sinh được giải thoát, được hoàn toàn giải thoát, được chấm dứt khỏi mọi khổ đau, do đó Nibbāna được gọi là “nimokkha, pamokkha, viveka”.
Jānāmi khvāhanti jānāmi kho ahaṃ.
" Jānāmi khvāhaṃ" means "I surely know."
Jānāmi khvāhaṃ có nghĩa là jānāmi kho ahaṃ (chắc chắn tôi biết).
Avadhāraṇattho khokāro.
The particle kho has the meaning of emphasis.
Tiểu từ kho có nghĩa là xác quyết.
Ahaṃ jānāmiyeva.
I surely know.
Tôi chắc chắn biết.
Sattānaṃ nimokkhādijānanatthameva hi mayā samatiṃsa pāramiyo pūretvā sabbaññutaññāṇaṃ paṭividdhanti sīhanādaṃ nadati.
Indeed, the Buddha roars a lion's roar, saying, "It was precisely for the sake of knowing the liberation and so forth of beings that I fulfilled the thirty perfections and penetrated Omniscience."
Thật vậy, để biết được sự giải thoát của chúng sinh, v.v., tôi đã hoàn thành ba mươi Ba-la-mật và chứng đắc Nhất thiết trí – Đức Thế Tôn đã rống lên tiếng rống sư tử như vậy.
Buddhasīhanādaṃ nāma kira etaṃ suttaṃ.
It is said that this sutta is a lion's roar of the Buddha.
Bài kinh này được gọi là tiếng rống sư tử của Đức Phật.
Nandībhavaparikkhayāti nandīmūlakassa kammabhavassa parikkhayena.
" Nandībhavaparikkhayā" means by the destruction of kamma-bhava that has nandī (delight) as its root.
Nandībhavaparikkhayā có nghĩa là do sự đoạn diệt của nghiệp hữu (kammabhava) có gốc rễ là hoan hỷ (nandī).
Nandiyā ca bhavassa cātipi vaṭṭati.
It is also suitable to say "by the destruction of nandī and bhava."
Cũng có thể hiểu là do sự đoạn diệt của hoan hỷ và hữu.
Tattha hi purimanaye nandībhavena tividhakammābhisaṅkhāravasena saṅkhārakkhandho gahito, saññāviññāṇehi taṃsampayuttā ca dve khandhā.
Here, in the former interpretation, by nandībhava, the saṅkhārakkhandha (volitional formations aggregate) is taken in the sense of the three kinds of kammābhisaṅkhāra; and by saññā and viññāṇa, the two aggregates associated with it are taken.
Trong cách giải thích trước, từ nandībhava được dùng để chỉ uẩn hành (saṅkhārakkhandha) theo ba loại nghiệp hành, và hai uẩn còn lại (tưởng và thức) cũng được bao hàm do liên hệ với uẩn hành.
Tehi pana tīhi khandhehi sampayuttā vedanā tesaṃ gahaṇena gahitāvāti anupādiṇṇakānaṃ catunnaṃ arūpakkhandhānaṃ appavattivasena saupādisesaṃ nibbānaṃ kathitaṃ hoti.
The vedanākkhandha (feeling aggregate) associated with these three aggregates is implicitly taken with their inclusion, thus Nibbāna with a remnant of substratum (saupādisesa-nibbāna) is described as the non-occurrence of the four non-appropriated formless aggregates.
Khi ba uẩn này được bao hàm, thọ uẩn (vedanākkhandha) liên hệ với chúng cũng được bao hàm. Như vậy, Nibbāna hữu dư y (saupādisesa-nibbāna) được nói đến là sự không tái diễn của bốn uẩn vô sắc không bị chấp thủ.
Vedanānaṃ nirodhā upasamāti upādiṇṇakavedanānaṃ nirodhena ca upasamena ca.
" Vedanānaṃ nirodhā upasamā" means by the cessation and appeasement of the appropriated feelings.
Vedanānaṃ nirodhā upasamā có nghĩa là do sự diệt trừ và chấm dứt các thọ uẩn bị chấp thủ.
Tattha vedanāgahaṇena taṃsampayuttā tayo khandhā gahitāva honti, tesaṃ vatthārammaṇavasena rūpakkhandhopi.
Here, by the mention of feelings, the three aggregates associated with it are implicitly taken, and also the rūpakkhandha (form aggregate) in terms of its basis and object.
Trong đó, khi thọ uẩn được đề cập, ba uẩn liên hệ với nó cũng được bao hàm, và sắc uẩn (rūpakkhandha) cũng được bao hàm do liên hệ với nền tảng và đối tượng của chúng.
Evaṃ imesaṃ upādiṇṇakānaṃ pañcannaṃ khandhānaṃ appavattivasena anupādisesaṃ nibbānaṃ kathitaṃ hoti.
Thus, Nibbāna without a remnant of substratum (anupādisesa-nibbāna) is described as the non-occurrence of these five appropriated aggregates.
Như vậy, Nibbāna vô dư y (anupādisesa-nibbāna) được nói đến là sự không tái diễn của năm uẩn bị chấp thủ này.
Dutiyanaye pana nandiggahaṇena saṅkhārakkhandho gahito, bhavaggahaṇena upapattibhavasaṅkhāto rūpakkhandho, saññādīhi sarūpeneva tayo khandhā.
In the second interpretation, by the mention of nandī, the saṅkhārakkhandha is taken; by the mention of bhava, the rūpakkhandha referred to as upapattibhava (rebirth-existence) is taken; and by saññā, etc., the three aggregates are taken in their literal sense.
Trong cách giải thích thứ hai, từ nandī được dùng để chỉ uẩn hành, từ bhava được dùng để chỉ sắc uẩn dưới dạng tái sinh hữu (upapattibhava), và ba uẩn còn lại (tưởng, thức, thọ) được nói đến trực tiếp bằng chính tên gọi của chúng.
Evaṃ imesaṃ pañcannaṃ khandhānaṃ appavattivasena nibbānaṃ kathitaṃ hotīti veditabbaṃ.
Thus, Nibbāna is described as the non-occurrence of these five aggregates. This should be understood.
Như vậy, cần phải hiểu rằng Nibbāna được nói đến là sự không tái diễn của năm uẩn này.
Imameva ca nayaṃ catunikāyikabhaṇḍikatthero roceti.
And the Elder Bandika, expert in the four Nikāyas, approves of this very method.
Trưởng lão Bhāṇḍika, người thông thạo bốn bộ Nikāya, cũng tán thành cách giải thích này.
Iti nibbānavaseneva bhagavā desanaṃ niṭṭhāpesīti.
Thus, the Blessed One concluded the teaching primarily by referring to Nibbāna.
Như vậy, Đức Thế Tôn đã kết thúc bài thuyết pháp của mình bằng cách nói về Nibbāna.
3. Tatiye upanīyatīti parikkhīyati nirujjhati, upagacchati vā, anupubbena maraṇaṃ upetīti attho.
In the third*, " upanīyati" means it is worn out, it ceases, or it approaches, meaning it gradually approaches death.
3. Trong bài kinh thứ ba, upanīyatī có nghĩa là bị tiêu diệt, bị chấm dứt, hoặc đi đến, có nghĩa là dần dần đi đến cái chết.
Yathā vā gopālena gogaṇo nīyati, evaṃ jarāya maraṇasantikaṃ upanīyatīti attho.
Or, just as a herdsman leads a herd of cows, so too old age leads one to death.
Hoặc, như người chăn bò dẫn đàn bò đi, tương tự, tuổi già dẫn đến cái chết.
Jīvitanti jīvitindriyaṃ.
" Jīvitaṃ" means the life-faculty.
Jīvitaṃ là sinh mạng (jīvitindriya).
Appanti parittaṃ thokaṃ.
" Appaṃ" means little, small.
Appaṃ là ít ỏi, nhỏ nhoi.
Tassa dvīhākārehi parittatā veditabbā sarasaparittatāya ca khaṇaparittatāya ca.
Its shortness should be understood in two ways: shortness in terms of its natural flow and shortness in terms of its momentariness.
Sự ít ỏi của nó cần được hiểu theo hai cách: ít ỏi về bản chất và ít ỏi về sát-na.
Sarasaparittatāyapi hi ‘‘yo, bhikkhave, ciraṃ jīvati, so vassasataṃ appaṃ vā bhiyyo’’ti (dī. ni. 2.7; saṃ. ni. 2.143) vacanato parittaṃ.
Even in terms of its natural shortness, it is short, as stated: "Monks, whoever lives long, lives a hundred years or a little more."
Về sự ít ỏi về bản chất, nó là ít ỏi theo lời dạy: “Này các Tỳ-khưu, ai sống lâu thì sống một trăm năm, hoặc hơn một chút.”
Khaṇaparittatāyapi.
And in terms of its momentary shortness.
Về sự ít ỏi về sát-na.
Paramatthato hi atiparitto sattānaṃ jīvitakkhaṇo ekacittappavattimattoyeva.
For in the ultimate sense, the life-moment of beings is extremely short, lasting only for a single thought-moment.
Thật vậy, xét về mặt tối hậu, sát-na sinh mạng của chúng sinh là cực kỳ ít ỏi, chỉ bằng một sát-na tâm khởi lên mà thôi.
Yathā nāma rathacakkaṃ pavattamānampi ekeneva nemippadesena pavattati, tiṭṭhamānampi ekeneva tiṭṭhati, evamevaṃ ekacittakkhaṇikaṃ sattānaṃ jīvitaṃ, tasmiṃ citte niruddhamatte satto niruddhoti vuccati.
Just as a chariot wheel, even when moving, moves with only one part of its rim, and even when standing still, rests on only one part, so too the life of beings is momentary, lasting for a single thought-moment, and as soon as that thought ceases, the being is said to have ceased.
Như bánh xe đang lăn cũng chỉ lăn trên một điểm của vành, khi dừng lại cũng chỉ dừng trên một điểm, tương tự, sinh mạng của chúng sinh chỉ kéo dài một sát-na tâm. Khi tâm ấy diệt, chúng sinh được gọi là đã diệt.
Yathāha – atīte cittakkhaṇe jīvittha na jīvati na jīvissati, anāgate cittakkhaṇe jīvissati na jīvati na jīvittha, paccuppanne cittakkhaṇe jīvati na jīvittha na jīvissati.
As it is said: In the past thought-moment, one lived, one does not live now, one will not live in the future; in the future thought-moment, one will live, one does not live now, one did not live in the past; in the present thought-moment, one lives, one did not live in the past, one will not live in the future.
Như đã nói: “Trong sát-na tâm quá khứ, đã sống, không sống hiện tại, không sống tương lai. Trong sát-na tâm tương lai, sẽ sống, không sống hiện tại, không sống quá khứ. Trong sát-na tâm hiện tại, đang sống, không sống quá khứ, không sống tương lai.”
Jarūpanītassāti jaraṃ upagatassa, jarāya vā maraṇasantikaṃ upanītassa.
" Jarūpanītassā" means for one who has approached old age, or for one led to death by old age.
Tất cả đều giống nhau, đã đi không tái sinh.
Na santi tāṇāti tāṇaṃ leṇaṃ saraṇaṃ bhavituṃ samatthā nāma keci natthi.
" Na santi tāṇā" means there is no one capable of being a protector, a shelter, a refuge.
Không phải bởi cái chưa sinh mà sinh,
Etaṃ bhayanti etaṃ jīvitindriyassa maraṇūpagamanaṃ, āyuparittatā, jarūpanītassa tāṇābhāvoti tividhaṃ bhayaṃ bhayavatthu bhayakāraṇanti attho.
" Etaṃ bhayaṃ" means this three-fold fear: the approach of death for the life-faculty, the shortness of life, and the absence of a protector for one led by old age, which is a cause of fear, a situation of fear.
Bởi cái hiện tại mà sống;
Puññāni kayirātha sukhāvahānīti viññū puriso sukhāvahāni sukhadāyakāni puññāni kareyya.
" Puññāni kayirātha sukhāvahānī" means a wise person should perform meritorious deeds that bring happiness, that give happiness.
Thế gian chết do tâm diệt, với sự chế định tối hậu.”
Iti devatā rūpāvacarajjhānaṃ sandhāya pubbacetanaṃ aparacetanaṃ muñcacetanañca gahetvā bahuvacanavasena ‘‘puññānī’’ti āha.
Thus, the deva, referring to the rūpāvacara jhāna, and taking the previous volition (pubbacetanā), the subsequent volition (aparacetanā), and the abandoning volition (muñcacetanā), spoke of "merits" (puññāni) in the plural.
Như vậy, vị thiên nhân ấy, nhắm đến thiền sắc giới (rūpāvacarajjhāna), đã lấy tư tâm sở (cetanā) trước (pubbacetanā), tư tâm sở sau (aparacetanā) và tư tâm sở xả (muñcacetanā), rồi dùng số nhiều mà nói là ‘các công đức’ (puññāni).
Jhānassādaṃ jhānanikantiṃ jhānasukhañca gahetvā ‘‘sukhāvahānī’’ti āha.
Taking the delight in jhāna (jhānassāda), the craving for jhāna (jhānanikanti), and the pleasure of jhāna (jhānasukha), he said, "bringing happiness" (sukhāvahāni).
Lấy sự hoan hỷ của thiền (jhānassāda), sự yêu thích thiền (jhānanikanti) và sự an lạc của thiền (jhānasukha), vị ấy nói là ‘đem lại an lạc’ (sukhāvahāni).
Tassā kira devatāya sayaṃ dīghāyukaṭṭhāne brahmaloke nibbattattā heṭṭhā kāmāvacaradevesu parittāyukaṭṭhāne cavamāne upapajjamāne ca thullaphusitake vuṭṭhipātasadise satte disvā etadahosi ‘‘ahovatime sattā jhānaṃ bhāvetvā aparihīnajjhānā kālaṃ katvā brahmaloke ekakappa-dvekappa-catukappa-aṭṭhakappa-soḷasakappa-dvattiṃsakappa-catusaṭṭhikappappamāṇaṃ addhānaṃ tiṭṭheyyu’’nti.
Now, because that deva himself had been reborn in the Brahma-world, a state of long life, he saw beings in the lower Kāma-worlds, realms of short life, passing away and being reborn like falling large raindrops, and it occurred to him: "Oh, if these beings were to cultivate jhāna, and after dying with unimpared jhāna, were to remain in the Brahma-world for a period of one, two, four, eight, sixteen, thirty-two, or sixty-four kappas! How wonderful!"
Vị thiên nhân ấy, vì tự mình tái sinh vào cõi Phạm thiên là nơi có tuổi thọ dài, đã thấy các chúng sinh ở các cõi trời dục giới bên dưới, nơi có tuổi thọ ngắn ngủi, đang hoại diệt và tái sinh, giống như những hạt mưa lớn rơi xuống, nên đã nghĩ rằng: “Ôi, ước gì những chúng sinh này, sau khi tu tập thiền và không bị suy thoái thiền, sẽ chết và tái sinh vào cõi Phạm thiên, sống lâu một kiếp, hai kiếp, bốn kiếp, tám kiếp, mười sáu kiếp, ba mươi hai kiếp, sáu mươi bốn kiếp!”.
Tasmā evamāha.
Therefore, he spoke thus.
Vì thế, vị ấy nói như vậy.
Atha bhagavā – ‘‘ayaṃ devatā aniyyānikaṃ vaṭṭakathaṃ kathetī’’ti vivaṭṭamassā dassento dutiyaṃ gāthamāha.
Then, the Blessed One, seeing that "this deva is speaking words pertaining to saṃsāra, which do not lead to liberation," spoke the second stanza, showing him the end of saṃsāra.
Khi đó, Đức Thế Tôn, thấy rằng “vị thiên nhân này đang nói về luân hồi (vaṭṭa) không đưa đến giải thoát (aniyyānikaṃ)”, nên đã nói kệ thứ hai để chỉ cho vị ấy thấy sự thoát ly (vivaṭṭa).
Tattha lokāmisanti dve lokāmisā pariyāyena ca nippariyāyena ca.
Here, lokāmisa (worldly allurements) are of two kinds: indirect (pariyāyena) and direct (nippariyāyena).
Trong đó, lợi lộc thế gian (lokāmisaṃ) có hai loại: theo cách gián tiếp (pariyāya) và trực tiếp (nippariyāya).
Pariyāyena tebhūmakavaṭṭaṃ lokāmisaṃ, nippariyāyena cattāro paccayā.
Indirectly, the cycle of the three realms (tebhūmaka vaṭṭa) is lokāmisa; directly, the four requisites are lokāmisa.
Theo cách gián tiếp, luân hồi ba cõi (tebhūmaka-vaṭṭa) là lợi lộc thế gian; theo cách trực tiếp, bốn vật dụng (paccaya) là lợi lộc thế gian.
Idha pariyāyalokāmisaṃ adhippetaṃ.
Here, the indirect lokāmisa is intended.
Ở đây, lợi lộc thế gian theo cách gián tiếp (pariyāyalokāmisaṃ) được đề cập.
Nippariyāyalokāmisampi vaṭṭatiyeva.
The direct lokāmisa is also appropriate.
Lợi lộc thế gian theo cách trực tiếp (nippariyāyalokāmisaṃ) cũng phù hợp.
Santipekkhoti nibbānasaṅkhātaṃ accantasantiṃ pekkhanto icchanto patthayantoti.
Santipekkho means one who seeks, desires, or yearns for the absolute peace known as Nibbāna.
Người tìm cầu sự an tịnh (santipekkho) nghĩa là người tìm kiếm, mong muốn, khao khát sự an tịnh tối thượng, tức là Niết Bàn (nibbāna).
4. Catutthe accentīti atikkamanti.
In the fourth (sutta), accenti means they pass beyond.
4. Trong kinh thứ tư, họ trôi qua (accenti) nghĩa là họ vượt qua.
Kālāti purebhattādayo kālā.
Kālā refers to times such as the time before a meal.
Thời gian (kālā) là các thời gian như trước bữa ăn.
Tarayanti rattiyoti rattiyo atikkamamānā puggalaṃ maraṇūpagamanāya tarayanti sīghaṃ sīghaṃ gamayanti.
Tarayanti rattiyo means that the nights, as they pass, carry the individual swiftly towards death.
Các đêm trôi qua (tarayanti rattiyo) nghĩa là các đêm trôi qua, khiến con người nhanh chóng tiến đến cái chết.
Vayoguṇāti paṭhamamajjhimapacchimavayānaṃ guṇā, rāsayoti attho.
Vayoguṇā means the aggregates of the first, middle, and last ages; that is, the heaps.
Các đặc tính của tuổi tác (vayoguṇā) là các đặc tính của tuổi thơ, tuổi trung niên và tuổi già, nghĩa là các giai đoạn tuổi tác.
‘‘Anujānāmi, bhikkhave, ahatānaṃ vatthānaṃ diguṇaṃ saṅghāṭi’’nti (mahāva. 348) ettha hi paṭalaṭṭho guṇaṭṭho.
For instance, in "Monks, I allow a double outer robe of unstitched cloth" (Vin. Mahāvagga 348), guṇa means a layer.
Trong câu “Này các Tỳ-khưu, Ta cho phép dùng y Saṅghāṭi hai lớp bằng vải mới” (Mahāva. 348), chữ guṇa ở đây có nghĩa là lớp.
‘‘Sataguṇā dakkhiṇā pāṭikaṅkhitabbā’’ti (ma. ni. 3.379) ettha ānisaṃsaṭṭho.
In "a hundredfold reward is to be expected from the offering" (MN 3.379), it means benefit or advantage.
Trong câu “Dakkhiṇā được mong đợi có trăm guṇa” (Ma. Ni. 3.379), chữ guṇa ở đây có nghĩa là lợi ích.
‘‘Antaṃ antaguṇa’’nti ettha koṭṭhāsaṭṭho.
In "large intestine, small intestine," it means a section or part.
Trong câu “ruột già, ruột non” (antaṃ antaguṇaṃ), chữ guṇa ở đây có nghĩa là phần.
‘‘Kayirā mālāguṇe bahū’’ti (dha. pa. 53) ettha rāsaṭṭho.
In "one should make many garlands" (Dhp. 53), it means a heap or cluster.
Trong câu “có thể làm nhiều vòng hoa” (kayirā mālāguṇe bahū) (Dha. Pa. 53), chữ guṇa ở đây có nghĩa là vòng.
‘‘Pañca kāmaguṇā’’ti ettha bandhanaṭṭho.
In "the five strands of sensuality," it means a bond.
Trong câu “năm dục lạc” (pañca kāmaguṇā), chữ guṇa ở đây có nghĩa là sự ràng buộc.
Idha pana rāsaṭṭho guṇaṭṭho.
But here, guṇa means a heap or cluster.
Nhưng ở đây, chữ guṇa có nghĩa là giai đoạn.
Tasmā vayoguṇāti vayorāsayo veditabbā.
Therefore, vayoguṇā should be understood as heaps of ages.
Do đó, các đặc tính của tuổi tác (vayoguṇā) nên được hiểu là các giai đoạn của tuổi tác.
Anupubbaṃ jahantīti anupaṭipāṭiyā puggalaṃ jahanti.
Anupubbaṃ jahantī means they abandon the individual in succession.
Họ tuần tự rời bỏ (anupubbaṃ jahanti) nghĩa là họ tuần tự rời bỏ con người.
Majjhimavaye ṭhitaṃ hi paṭhamavayo jahati, pacchimavaye ṭhitaṃ dve paṭhamamajjhimā jahanti, maraṇakkhaṇe pana tayopi vayā jahanteva.
Indeed, the first age abandons one who is in the middle age; the first and middle ages abandon one who is in the last age; and at the moment of death, all three ages abandon.
Thật vậy, tuổi thơ rời bỏ người ở tuổi trung niên; tuổi thơ và tuổi trung niên rời bỏ người ở tuổi già; còn vào khoảnh khắc cái chết, cả ba tuổi tác đều rời bỏ.
Etaṃ bhayanti etaṃ kālānaṃ atikkamanaṃ, rattidivānaṃ taritabhāvo, vayoguṇānaṃ jahanabhāvoti tividhaṃ bhayaṃ.
Etaṃ bhayaṃ refers to this threefold fear: the passing of times, the swift passing of days and nights, and the abandoning by the aggregates of ages.
Nỗi sợ hãi này (etaṃ bhayaṃ) là ba loại sợ hãi: sự trôi qua của thời gian, sự trôi qua của ngày đêm, và sự rời bỏ của các giai đoạn tuổi tác.
Sesaṃ purimasadisamevāti.
The rest is similar to the previous (sutta).
Phần còn lại tương tự như trước.
5. Pañcame kati chindeti chindanto kati chindeyya.
In the fifth (sutta), kati chinde means "how many should one cut?"
5. Trong kinh thứ năm, bao nhiêu nên đoạn trừ (kati chinde) nghĩa là khi đoạn trừ, nên đoạn trừ bao nhiêu.
Sesapadesupi eseva nayo.
The same method applies to the remaining phrases as well.
Các đoạn văn còn lại cũng theo cách này.
Ettha ca ‘‘chinde jahe’’ti atthato ekaṃ.
Here, "chinde" (cut) and "jahe" (abandon) are one in meaning.
Ở đây, “đoạn trừ” (chinde) và “loại bỏ” (jahe) có cùng ý nghĩa.
Gāthābandhassa pana maṭṭhabhāvatthaṃ ayaṃ devatā saddapunaruttiṃ vajjayantī evamāha.
However, for the sake of the refinement of the poetic meter, this deva avoided verbal repetition and spoke thus.
Nhưng để làm cho cấu trúc bài kệ (gāthābandha) thêm trau chuốt, vị thiên nhân này đã tránh lặp lại từ ngữ và nói như vậy.
Kati saṅgātigoti kati saṅge atigato, atikkantoti attho.
Kati saṅgātigo means "how many bonds has one overcome, transcended?"
Vượt qua bao nhiêu sự ràng buộc (kati saṅgātigo) nghĩa là đã vượt qua bao nhiêu sự ràng buộc.
Saṅgātikotipi pāṭho, ayameva attho.
"Saṅgātiko" is also a reading, and the meaning is the same.
Cũng có bản đọc là Saṅgātiko, ý nghĩa vẫn như vậy.
Pañca chindeti chindanto pañca orambhāgiyasaṃyojanāni chindeyya.
Pañca chinde means, "when cutting, one should cut the five lower fetters (orambhāgiyasaṃyojanāni)."
Nên đoạn trừ năm (pañca chinde) nghĩa là khi đoạn trừ, nên đoạn trừ năm hạ phần kiết sử (orambhāgiyasaṃyojanāni).
Pañca jaheti jahanto pañcuddhambhāgiyasaṃyojanāni jaheyya.
Pañca jahe means, "when abandoning, one should abandon the five higher fetters (uddhambhāgiyasaṃyojanāni)."
Nên loại bỏ năm (pañca jahe) nghĩa là khi loại bỏ, nên loại bỏ năm thượng phần kiết sử (uddhambhāgiyasaṃyojanāni).
Idhāpi chindanañca jahanañca atthato ekameva, bhagavā pana devatāya āropitavacanānurūpeneva evamāha.
Here too, cutting and abandoning are one in meaning, but the Blessed One spoke thus in accordance with the words attributed to the deva.
Ở đây, việc đoạn trừ và loại bỏ cũng chỉ là một ý nghĩa, nhưng Đức Thế Tôn đã nói như vậy theo đúng lời vị thiên nhân đã nêu ra.
Atha vā pādesu baddhapāsasakuṇo viya pañcorambhāgiyasaṃyojanāni heṭṭhā ākaḍḍhamānākārāni honti, tāni anāgāmimaggena chindeyyāti vadati.
Alternatively, the five lower fetters are like a bird caught in a snare by its feet, pulling it downwards, and he means that one should cut them with the Anāgāmi path.
Hoặc, năm hạ phần kiết sử giống như con chim bị mắc bẫy ở chân, kéo xuống dưới, nên nói rằng hãy đoạn trừ chúng bằng đạo quả Bất Lai (Anāgāmimagga).
Hatthehi gahitarukkhasākhā viya pañcuddhambhāgiyasaṃyojanāni upari ākaḍḍhamānākārāni honti, tāni arahattamaggena jaheyyāti vadati.
The five higher fetters are like tree branches grasped by the hands, pulling one upwards, and he means that one should abandon them with the Arahantship path.
Năm thượng phần kiết sử giống như cành cây bị nắm bằng tay, kéo lên trên, nên nói rằng hãy loại bỏ chúng bằng đạo quả A-la-hán (Arahattamagga).
Pañca cuttari bhāvayeti etesaṃ saṃyojanānaṃ chindanatthāya ceva pahānatthāya ca uttari atirekaṃ visesaṃ bhāvento saddhāpañcamāni indriyāni bhāveyyāti attho.
Pañca cuttari bhāvaye means that, in order to cut and abandon these fetters, one should cultivate the faculties (indriyāni), the fifth of which is faith (saddhā), as an extra, special cultivation.
Nên tu tập thêm năm (pañca cuttari bhāvaye) nghĩa là để đoạn trừ và loại bỏ các kiết sử này, nên tu tập thêm các căn (indriya) với tín (saddhā) là thứ năm.
Pañca saṅgātigoti rāgasaṅgo dosasaṅgo mohasaṅgo mānasaṅgo diṭṭhisaṅgoti ime pañca saṅge atikkanto.
Pañca saṅgātigo means one who has overcome these five bonds: the bond of lust (rāgasaṅga), the bond of hatred (dosasaṅga), the bond of delusion (mohasaṅga), the bond of conceit (mānasaṅga), and the bond of wrong view (diṭṭhisaṅga).
Vượt qua năm sự ràng buộc (pañca saṅgātigo) nghĩa là đã vượt qua năm sự ràng buộc này: sự ràng buộc của tham (rāgasaṅgo), sự ràng buộc của sân (dosasaṅgo), sự ràng buộc của si (mohasaṅgo), sự ràng buộc của mạn (mānasaṅgo), sự ràng buộc của tà kiến (diṭṭhisaṅgo).
Oghatiṇṇoti vuccatīti caturoghatiṇṇoti kathīyati.
Oghatiṇṇoti vuccatī means one is called "one who has crossed the four floods (ogha)."
Được gọi là người đã vượt qua dòng nước lũ (oghatiṇṇoti vuccatī) nghĩa là được gọi là người đã vượt qua bốn dòng nước lũ (ogha).
Imāya pana gāthāya pañcindriyāni lokiyalokuttarāni kathitānīti.
And by this stanza, the five faculties, both mundane (lokiya) and supramundane (lokuttara), are taught.
Và trong bài kệ này, năm căn (pañcindriyāni) được nói đến là cả thế gian (lokiya) và siêu thế (lokuttara).
6. Chaṭṭhe jāgaratanti jāgarantānaṃ.
In the sixth (sutta), jāgarataṃ means "of those who are awake."
6. Trong kinh thứ sáu, người thức tỉnh (jāgarataṃ) nghĩa là những người đang thức tỉnh.
Pañca jāgaratanti vissajjanagāthāyaṃ pana saddhādīsu pañcasu indriyesu jāgarantesu pañca nīvaraṇā suttā nāma.
In the answering stanza, pañca jāgarataṃ means that when the five faculties (saddhā, etc.) are awake, the five hindrances are said to be asleep.
Trong bài kệ giải đáp (vissajjanagāthā) về năm người thức tỉnh (pañca jāgarataṃ), năm triền cái (nīvaraṇā) được gọi là đang ngủ khi năm căn như tín (saddhā) v.v. đang thức tỉnh.
Yasmā taṃsamaṅgīpuggalo yattha katthaci nisinno vā ṭhito vā aruṇaṃ uṭṭhapentopi pamādatāya akusalasamaṅgitāya sutto nāma hoti.
Because a person endowed with those (hindrances), whether sitting or standing anywhere, even at dawn, is said to be asleep due to heedlessness and being endowed with unwholesome states.
Vì một người có đầy đủ các triền cái đó, dù đang ngồi hay đứng ở bất cứ đâu, thậm chí khi bình minh ló dạng, vẫn được gọi là đang ngủ vì sự phóng dật (pamāda) và sự đầy đủ bất thiện (akusalasamaṅgitā).
Evaṃ suttesu pañcasu nīvaraṇesu pañcindriyāni jāgarāni nāma.
Similarly, when the five hindrances are asleep, the five faculties are said to be awake.
Tương tự như vậy, khi năm triền cái đang ngủ, năm căn được gọi là đang thức tỉnh.
Yasmā taṃsamaṅgīpuggalo yattha katthaci nipajjitvā niddāyantopi appamādatāya kusalasamaṅgitāya jāgaro nāma hoti.
Because a person endowed with those (faculties), even lying down and sleeping anywhere, is said to be awake due to heedfulness and being endowed with wholesome states.
Vì một người có đầy đủ các căn đó, dù đang nằm ngủ ở bất cứ đâu, vẫn được gọi là đang thức tỉnh vì sự không phóng dật (appamāda) và sự đầy đủ thiện (kusalasamaṅgitā).
Pañcahi pana nīvaraṇeheva kilesarajaṃ ādiyati gaṇhāti parāmasati.
Indeed, it is through the five hindrances that one takes, grasps, and wrongly applies the defilements' dust.
Tuy nhiên, con người thu nhận (ādiyati), nắm giữ (gaṇhāti), và bám víu (parāmasati) bụi phiền não (kilesarajaṃ) chỉ bằng năm triền cái.
Purimā hi kāmacchandādayo pacchimānaṃ paccayā hontīti pañcahi indriyehi parisujjhatīti ayamattho veditabbo.
For indeed, the former states like sensual desire are causes for the latter, and therefore, it should be understood that one is purified by the five faculties.
Thật vậy, các pháp như dục tham (kāmacchanda) v.v. trước là nhân duyên cho các pháp sau, nên ý nghĩa cần được hiểu là người đó được thanh tịnh hoàn toàn nhờ năm căn.
Idhāpi pañcindriyāni lokiyalokuttarāneva kathitānīti.
Here too, the five faculties, both mundane and supramundane, are taught.
Ở đây, năm căn cũng được nói đến là cả thế gian và siêu thế.
7. Sattame dhammāti catusaccadhammā.
In the seventh (sutta), dhammā refers to the four Noble Truths (catusaccadhammā).
7. Trong kinh thứ bảy, các pháp (dhammā) là các pháp Tứ Thánh Đế (catusaccadhammā).
Appaṭividitāti ñāṇena appaṭividdhā.
Appaṭividitā means "not penetrated by wisdom."
Chưa được thấu hiểu (appaṭividitā) nghĩa là chưa được thấu suốt bằng trí tuệ (ñāṇa).
Paravādesūti dvāsaṭṭhidiṭṭhigatavādesu.
Paravādesu refers to the sixty-two wrong views.
Trong các giáo phái khác (paravādesu) là trong các giáo phái của sáu mươi hai tà kiến (dvāsaṭṭhidiṭṭhigatavādesu).
Te hi ito paresaṃ titthiyānaṃ vādattā paravādā nāma.
Indeed, these are called "paravādā" (other views) because they are the views of other teachers (titthiya).
Thật vậy, chúng được gọi là các giáo phái khác (paravādā) vì chúng là các giáo phái của các ngoại đạo.
Nīyareti attano dhammatāyapi gacchanti, parenapi nīyanti.
Nīyare means they go by their own nature, and they are also led by others.
Họ bị dẫn đi (nīyare) nghĩa là họ tự đi theo bản chất của mình, và cũng bị người khác dẫn đi.
Tattha sayameva sassatādīni gaṇhantā gacchanti nāma, parassa vacanena tāni gaṇhantā nīyanti nāma.
Here, going means that they themselves grasp views such as eternalism; being led means that they grasp those views by the words of others.
Trong đó, việc tự đi nghĩa là họ tự chấp thủ các kiến chấp như thường kiến (sassata) v.v.; việc bị dẫn đi nghĩa là họ chấp thủ chúng theo lời của người khác.
Kālo tesaṃ pabujjhitunti tesaṃ puggalānaṃ pabujjhituṃ ayaṃ kālo.
Kālo tesaṃ pabujjhituṃ means "this is the time for those individuals to awaken."
Đã đến lúc họ thức tỉnh (kālo tesaṃ pabujjhituṃ) nghĩa là đây là lúc để những người đó thức tỉnh.
Lokasmiñhi buddho uppanno, dhammo desiyati, saṅgho suppaṭipanno, paṭipadā bhaddikā, ime ca pana mahājanā vaṭṭe suttā nappabujjhantīti devatā āha.
Indeed, the deva said, "A Buddha has arisen in the world, the Dhamma is taught, the Saṅgha is well-practiced, the path is excellent, yet these common people sleep in saṃsāra and do not awaken."
Thật vậy, vị thiên nhân nói: “Đức Phật đã xuất hiện trên thế gian, Pháp đang được thuyết giảng, Tăng chúng đang thực hành đúng đắn, con đường tu tập là tốt đẹp, nhưng những chúng sinh này vẫn đang ngủ trong luân hồi và không thức tỉnh”.
Sambuddhāti sammā hetunā kāraṇena buddhā.
Sambuddhā means "rightly awakened by cause and reason."
Những người giác ngộ hoàn toàn (sambuddhā) nghĩa là những người đã giác ngộ đúng đắn bằng nhân và duyên.
Cattāro hi buddhā – sabbaññubuddho, paccekabuddho, catusaccabuddho, sutabuddhoti.
There are four kinds of Buddhas: the Omniscient Buddha (Sabbaññubuddha), the Paccekabuddha, the Catusaccabuddha, and the Sutabuddha.
Thật vậy, có bốn loại Phật: Chánh Đẳng Giác (Sabbaññubuddha), Độc Giác (Paccekabuddha), Giác Ngộ Tứ Thánh Đế (Catusaccabuddha), và Giác Ngộ nhờ nghe Pháp (Sutabuddha).
Tattha samatiṃsapāramiyo pūretvā sammāsambodhiṃ patto sabbaññubuddho nāma.
Among these, one who has fulfilled thirty perfections and attained perfect self-awakening is called a Sabbaññubuddha.
Trong đó, người đã viên mãn ba mươi ba Ba-la-mật và đạt được Chánh Đẳng Giác (Sammāsambodhi) được gọi là Chánh Đẳng Giác.
Kappasatasahassādhikāni dve asaṅkhyeyyāni pāramiyo pūretvā sayambhutaṃ patto paccekabuddho nāma.
One who has fulfilled perfections for two asaṅkhyeyyas and one hundred thousand kappas and attained self-awakening is called a Paccekabuddha.
Người đã viên mãn Ba-la-mật trong hai A-tăng-kỳ và một trăm ngàn đại kiếp, và đạt được sự tự giác ngộ (sayambhutaṃ) được gọi là Độc Giác.
Avasesā khīṇāsavā catusaccabuddhā nāma.
The remaining Arahants are called Catusaccabuddhas.
Các vị A-la-hán còn lại được gọi là Giác Ngộ Tứ Thánh Đế.
Bahussuto sutabuddho nāma.
One who is learned is called a Sutabuddha.
Người đa văn (bahussuta) được gọi là Giác Ngộ nhờ nghe Pháp.
Imasmiṃ atthe tayopi purimā vaṭṭanti.
In this context, all three former types are applicable.
Trong ngữ cảnh này, cả ba loại Phật đầu tiên đều phù hợp.
Sammadaññāti sammā hetunā kāraṇena jānitvā.
Sammadaññā means having known well, through proper reason and cause.
Sammadaññā có nghĩa là biết rõ ràng, đúng đắn, có lý do, có nguyên nhân.
Caranti visame samanti visame vā lokasannivāse visame vā sattanikāye visame vā kilesajāte samaṃ carantīti.
They fare evenly in the uneven means they fare evenly in the uneven state of human society, or among uneven beings (lacking mindfulness and wisdom), or among uneven defilements such as greed.
Caranti visame sama có nghĩa là sống bình đẳng giữa thế gian bất bình đẳng, giữa chúng sinh bất bình đẳng, hoặc giữa các phiền não bất bình đẳng.
8. Aṭṭhame susammuṭṭhāti paññāya appaṭividdhabhāveneva sunaṭṭhā.
8. In the eighth*, susammuṭṭhā means utterly lost simply due to not having penetrated with wisdom.
8. Trong kinh thứ tám, susammuṭṭhā có nghĩa là hoàn toàn bị hủy hoại do không thấu hiểu bằng tuệ.
Yathā hi dve khettāni kasitvā, ekaṃ vapitvā, bahudhaññaṃ adhigatassa avāpitakhettato aladdhaṃ sandhāya ‘‘bahuṃ me dhaññaṃ naṭṭha’’nti vadanto aladdhameva ‘‘naṭṭha’’nti vadati, evamidhāpi appaṭividitāva susammuṭṭhā nāma.
Just as one who has tilled two fields, sown one, and obtained much grain, but says "much of my grain is lost" referring to what was not obtained from the unsown field, speaking of what was not obtained as "lost"; so too here, those who have not penetrated are called susammuṭṭhā (utterly lost).
Ví như, một người cày hai thửa ruộng, gieo trồng một thửa, và thu được nhiều lúa. Khi nói “Tôi đã mất nhiều lúa” để chỉ số lúa không thu được từ thửa ruộng không gieo trồng, người ấy nói “mất” là chỉ những gì không có được. Tương tự như vậy ở đây, chỉ những gì không được thấu hiểu mới được gọi là susammuṭṭhā.
Asammuṭṭhāti paññāya paṭividdhabhāveneva anaṭṭhā.
Asammuṭṭhā means not lost, simply due to having penetrated with wisdom.
Asammuṭṭhā có nghĩa là không bị hủy hoại do đã thấu hiểu bằng tuệ.
Sesaṃ purimasadisamevāti.
The rest is similar to the preceding*.
Phần còn lại tương tự như trước.
9. Navame mānakāmassāti mānaṃ kāmentassa icchantassa.
9. In the ninth*, mānakāmassā means one who longs for, desires, conceit.
9. Trong kinh thứ chín, mānakāmassā có nghĩa là của người mong muốn, khao khát ngã mạn.
Damoti evarūpassa puggalassa samādhipakkhiko damo natthīti vadati.
Damo (self-control) means that a person of such a nature does not possess self-control belonging to the concentration-group of factors.
Damo có nghĩa là người như vậy không có sự chế ngự thuộc về định.
‘‘Saccena danto damasā upeto, vedantagū vusitabrahmacariyo’’ti (saṃ. ni. 1.195) ettha hi indriyasaṃvaro damoti vutto.
For here, in "Tamed by truth, endowed with self-control, one who has reached the end of knowledge, who has lived the holy life" (Saṃ. Ni. 1.195), control of the faculties is called dama.
Ở đây, trong câu ‘‘Saccena danto damasā upeto, vedantagū vusitabrahmacariyo’’ (Saṃ. Ni. 1.195), sự chế ngự các căn được gọi là damo.
‘‘Yadi saccā damā cāgā, khantyā bhiyyodha vijjatī’’ti (saṃ. ni. 1.246; su. ni. 191) ettha paññā.
In "If there is still more of truth, self-control, relinquishment, and patience here" (Saṃ. Ni. 1.246; Su. Ni. 191), it refers to wisdom.
Trong câu ‘‘Yadi saccā damā cāgā, khantyā bhiyyodha vijjatī’’ (Saṃ. Ni. 1.246; Su. Ni. 191), đó là tuệ.
‘‘Dānena damena saṃyamena saccavajjena atthi puññaṃ, atthi puññassa āgamo’’ti (saṃ. ni. 4.365) ettha uposathakammaṃ.
In "Through generosity, self-control, restraint, and truthfulness there is merit, there is an accumulation of merit" (Saṃ. Ni. 4.365), it refers to the observance of Uposatha.
Trong câu ‘‘Dānena damena saṃyamena saccavajjena atthi puññaṃ, atthi puññassa āgamo’’ (Saṃ. Ni. 4.365), đó là việc giữ giới uposatha.
‘‘Sakkhissasi kho tvaṃ, puṇṇa, iminā damūpasamena samannāgato sunāparantasmiṃ janapade viharitu’’nti (saṃ. ni. 4.88; ma. ni. 3.396) ettha adhivāsanakhanti.
In "Surely, Puṇṇa, being endowed with this self-control and peacefulness, you will be able to dwell in the country of Sunāparanta" (Saṃ. Ni. 4.88; Ma. Ni. 3.396), it refers to the patience of endurance (adhivāsanakhanti).
Trong câu ‘‘Sakkhissasi kho tvaṃ, Puṇṇa, iminā damūpasamena samannāgato sunāparantasmiṃ janapade viharitu’’ (Saṃ. Ni. 4.88; Ma. Ni. 3.396), đó là sự nhẫn nại cam chịu (adhivāsanakhantī).
Imasmiṃ pana sutte damoti samādhipakkhikadhammānaṃ etaṃ nāmaṃ.
In this sutta, however, dama is a name for the qualities belonging to the concentration-group.
Tuy nhiên, trong kinh này, damo là tên gọi của các pháp thuộc về định.
Tenevāha – ‘‘na monamatthi asamāhitassā’’ti.
Therefore, it says: "There is no sagehood for one who is not concentrated."
Do đó, Đức Phật đã dạy: ‘‘na monamatthi asamāhitassā’’ (không có sự tịch tịnh cho người không có định).
Tattha monanti catumaggañāṇaṃ, tañhi munātīti monaṃ, catusaccadhamme jānātīti attho.
There, monaṃ means the knowledge of the four paths; for that is mona (sagehood) because it munāti (knows), meaning it knows the truths of the four Noble Truths.
Ở đây, monaṃ là Tứ đạo trí, vì nó biết (munāti) nên gọi là monaṃ, tức là biết Tứ diệu đế.
Maccudheyyassāti tebhūmakavaṭṭassa.
Maccudheyyassā refers to the three realms of existence (tebhūmakavaṭṭa).
Maccudheyyassā là ba cõi luân hồi (tebhūmakavaṭṭa).
Tañhi maccuno patiṭṭhānaṭṭhena maccudheyyanti vuccati.
For that is called maccudheyya (the domain of Death) in the sense of being the dwelling place of Death.
Vì nó là nơi nương tựa của tử thần, nên được gọi là maccudheyya.
Pāranti tasseva pāraṃ nibbānaṃ.
Pāraṃ is the other shore of that very*, Nibbāna.
Pāraṃ là Niết Bàn, bờ bên kia của chính nó.
Tareyyāti paṭivijjheyya pāpuṇeyya vā.
Tareyyā means to penetrate or to reach.
Tareyyā có nghĩa là thấu hiểu hoặc đạt đến.
Idaṃ vuttaṃ hoti – eko araññe viharanto pamatto puggalo maccudheyyassa pāraṃ na tareyya na paṭivijjheyya na pāpuṇeyyāti.
This is what is meant: A heedless person dwelling alone in the forest would not cross, would not penetrate, would not reach the other shore of Death's domain.
Điều này có nghĩa là: một người sống trong rừng, nếu phóng dật, sẽ không thể vượt qua, không thể thấu hiểu, không thể đạt đến bờ bên kia của cõi tử thần.
Mānaṃ pahāyāti arahattamaggena navavidhamānaṃ pajahitvā.
Mānaṃ pahāyā means having abandoned the nine kinds of conceit through the path of Arahantship.
Mānaṃ pahāyā có nghĩa là đã từ bỏ chín loại ngã mạn bằng đạo A-la-hán.
Susamāhitattoti upacārappanāsamādhīhi suṭṭhu samāhitatto.
Susamāhitatto means having a mind well concentrated by access concentration and absorption concentration.
Susamāhitatto có nghĩa là tâm đã được định tốt đẹp bằng định cận hành và định an chỉ.
Sucetasoti ñāṇasampayuttatāya sundaracitto.
Sucetaso means having a beautiful mind due to being associated with knowledge.
Sucetaso có nghĩa là tâm thanh tịnh do có trí tuệ đi kèm.
Ñāṇavippayuttacittena hi sucetasoti na vuccati, tasmā ñāṇasampayuttena sucetaso hutvāti attho.
Indeed, a mind dissociated from knowledge is not called sucetaso; therefore, the meaning is: having become sucetaso (beautiful-minded) by being associated with knowledge.
Vì một tâm không có trí tuệ thì không được gọi là sucetaso, do đó, sucetaso có nghĩa là có một tâm thanh tịnh đi kèm với trí tuệ.
Sabbadhi vippamuttoti sabbesu khandhāyatanādīsu vippamutto hutvā.
Sabbadhi vippamutto means having become completely liberated from all aggregates, sense bases, and so forth.
Sabbadhi vippamutto có nghĩa là đã hoàn toàn giải thoát khỏi tất cả các uẩn, xứ, v.v.
Tareyyāti ettha tebhūmakavaṭṭaṃ samatikkamanto nibbānaṃ paṭivijjhanto taratīti paṭivedhataraṇaṃ nāma vuttaṃ.
Here, in Tareyyā, crossing by penetration is spoken of, meaning one who transcends the three realms of existence, penetrating Nibbāna, thereby crosses.
Ở đây, Tareyyā có nghĩa là vượt qua ba cõi luân hồi, thấu hiểu Niết Bàn, tức là sự vượt qua bằng sự thấu hiểu.
Iti imāya gāthāya tisso sikkhā kathitā honti.
Thus, by this verse, the three trainings are expounded.
Như vậy, với bài kệ này, ba học pháp đã được giảng giải.
Kathaṃ – māno nāmāyaṃ sīlabhedano, tasmā ‘‘mānaṃ pahāyā’’ti iminā adhisīlasikkhā kathitā hoti.
How? This conceit is a breaker of sīla; therefore, by "Mānaṃ pahāyā," the training in higher sīla (adhisīla) is expounded.
Thế nào? Ngã mạn này là kẻ phá hoại giới hạnh, do đó, với câu ‘‘mānaṃ pahāyā’’ (từ bỏ ngã mạn), giới tăng thượng học (adhisīlasikkhā) đã được giảng giải.
‘‘Susamāhitatto’’ti iminā adhicittasikkhā.
By "Susamāhitatto," the training in higher consciousness (adhicitta)*.
Với câu ‘‘Susamāhitatto’’ (tâm đã được định tốt đẹp), tâm tăng thượng học (adhicittasikkhā) đã được giảng giải.
‘‘Sucetaso’’ti ettha cittena paññā dassitā, tasmā iminā adhipaññāsikkhā kathitā.
In "Sucetaso," wisdom is shown by means of the mind; therefore, by this, the training in higher wisdom (adhipaññā) is expounded.
Trong câu ‘‘Sucetaso’’ (tâm thanh tịnh), trí tuệ được thể hiện qua tâm, do đó, với câu này, tuệ tăng thượng học (adhipaññāsikkhā) đã được giảng giải.
Adhisīlañca nāma sīle sati hoti, adhicittaṃ citte sati, adhipaññā paññāya sati.
Higher sīla arises when there is sīla; higher consciousness when there is consciousness; higher wisdom when there is wisdom.
Giới tăng thượng học có khi có giới (sīla), tâm tăng thượng học có khi có tâm (citta), tuệ tăng thượng học có khi có tuệ (paññā).
Tasmā sīlaṃ nāma pañcapi dasapi sīlāni, pātimokkhasaṃvaro adhisīlaṃ nāmāti veditabbaṃ.
Therefore, sīla refers to the five or ten precepts, and the restraint of the Pātimokkha is to be understood as higher sīla.
Do đó, giới (sīla) là năm giới hoặc mười giới, còn giới luật Pātimokkha (pātimokkhasaṃvaro) được biết là giới tăng thượng học (adhisīlaṃ).
Aṭṭha samāpattiyo cittaṃ, vipassanāpādakajjhānaṃ adhicittaṃ.
The eight attainments are consciousness, and the jhāna based on vipassanā is higher consciousness.
Tám thiền chứng (aṭṭha samāpattiyo) là tâm (citta), thiền làm nền tảng cho thiền quán (vipassanāpādakajjhāna) là tâm tăng thượng học (adhicittaṃ).
Kammassakatañāṇaṃ paññā, vipassanā adhipaññā.
The knowledge of the ownership of kamma is wisdom, and vipassanā is higher wisdom.
Trí tuệ về nghiệp và quả của nghiệp (kammassakatañāṇaṃ) là tuệ (paññā), thiền quán (vipassanā) là tuệ tăng thượng học (adhipaññā).
Anuppannepi hi buddhuppāde pavattatīti pañcasīlaṃ dasasīlaṃ sīlameva, pātimokkhasaṃvarasīlaṃ buddhuppādeyeva pavattatīti adhisīlaṃ.
For the five precepts and ten precepts are indeed sīla, as they prevail even without the arising of a Buddha, but the sīla of Pātimokkha restraint prevails only with the arising of a Buddha, and is thus higher sīla.
Ngay cả khi Đức Phật chưa xuất hiện, năm giới và mười giới vẫn tồn tại và là giới (sīla) thuần túy. Giới Pātimokkha chỉ tồn tại khi Đức Phật xuất hiện, do đó nó là giới tăng thượng học (adhisīlaṃ).
Cittapaññāsupi eseva nayo.
The same method applies to consciousness and wisdom.
Tương tự cũng áp dụng cho tâm và tuệ.
Apica nibbānaṃ patthayantena samādinnaṃ pañcasīlampi dasasīlampi adhisīlameva.
Furthermore, even the five precepts or ten precepts undertaken by one aspiring to Nibbāna are indeed higher sīla.
Hơn nữa, năm giới và mười giới mà người mong cầu Niết Bàn đã thọ trì cũng là giới tăng thượng học.
Samāpannā aṭṭha samāpattiyopi adhicittameva.
The eight attainments entered into by one aspiring to Nibbāna are indeed higher consciousness.
Tám thiền chứng đã nhập cũng là tâm tăng thượng học.
Sabbampi vā lokiyasīlaṃ sīlameva, lokuttaraṃ adhisīlaṃ.
Alternatively, all mundane sīla is indeed sīla, while supramundane sīla is higher sīla.
Hoặc tất cả các giới thuộc thế gian đều là giới (sīla), còn giới siêu thế là giới tăng thượng học (adhisīlaṃ).
Cittapaññāsupi eseva nayoti.
The same method applies to consciousness and wisdom.
Tương tự cũng áp dụng cho tâm và tuệ.
Iti imāya gāthāya samodhānetvā tisso sikkhā sakalasāsanaṃ kathitaṃ hotīti.
Thus, by integrating these three trainings through this verse, the entire Dispensation is expounded.
Như vậy, với bài kệ này, ba học pháp, tức là toàn bộ giáo pháp, đã được giảng giải.
10. Dasame santānanti santakilesānaṃ, paṇḍitānaṃ vā.
10. In the tenth*, santānaṃ means of those whose defilements are calmed, or of the wise.
10. Trong kinh thứ mười, santānaṃ có nghĩa là của những người có phiền não đã lắng dịu, hoặc của những bậc hiền trí.
‘‘Santo have sabbhi pavedayanti (jā. 2.21.413), dūre santo pakāsantī’’tiādīsu (dha. pa. 304) hi paṇḍitāpi santoti vuttā.
For in phrases like "The good surely make themselves known to the virtuous (Jā. 2.21.413), the good shine forth from afar" (Dha. Pa. 304), the wise are also called "good" (santa).
Trong các câu như ‘‘Santo have sabbhi pavedayanti, dūre santo pakāsantī’’ (Jā. 2.21.413; Dhp. 304), các bậc hiền trí cũng được gọi là santo.
Brahmacārinanti seṭṭhacārīnaṃ maggabrahmacariyavāsaṃ vasantānaṃ.
Brahmacārinaṃ means of those who practice the noble conduct, who live the holy life of the path.
Brahmacārinaṃ có nghĩa là của những người sống phạm hạnh cao thượng, sống đời phạm hạnh của đạo.
Kena vaṇṇo pasīdatīti kena kāraṇena chavivaṇṇo pasīdatīti pucchati.
Kena vaṇṇo pasīdatī means by what cause does the complexion become clear? she asks.
Kena vaṇṇo pasīdatī có nghĩa là hỏi: “Do nguyên nhân nào mà sắc diện trở nên trong sáng?”
Kasmā panesā evaṃ pucchati?
But why does she ask thus?
Vì sao vị ấy lại hỏi như vậy?
Esā kira vanasaṇḍavāsikā bhummadevatā āraññake bhikkhū pacchābhattaṃ piṇḍapātapaṭikkante araññaṃ pavisitvā rattiṭṭhānadivāṭṭhānesu mūlakammaṭṭhānaṃ gahetvā nisinne passati.
This earth-deity, dwelling in a forest grove, saw the forest-dwelling bhikkhus, after their meal and return from alms-round, entering the forest, taking their fundamental meditation subjects, and sitting in their night-quarters and day-quarters.
Vị thiên nữ trú trong khu rừng này đã thấy các Tỳ-kheo sống trong rừng, sau khi thọ trai và trở về từ việc khất thực, đi vào rừng và ngồi thiền quán căn bản tại các nơi trú ngụ ban đêm và ban ngày.
Tesañca evaṃ nisinnānaṃ balavacittekaggatā uppajjati.
And as they sat thus, strong one-pointedness of mind arose in them.
Khi các vị ấy ngồi như vậy, sự định tâm mạnh mẽ phát sinh.
Tato visabhāgasantati vūpasammati, sabhāgasantati okkamati, cittaṃ pasīdati.
Then, the heterogeneous mental continuum subsided, the homogeneous mental continuum entered, and the mind became clear.
Từ đó, dòng tâm thức không tương thích lắng dịu, dòng tâm thức tương thích khởi lên, tâm trở nên thanh tịnh.
Citte pasanne lohitaṃ pasīdati, cittasamuṭṭhānāni upādārūpāni parisuddhāni honti, vaṇṭā pamuttatālaphalassa viya mukhassa vaṇṇo hoti.
When the mind became clear, the blood became clear, and the derived material forms born of mind became purified, and the complexion of their faces was like a ripe palm fruit freed from its stalk.
Khi tâm thanh tịnh, máu cũng thanh tịnh, các sắc pháp do tâm sinh ra trở nên trong sạch, sắc diện giống như quả chà là rụng khỏi cuống.
Taṃ disvā devatā cintesi – ‘‘sarīravaṇṇo nāmāyaṃ paṇītāni rasasampannāni bhojanāni sukhasamphassāni nivāsanapāpuraṇasayanāni utusukhe tebhūmikādibhede ca pāsāde mālāgandhavilepanādīni ca labhantānaṃ pasīdati, ime pana bhikkhū piṇḍāya caritvā missakabhattaṃ bhuñjanti, viraḷamañcake vā phalake vā silāya vā sayanāni kappenti, rukkhamūlādīsu vā abbhokāse vā vasanti, kena nu kho kāraṇena etesaṃ vaṇṇo pasīdatī’’ti.
Seeing this, the deity thought: "This bodily complexion usually becomes clear for those who receive excellent foods rich in flavour, comfortable clothing and bedding, and dwell in pleasant palaces of three levels, etc., enjoying garlands, scents, ointments, and so on. But these bhikkhus, after wandering for alms, eat mixed food, make their beds on sparse beds, planks, or stones, and dwell at the foot of trees or in the open air. By what cause, then, does their complexion become clear?"
Thấy vậy, vị thiên nữ suy nghĩ: ‘‘Sắc diện cơ thể này trở nên trong sáng là do những người được hưởng các món ăn ngon, đầy đủ hương vị, các y phục, chăn mền, giường nằm êm ái, các cung điện ba tầng trong thời tiết dễ chịu, và các loại hoa, hương, dầu thơm, v.v. Nhưng các Tỳ-kheo này lại đi khất thực, ăn cơm trộn, ngủ trên những chiếc giường cũ kỹ, trên ván gỗ hoặc trên đá, sống dưới gốc cây hoặc ngoài trời. Vậy do nguyên nhân nào mà sắc diện của các vị ấy lại trong sáng như vậy?’’
Tasmā pucchi.
Therefore, she asked.
Vì vậy, vị ấy đã hỏi.
Athassā bhagavā kāraṇaṃ kathento dutiyaṃ gāthaṃ āha.
Then the Blessed One, explaining the cause to her, spoke the second verse.
Bấy giờ, Đức Thế Tôn đã nói bài kệ thứ hai để giải thích nguyên nhân cho vị ấy.
Tattha atītanti atīte asuko nāma rājā dhammiko ahosi, so amhākaṃ paṇīte paccaye adāsi.
There, atītaṃ (the past) refers to: "Such and such a king in the past was righteous, and he gave us excellent requisites.
Ở đây, atītaṃ có nghĩa là: ‘‘Ngày xưa có vị vua tên là X là người công chính, ngài đã cúng dường cho chúng ta những vật dụng cao cấp.
Ācariyupajjhāyā lābhino ahesuṃ.
Our teachers and preceptors were fortunate.
Các vị thầy và giới sư đã nhận được nhiều lợi lộc.
Atha mayaṃ evarūpāni bhojanāni bhuñjimhā, cīvarāni pārupimhāti evaṃ ekacce paccayabāhullikā viya ime bhikkhū atītaṃ nānusocanti.
Then we ate such foods and wore such robes" - these bhikkhus do not grieve over the past like some who are excessively attached to requisites.
Sau đó, chúng ta đã thọ dụng những món ăn như vậy, mặc những y phục như vậy.’’ Các Tỳ-kheo này không than khóc về quá khứ như những người quá chú trọng vào vật dụng.
Nappajappanti nāgatanti anāgate dhammiko rājā bhavissati, phītā janapadā bhavissanti, bahūni sappinavanītādīni uppajjissanti, ‘‘khādatha bhuñjathā’’ti tattha tattha vattāro bhavissanti, tadā mayaṃ evarūpāni bhojanāni bhuñjissāma, cīvarāni pārupissāmāti evaṃ anāgataṃ na patthenti.
"Nappajappanti nāgata"nti (they do not long for the future) means that they do not long for the future thus: "In the future, a righteous king will arise, prosperous will the districts be, many kinds of ghee, fresh butter, and so on will appear, there will be people saying 'Eat and enjoy!' here and there, and then we will eat such foods and wear such robes."
Không mong cầu tương lai nghĩa là: "Trong tương lai, sẽ có một vị vua sống theo Chánh pháp, các vùng đất sẽ thịnh vượng, nhiều bơ sữa tươi (sappinavanītādīni) sẽ xuất hiện, sẽ có những người ở khắp nơi nói rằng: 'Hãy ăn đi, hãy thọ dụng đi!', khi đó chúng ta sẽ thọ dụng những món ăn như vậy, sẽ khoác những y phục như vậy." Như vậy, họ không mong cầu tương lai.
Paccuppannenāti yena kenaci taṅkhaṇe laddhena yāpenti.
Paccuppannenāti (with what is present) means they sustain themselves with whatever they receive at that moment, without regard for quality.
Với hiện tại nghĩa là: Họ duy trì cuộc sống với bất cứ thứ gì nhận được ngay lúc đó.
Tenāti tena tividhenāpi kāraṇena.
Tenāti (by that) means by that threefold reason.
Với điều đó nghĩa là: Với cả ba lý do đó.
Evaṃ vaṇṇasampattiṃ dassetvā idāni tasseva vaṇṇassa vināsaṃ dassento anantaraṃ gāthamāha.
Having thus shown the beauty of complexion, the Buddha now speaks the next verse, showing the destruction of that very beauty.
Sau khi trình bày về sự viên mãn của sắc diện như vậy, bây giờ, để chỉ ra sự hoại diệt của chính sắc diện đó, Đức Phật đã nói bài kệ tiếp theo.
Tattha anāgatappajappāyāti anāgatassa patthanāya.
There, anāgatappajappāyāti (by longing for the future) means by desiring what has not yet arrived.
Trong đó, do mong cầu tương lai nghĩa là: do sự mong cầu những gì chưa đến.
Etenāti etena kāraṇadvayena.
Etenāti (by this) means by these two reasons.
Với điều này nghĩa là: với hai lý do này.
Naḷova harito lutoti yathā harito naḷo lāyitvā uṇhapāsāṇe pakkhitto sussati, evaṃ sussantīti.
Naḷova harito lutoti (like green reeds cut down) means just as a green reed, when cut and thrown on a hot rock, dries up, so do they dry up.
Như lau xanh bị cắt nghĩa là: giống như cây lau xanh bị cắt rồi phơi trên đá nóng sẽ khô héo, cũng vậy, họ sẽ khô héo.
11. Nandanavaggassa paṭhame tatrāti tasmiṃ ārāme.
11. In the first (sutta) of the Nandanavagga, tatrāti (there) means in that monastery.
11. Trong kinh đầu tiên của phẩm Nandana, ở đó nghĩa là: trong khu vườn đó.
Khoti byañjanasiliṭṭhatāvasena nipātamattaṃ.
Khoti is merely a particle to smooth the phrasing.
Kho là một từ ngữ chỉ để làm cho văn phong trôi chảy hơn.
Bhikkhū āmantesīti parisajeṭṭhake bhikkhū jānāpesi.
Bhikkhū āmantesīti (he addressed the bhikkhus) means he informed the chief bhikkhus of the assembly.
Đức Phật đã gọi các Tỳ-khưu nghĩa là: Đức Phật đã thông báo cho các Tỳ-khưu trưởng lão trong hội chúng.
Bhikkhavoti tesaṃ āmantanākāradīpanaṃ.
Bhikkhavoti (bhikkhus!) indicates the manner of addressing them.
Này các Tỳ-khưu là lời chỉ ra cách thức gọi của Ngài.
Bhadanteti pativacanadānaṃ.
Bhadanteti (venerable sir!) is the reply given.
Bạch Thế Tôn là lời đáp lại.
Te bhikkhūti ye tattha sammukhībhūtā dhammapaṭiggāhakā bhikkhū.
Te bhikkhūti (those bhikkhus) refers to those bhikkhus present there who were receptive to the Dhamma.
Các Tỳ-khưu đó nghĩa là: những Tỳ-khưu đang có mặt ở đó để thọ nhận Pháp.
Bhagavato paccassosunti bhagavato vacanaṃ patiassosuṃ, abhimukhā hutvā suṇiṃsu sampaṭicchiṃsūti attho.
Bhagavato paccassosunti (they assented to the Blessed One) means they assented to the word of the Blessed One; the meaning is that they listened and accepted, facing Him.
Đã vâng lời Đức Thế Tôn nghĩa là: đã vâng lời Đức Thế Tôn, có nghĩa là họ đã lắng nghe và chấp nhận lời Ngài.
Etadavocāti etaṃ idāni vattabbaṃ ‘‘bhūtapubba’’ntiādivacanaṃ avoca.
Etadavocāti (He said this) means He spoke these words, beginning with "bhūtapubba" (formerly), which are now to be stated.
Đã nói điều này nghĩa là: đã nói lời "Thuở xưa" (bhūtapubba) và những lời khác sắp được nói ra đây.
Tattha tāvatiṃsakāyikāti tāvatiṃsakāye nibbattā.
There, tāvatiṃsakāyikāti (belonging to the Tāvatiṃsa realm) means born in the Tāvatiṃsa realm.
Trong đó, chư thiên cõi Tam Thập Tam Thiên nghĩa là: được tái sinh trong cõi Tam Thập Tam Thiên.
Tāvatiṃsakāyo nāma dutiyadevaloko vuccati.
The Tāvatiṃsa realm is called the second deva-world.
Cõi Tam Thập Tam Thiên (Tāvatiṃsakāyo) được gọi là cõi trời thứ hai.
Maghena māṇavena saddhiṃ macalagāme kālaṃ katvā tattha uppanne tettiṃsa devaputte upādāya kira tassa devalokassa ayaṃ paṇṇatti jātāti vadanti.
It is said that this designation for that deva-world arose because thirty-three devaputtas were born there after the māṇava named Magha and his companions passed away in the village of Macala.
Người ta nói rằng, tên gọi của cõi trời này xuất phát từ ba mươi ba vị thiên tử được tái sinh ở đó sau khi cùng với Maṅgha (Māṇavena) chết tại làng Macala.
Yasmā pana sesacakkavāḷesupi cha kāmāvacaradevalokā atthi.
However, since there are also six kāma-worlds in other universes,
Tuy nhiên, vì ở các thế giới khác cũng có sáu cõi trời Dục giới,
Vuttampi cetaṃ ‘‘sahassaṃ cātumahārājikānaṃ sahassaṃ tāvatiṃsāna’’nti (a. ni. 10.29), tasmā nāmapaṇṇattiyevesā tassa devalokassāti veditabbā.
and it is also stated: "a thousand Cātumahārājika devas, a thousand Tāvatiṃsa devas" (AN 10.29), it should be understood that this is merely a nominal designation for that deva-world.
và điều này cũng được nói: "Một ngàn cõi trời Tứ Đại Thiên Vương, một ngàn cõi trời Tam Thập Tam Thiên", do đó, cần phải hiểu rằng đây chỉ là một tên gọi quy ước cho cõi trời đó.
Evañhi niddosaṃ padaṃ hoti.
Only then is the word faultless.
Như vậy thì từ ngữ này mới không có lỗi.
Nandane vaneti ettha taṃ vanaṃ paviṭṭhe paviṭṭhe nandayati tosetīti nandanaṃ.
Nandane vaneti (in the Nandana Grove): Here, that grove is called Nandana because it delights and pleases all who enter it.
Trong khu vườn Nandana (Nandane vane): Khu vườn này làm cho những ai bước vào đều hoan hỷ, đều vui thích, nên gọi là Nandana.
Pañcasu hi maraṇanimittesu uppannesu ‘‘sampattiṃ pahāya cavissāmā’’ti paridevamānā devatā sakko devānamindo ‘‘mā paridevittha, abhijjanadhammā nāma saṅkhārā natthī’’ti ovaditvā tattha pavesāpeti.
Indeed, when the five signs of death appear, the devas lamenting "We will cast off our prosperity and fall away," are admonished by Sakka, the king of devas, saying, "Do not lament, for there are no formations that are not subject to decay," and he causes them to enter there.
Quả thật, khi năm dấu hiệu của cái chết xuất hiện, các vị chư thiên than khóc rằng: “Chúng ta sẽ chết, từ bỏ mọi tài sản!”, thì Sakka, Vua của các vị trời, khuyên nhủ: “Đừng than khóc! Các pháp hữu vi (saṅkhārā) không có pháp nào là không hoại diệt cả!” rồi cho họ vào khu vườn đó.
Tāsaṃ aññāhi devatāhi bāhāsu gahetvā pavesitānampi tassa sampattiṃ disvāva maraṇasoko vūpasammati, pītipāmojjameva uppajjati.
Even those who are led in by other devas holding their arms, upon seeing the splendor of that grove, their sorrow of death subsides, and only joy and delight arise.
Dù được các vị chư thiên khác nắm tay dẫn vào, nhưng khi nhìn thấy sự tráng lệ của khu vườn, nỗi sầu muộn về cái chết của họ liền lắng xuống, chỉ còn niềm vui và sự hân hoan dâng trào.
Atha tasmiṃ kīḷamānā eva uṇhasantatto himapiṇḍo viya vilīyanti, vātāpahatadīpasikhā viya vijjhāyantīti evaṃ yaṃkiñci anto paviṭṭhaṃ nandayati tosetiyevāti nandanaṃ, tasmiṃ nandane.
Then, while playing in that grove, they dissolve like a lump of snow heated by the sun, or they are extinguished like a lamp flame struck by the wind; thus, whatever enters within delights and pleases, hence it is Nandana; in that Nandana (grove).
Rồi khi đang vui chơi trong đó, họ tan chảy như một khối băng bị nắng nóng làm tan rã, và tắt lịm như ngọn đèn bị gió thổi. Như vậy, bất cứ ai bước vào đều được hoan hỷ, đều vui thích, nên gọi là Nandana. Trong khu vườn Nandana đó.
Accharāsaṅghaparivutāti accharāti devadhītānaṃ nāmaṃ, tāsaṃ samūhena parivutā.
Accharāsaṅghaparivutāti (surrounded by throngs of nymphs): Accharā is a name for deva-daughters, surrounded by their host.
Được vây quanh bởi đoàn Apsara (Accharāsaṅghaparivutā): Apsara là tên gọi của các thiên nữ, được vây quanh bởi đoàn thiên nữ đó.
Dibbehīti devaloke nibbattehi.
Dibbehīti (divine) means born in the deva-world.
Thiên thượng nghĩa là: được sinh ra ở cõi trời.
Pañcahi kāmaguṇehīti manāpiyarūpasaddagandharasaphoṭṭhabbasaṅkhātehi pañcahi kāmabandhanehi kāmakoṭṭhāsehi vā.
Pañcahi kāmaguṇehīti (with the five strands of sensual pleasure) means with the five bonds of sensuality, or portions of sensuality, that consist of agreeable sights, sounds, smells, tastes, and tactile objects.
Với năm dục lạc nghĩa là: với năm sự ràng buộc của dục lạc, tức là sắc, thinh, hương, vị, xúc đáng yêu; hoặc là với năm phần của dục lạc.
Samappitāti upetā.
Samappitāti (endowed) means possessed of.
Được ban tặng nghĩa là: được đầy đủ.
Itaraṃ tasseva vevacanaṃ.
The other term (samangibhūtā) is merely a synonym for that.
Từ khác là đồng nghĩa với từ đó.
Paricārayamānāti ramamānā, tesu tesu vā rūpādīsu indriyāni sañcārayamānā.
Paricārayamānāti (indulging) means enjoying themselves, or directing their senses towards those sights and so on.
Đang hưởng thụ nghĩa là: đang vui thú, hoặc đang điều khiển các căn (indriya) của mình trên các sắc (rūpa) và các đối tượng khác.
Tāyaṃ velāyanti tasmiṃ paricāraṇakāle.
Tāyaṃ velāyanti (at that time) refers to that period of indulgence.
Vào lúc đó nghĩa là: vào thời điểm đang hưởng thụ đó.
So panassa devaputtassa adhunā abhinibbattakālo veditabbo.
This refers to the time when that devaputta had just been born.
Và thời điểm đó cần được hiểu là thời điểm vị thiên tử ấy vừa mới tái sinh.
Tassa hi paṭisandhikkhaṇeyeva rattasuvaṇṇakkhandho viya virocayamāno tigāvutappamāṇo attabhāvo nibbatti.
At the very moment of his rebirth, an existence three gāvutas high appeared, radiant like a mass of pure gold.
Quả thật, ngay vào khoảnh khắc tái sinh của vị ấy, một thân thể cao ba gāvuta (tigāvutappamāṇo) đã xuất hiện, rực rỡ như một khối vàng đỏ.
So dibbavatthanivattho dibbālaṅkārapaṭimaṇḍito dibbamālāvilepanadharo dibbehi candanacuṇṇehi samaṃ vikiriyamāno dibbehi pañcahi kāmaguṇehi ovuto nivuto pariyonaddho lobhābhibhūto hutvā lobhanissaraṇaṃ nibbānaṃ apassanto āsabhiṃ vācaṃ bhāsanto viya mahāsaddena ‘‘na te sukhaṃ pajānantī’’ti imaṃ gāthaṃ gāyamāno nandanavane vicari.
Wearing divine garments, adorned with divine ornaments, bearing divine garlands and perfumes, with divine sandalwood powder scattered around him, enveloped, surrounded, and enmeshed by the five divine sensual pleasures, overwhelmed by craving, and unable to perceive Nibbāna, the escape from craving, he wandered in the Nandana Grove, singing this verse, "They do not know happiness," with a great voice, as if uttering a noble declaration.
Vị ấy, mặc thiên y, trang sức bằng thiên trang sức, đội thiên hoa, thoa thiên hương, được rắc đều bằng thiên phấn gỗ chiên đàn, bị năm dục lạc thiên thượng bao phủ, vây bọc, bị tham ái chế ngự, không thấy được Niết bàn là sự thoát ly tham ái, đã đi trong vườn Nandana, ca hát bài kệ này với tiếng nói lớn như một vị anh hùng (āsabhiṃ vācaṃ) đang tuyên bố: "Họ không biết hạnh phúc".
Tena vuttaṃ – ‘‘tāyaṃ velāyaṃ imaṃ gāthaṃ abhāsī’’ti.
Therefore, it is said: "At that time, he uttered this verse."
Vì vậy, có lời nói rằng: "Vào lúc đó, vị ấy đã nói bài kệ này."
Aññatarā devatāti ekā ariyasāvikā devatā.
Aññatarā devatāti (a certain deva) refers to a certain female noble disciple deva.
Một vị thiên nữ khác nghĩa là: một vị thiên nữ là Thánh đệ tử.
Paccabhāsīti ‘‘ayaṃ bāladevatā imaṃ sampattiṃ niccaṃ acalaṃ maññati, nāssā chedanabhedanaviddhaṃsanadhammataṃ jānātī’’ti adhippāyaṃ vivaṭṭetvā dassentī ‘‘na tvaṃ bāle’’ti imāya gāthāya patiabhāsi.
Paccabhāsīti (replied) means she rebutted the intention of that devaputta, thinking, "This foolish deva believes this prosperity to be permanent and unmoving; he does not know its nature of being subject to cutting, breaking, and destruction," and so she replied with this verse, "You, fool, do not know."
Đã đáp lời nghĩa là: đã đáp lời bằng bài kệ "Này kẻ si mê, ngươi không biết" này, để làm rõ ý rằng: "Vị thiên tử ngu muội này nghĩ rằng tài sản này là vĩnh cửu, bất động, nhưng lại không biết rằng nó có bản chất bị hủy hoại, tan rã và phá vỡ."
Yathā arahataṃ vacoti yathā arahantānaṃ vacanaṃ, tathā tvaṃ na jānāsīti.
Yathā arahataṃ vacoti (as is the word of the Arahants) means "You do not know as is the word of the Arahants."
Theo lời của các bậc Arahant nghĩa là: ngươi không biết như lời của các bậc Arahant.
Evaṃ tassā adhippāyaṃ paṭikkhipitvā idāni arahantānaṃ vacanaṃ dassentī aniccātiādimāha.
Thus rejecting his intention, she now speaks aniccātiādimāha (impermanent, etc.) showing the word of the Arahants.
Như vậy, sau khi bác bỏ ý kiến của vị thiên tử đó, bây giờ, để chỉ ra lời của các bậc Arahant, vị thiên nữ đã nói: Các pháp hữu vi là vô thường và các câu tiếp theo.
Tattha aniccā vata saṅkhārāti sabbe tebhūmakasaṅkhārā hutvā abhāvatthena aniccā.
There, aniccā vata saṅkhārāti (impermanent, indeed, are all formations) means all formations of the three realms are impermanent in the sense that they exist and then cease to exist.
Trong đó, Các pháp hữu vi quả thật vô thường nghĩa là: tất cả các pháp hữu vi thuộc ba cõi đều vô thường do bản chất là đã có rồi không còn nữa.
Uppādavayadhamminoti uppādavayasabhāvā.
Uppādavayadhamminoti (of the nature to arise and cease) means having the nature of arising and ceasing.
Có bản chất sinh diệt nghĩa là: có bản chất sinh và diệt.
Uppajjitvā nirujjhantīti idaṃ purimasseva vevacanaṃ.
Uppajjitvā nirujjhantīti (having arisen, they cease) is merely a synonym for the former statement.
Sinh rồi diệt đi là đồng nghĩa với câu trước.
Yasmā vā uppajjitvā nirujjhanti, tasmā uppādavayadhamminoti.
Or, since they arise and cease, therefore they are of the nature to arise and cease.
Hoặc là, vì chúng sinh rồi diệt đi, nên chúng có bản chất sinh diệt.
Uppādavayaggahaṇena cettha tadanantarā vemajjhaṭṭhānaṃ gahitameva hoti.
By the mention of arising and ceasing, the intermediate state between them (the static moment) is also implicitly included here.
Và ở đây, với việc nắm bắt sự sinh và diệt, trạng thái trung gian ngay sau đó cũng được bao hàm.
Tesaṃ vūpasamo sukhoti tesaṃ saṅkhārānaṃ vūpasamasaṅkhātaṃ nibbānameva sukhaṃ.
Tesaṃ vūpasamo sukhoti (the appeasement of these is happiness) means Nibbāna, which is the appeasement of those formations, is truly happiness.
Sự tịch diệt của chúng là an lạc nghĩa là: Niết bàn, tức là sự tịch diệt của các pháp hữu vi đó, chính là an lạc.
Idaṃ arahataṃ vacoti.
This is the word of the Arahants.
Đây là lời của các bậc Arahant.
12. Dutiye nandatīti tussati attamano hoti.
12. In the second (sutta), nandatīti (rejoices) means is pleased and joyful.
12. Trong kinh thứ hai, hoan hỷ nghĩa là: vui mừng, tâm ý hoan hỷ.
Puttimāti bahuputto.
Puttimāti (one with sons) means one who has many sons.
Người có con nghĩa là: người có nhiều con.
Tassa hi ekacce puttā kasikammaṃ katvā dhaññassa koṭṭhe pūrenti, ekacce vaṇijjaṃ katvā hiraññasuvaṇṇaṃ āharanti, ekacce rājānaṃ upaṭṭhahitvā yānavāhanagāmanigamādīni labhanti.
Indeed, some of his sons fill granaries by cultivating, some bring silver and gold by trading, and some serve the king and obtain vehicles, conveyances, villages, townships, and so on.
Quả thật, một số con cái của người đó làm nông nghiệp, lấp đầy các kho lúa; một số khác buôn bán, mang về vàng bạc; một số khác hầu hạ vua, nhận được xe cộ, làng mạc, thị trấn, v.v.
Atha tesaṃ ānubhāvasaṅkhātaṃ siriṃ anubhavamānā mātā vā pitā vā nandati.
Then, the mother or father rejoices, experiencing the prosperity associated with their power.
Rồi cha hoặc mẹ, khi hưởng thụ sự giàu sang do uy lực của những người con đó, thì hoan hỷ.
Chaṇadivasādīsu vā maṇḍitapasādhite putte sampattiṃ anubhavamāne disvā nandatīti, ‘‘nandati puttehi puttimā’’ti āha.
Or, on festive days, seeing their sons, adorned and dressed, enjoying prosperity, they rejoice; thus, it is said, "One with sons rejoices through his sons."
Hoặc vào những ngày lễ hội, khi nhìn thấy con cái được trang điểm, ăn mặc đẹp đẽ đang hưởng thụ tài sản, thì hoan hỷ. Vì vậy, Đức Phật nói: "Người có con hoan hỷ với con cái."
Gohi tathevāti yathā puttimā puttehi, tathā gosāmikopi sampannaṃ gomaṇḍalaṃ disvā gāvo nissāya gorasasampattiṃ anubhavamāno gohi nandati.
Gohi tathevāti (and so too with cattle) means just as one with sons rejoices through his sons, so too the owner of cattle rejoices through his cattle, seeing his prosperous herd of cows and experiencing the abundance of milk products due to the cows.
Cũng vậy với người có bò nghĩa là: giống như người có con hoan hỷ với con cái, người chủ bò cũng vậy, khi nhìn thấy đàn bò sung túc, hưởng thụ sự giàu có từ sữa bò nhờ vào bò, thì hoan hỷ với bò.
Upadhī hi narassa nandanāti, ettha upadhīti cattāro upadhī – kāmūpadhi, khandhūpadhi, kilesūpadhi, abhisaṅkhārūpadhīti.
"Indeed, upadhi are a man's delight"—here, 'upadhi' refers to four kinds of upadhi: kāmūpadhi (sensual attachments), khandhūpadhi (attachments to aggregates), kilesūpadhi (attachments to defilements), and abhisaṅkhārūpadhi (attachments to volitional formations).
Upadhī hi narassa nandanā (Quả thật, các Upa-đhī là niềm vui của con người), ở đây, upadhī là bốn loại upa-đhī: kāmūpadhi (upa-đhī dục), khandhūpadhi (upa-đhī uẩn), kilesūpadhi (upa-đhī phiền não), abhisaṅkhārūpadhi (upa-đhī hành).
Kāmāpi hi ‘‘yaṃ pañca kāmaguṇe paṭicca uppajjati sukhaṃ somanassaṃ, ayaṃ kāmānaṃ assādo’’ti (ma. ni. 1.166) evaṃ vuttassa sukhassa adhiṭṭhānabhāvato ‘‘upadhiyati ettha sukha’’nti iminā vacanatthena upadhīti vuccati.
And because sensual pleasures (kāma), being the basis for the happiness that arises dependent on the five cords of sensual pleasure—as stated: "The delight of sensual pleasures is the happiness and joy that arises dependent on the five cords of sensual pleasure"—are thus called 'upadhi' by the meaning of the word "that on which happiness is based (upadhiyati)."
Quả thật, các dục cũng được gọi là upa-đhī theo nghĩa là “niềm vui được đặt vào đây”, vì chúng là nền tảng của niềm vui đã được nói đến như sau: “Niềm vui và sự hoan hỷ nào phát sinh do duyên năm dục công đức, đó là vị ngọt của các dục” (Ma. Ni. 1.166).
Khandhāpi khandhamūlakassa dukkhassa adhiṭṭhānabhāvato, kilesāpi apāyadukkhassa adhiṭṭhānabhāvato, abhisaṅkhārāpi bhavadukkhassa adhiṭṭhānabhāvatoti.
Similarly, the aggregates (khandha) are called 'upadhi' because they are the basis of suffering rooted in the aggregates; defilements (kilesa) because they are the basis of suffering in the lower realms; and volitional formations (abhisaṅkhāra) because they are the basis of suffering in existence.
Các uẩn cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau bắt nguồn từ uẩn; các phiền não cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau trong các cõi đọa xứ; và các hành cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau trong các cõi hữu.
Idha pana kāmūpadhi adhippeto.
However, here, kāmūpadhi (sensual attachments) is intended.
Nhưng ở đây, kāmūpadhi (upa-đhī dục) được đề cập đến.
Pañca hi kāmaguṇā tebhūmikādipāsāda-uḷārasayana-vatthālaṅkāra-nāṭakaparivārādivasena paccupaṭṭhitā pītisomanassaṃ upasaṃharamānā naraṃ nandayanti.
Indeed, the five cords of sensual pleasure, present as palaces, excellent beds, clothes, ornaments, dancers, and retinues, bringing joy and happiness, delight a person.
Quả thật, năm dục công đức, được biểu hiện dưới dạng cung điện ba cõi, giường nằm cao quý, y phục, trang sức, ca múa, tùy tùng, v.v., mang lại niềm vui và sự hoan hỷ, khiến con người hoan hỷ.
Tasmā yathā puttā ca gāvo ca, evaṃ imepi upadhī hi narassa nandanāti veditabbā.
Therefore, just as sons and cattle, so too are these upadhi to be understood as a man's delight.
Do đó, cần phải hiểu rằng, cũng như con cái và bò, những upa-đhī này quả thật là niềm vui của con người.
Na hi so nandati yo nirūpadhīti yo kāmaguṇasampattirahito daliddo dullabhaghāsacchādano, na hi so nandati.
"He who is without upadhi does not delight"—this refers to the poor person who is deprived of the enjoyment of sensual pleasures, one who finds sustenance and clothing difficult to obtain; such a person does not delight.
Na hi so nandati yo nirūpadhī (Người không có upa-đhī thì không hoan hỷ) nghĩa là người nghèo khó, thiếu thốn thực phẩm và y phục, không có sự sung túc về dục công đức, người đó không hoan hỷ.
Evarūpo manussapeto ca manussanerayiko ca kiṃ nandissati bhagavāti āha.
"How can such a human ghost or a human denizen of hell delight, O Blessed One?" the deity asks.
Bạch Thế Tôn, một người ngạ quỷ trong loài người và một người địa ngục trong loài người như vậy thì làm sao có thể hoan hỷ được? – vị thiên nhân nói.
Idaṃ sutvā satthā cintesi – ‘‘ayaṃ devatā sokavatthumeva nandavatthuṃ karoti, sokavatthubhāvamassā dīpessāmī’’ti phalena phalaṃ pātento viya tāyeva upamāya tassā vādaṃ bhindanto tameva gāthaṃ parivattetvā socatīti āha.
Hearing this, the Teacher reflected, "This deity makes the cause of sorrow into a cause of delight; I shall demonstrate to him its nature as a cause of sorrow." Like striking fruit with fruit, breaking his argument with the very same simile, the Blessed One responded by turning the verse around and saying, "He grieves."
Nghe điều này, Đức Thế Tôn suy nghĩ: “Vị thiên nhân này biến điều đáng sầu muộn thành điều đáng hoan hỷ. Ta sẽ chỉ rõ cho vị ấy bản chất đáng sầu muộn của nó.” Ngài liền, như thể dùng quả để đánh rụng quả, phá bỏ lập luận của vị ấy bằng chính ví dụ đó, và xoay ngược bài kệ đó mà nói: socati (sầu muộn).
Tattha socati puttehīti videsagamanādivasena puttesu naṭṭhesupi nassantesupi idāni nassissantīti nāsasaṅkīpi socati, tathā matesupi marantesupi corehi rājapurisehi gahitesu vā paccatthikānaṃ hatthaṃ upagatesu vā maraṇasaṅkīpi hutvā socati.
Here, "He grieves on account of sons"—even when sons are lost or in the process of being lost due to reasons like going abroad, or even when one suspects they will be lost now, one grieves. Similarly, even when they have died or are dying, or have been seized by thieves or royal officers, or have fallen into the hands of enemies, one grieves out of fear of their death.
Trong đó, socati puttehī (sầu muộn vì con cái) nghĩa là, ngay cả khi con cái bị mất mát do đi xa xứ hoặc đang mất mát, hoặc khi có sự nghi ngờ rằng chúng sẽ mất mát, người cha mẹ vẫn sầu muộn. Tương tự, ngay cả khi chúng đã chết, đang chết, hoặc bị bắt bởi kẻ trộm hoặc quan lại, hoặc rơi vào tay kẻ thù, người cha mẹ vẫn sầu muộn vì lo sợ cái chết.
Rukkhapabbatādīhi patitvā hatthapādādīnaṃ bhedavasena bhinnesupi bhijjantesupi bhedasaṅkīpi hutvā socati.
Even when they are broken or in the process of being broken, such as when they fall from trees or mountains, resulting in broken hands or feet, one grieves out of fear of their breakage.
Khi con cái té từ cây cối, núi non, v.v., bị gãy tay chân hoặc đang bị gãy, hoặc khi có sự nghi ngờ rằng chúng sẽ bị gãy, người cha mẹ vẫn sầu muộn.
Yathā ca puttehi puttimā, gosāmikopi tatheva navahākārehi gohi socati.
And just as one with sons grieves on account of sons, so too does the owner of cattle grieve on account of cattle in nine ways.
Cũng như người có con sầu muộn vì con cái, chủ bò cũng sầu muộn vì bò theo chín cách như vậy.
Upadhī hi narassa socanāti yathā ca puttagāvo, evaṃ pañca kāmaguṇopadhīpi –
"Indeed, upadhi are a man's sorrow"—just as sons and cattle, so too do the five sensual pleasure upadhi—
Upadhī hi narassa socanā (Quả thật, các Upa-đhī là nỗi sầu muộn của con người) nghĩa là, cũng như con cái và bò, năm dục công đức là upa-đhī cũng khiến con người sầu muộn –
13. Tatiye natthi puttasamaṃ pemanti virūpepi hi attano puttake suvaṇṇabimbakaṃ viya maññanti, mālāguḷe viya sīsādīsu katvā pariharamānā tehi ohaditāpi omuttikāpi gandhavilepanapatitā viya somanassaṃ āpajjanti.
In the third*, "There is no love like that for a son." Indeed, even ugly children are regarded by their parents as if they were golden images. Carrying them on their heads and other places like garlands, even when the children excrete or urinate on them, they feel joy as if fragrant unguents had fallen on them.
13. Trong bài kệ thứ ba, natthi puttasamaṃ pema (không có tình yêu nào bằng tình yêu con cái) nghĩa là, ngay cả với những đứa con xấu xí, người ta vẫn nghĩ chúng như tượng vàng, và khi bế chúng trên đầu hoặc các bộ phận khác như vòng hoa, dù chúng có đại tiện hay tiểu tiện, người ta vẫn cảm thấy hoan hỷ như thể hương liệu rơi vào.
Tenāha – ‘‘natthi puttasamaṃ pema’’nti.
Therefore, it is said: "There is no love like that for a son."
Vì vậy, Ngài nói: “Không có tình yêu nào bằng tình yêu con cái.”
Puttapemasamaṃ pemaṃ nāma natthīti vuttaṃ hoti.
It means that there is no love equal to a son's love.
Điều đó có nghĩa là không có tình yêu nào sánh bằng tình yêu con cái.
Gosamitaṃ dhananti gohi samaṃ godhanasamaṃ godhanasadisaṃ aññaṃ dhanaṃ nāma natthi bhagavāti āha.
"Wealth like cattle"—the deity says: "O Blessed One, there is no other wealth like cattle, no wealth comparable to cattle."
Gosamitaṃ dhanaṃ (tài sản ngang bằng bò) nghĩa là, bạch Thế Tôn, không có tài sản nào khác sánh bằng tài sản là bò, hoặc tương đương với tài sản là bò – vị thiên nhân nói.
Sūriyasamā ābhāti sūriyābhāya samā aññā ābhā nāma natthīti dasseti.
"Light like the sun"—this shows that there is no other light comparable to the light of the sun.
Sūriyasamā ābhā (ánh sáng ngang bằng mặt trời) nghĩa là, không có ánh sáng nào khác sánh bằng ánh sáng mặt trời – Ngài chỉ ra.
Samuddaparamāti ye keci aññe sarā nāma, sabbe te samuddaparamā, samuddo tesaṃ uttamo, samuddasadisaṃ aññaṃ udakanidhānaṃ nāma natthi, bhagavāti.
"The ocean is supreme"—the deity says: "O Blessed One, whatever other rivers there may be, all of them have the ocean as their ultimate limit; the ocean is superior to them. There is no other reservoir of water like the ocean."
Samuddaparamā (biển là tối thượng) nghĩa là, bạch Thế Tôn, tất cả các hồ nước khác đều lấy biển làm tối thượng, biển là tối cao của chúng; không có nơi chứa nước nào khác sánh bằng biển.
Yasmā pana attapemena samaṃ pemaṃ nāma natthi.
However, there is no love like self-love.
Vì không có tình yêu nào sánh bằng tình yêu bản thân.
Mātāpitādayo hi chaḍḍetvāpi puttadhītādayo ca aposetvāpi sattā attānameva posenti.
Indeed, beings sustain themselves even abandoning parents, and not supporting sons and daughters.
Quả thật, chúng sinh, dù bỏ cha mẹ và không nuôi dưỡng con cái, vẫn tự nuôi dưỡng bản thân mình.
Dhaññena ca samaṃ dhanaṃ nāma natthi.(Yadā hi sattā dubbhikkhā honti), tathārūpe hi kāle hiraññasuvaṇṇādīni gomahiṃsādīnipi dhaññaggahaṇatthaṃ dhaññasāmikānameva santikaṃ gahetvā gacchanti.
And there is no wealth like grain. (When beings suffer famine), in such a time, even gold, silver, etc., and cattle, buffalo, etc., are taken to the owners of grain for the purpose of obtaining grain.
Không có tài sản nào sánh bằng lúa gạo. (Khi chúng sinh gặp nạn đói), vào những thời điểm như vậy, vàng bạc, châu báu, bò, trâu, v.v., đều được mang đến cho những người chủ lúa gạo để đổi lấy lúa gạo.
Paññāya ca samā ābhā nāma natthi.
And there is no light like wisdom.
Không có ánh sáng nào sánh bằng trí tuệ.
Sūriyādayo hi ekadesaṃyeva obhāsanti, paccuppannameva ca tamaṃ vinodenti.
For the sun and others illuminate only a part, and dispel only the present darkness.
Quả thật, mặt trời và các nguồn sáng khác chỉ chiếu sáng một phần nhỏ và chỉ xua tan bóng tối hiện tại.
Paññā pana dasasahassimpi lokadhātuṃ ekappajjotaṃ kātuṃ sakkoti, atītaṃsādipaṭicchādakañca tamaṃ vidhamati.
But wisdom can make even ten thousand world-systems shine at once, and it dispels the darkness that conceals the past and other times.
Nhưng trí tuệ có thể làm cho mười ngàn thế giới trở thành một ánh sáng duy nhất, và xua tan bóng tối che phủ quá khứ, v.v.
Meghavuṭṭhiyā ca samo saro nāma natthi.
And there is no river like a rain shower.
Không có hồ nước nào sánh bằng mưa rào.
Nadīvāpi hotu talākādīni vā, vuṭṭhisamo saro nāma natthi.
Whether it be a river or tanks, there is no river like a rain shower.
Dù là sông hay ao hồ, không có hồ nước nào sánh bằng mưa rào.
Meghavuṭṭhiyā hi pacchinnāya mahāsamuddo aṅgulipabbatemanamattampi udakaṃ na hoti, vuṭṭhiyā pana pavattamānāya yāva ābhassarabhavanāpi ekodakaṃ hoti.
For when rain stops, the great ocean does not have even enough water to wet a finger joint; but when rain is falling, it becomes one sheet of water up to the Ābhassarabhava (Realm of Streaming Radiance).
Quả thật, khi mưa rào ngừng, đại dương không còn đủ nước để ngón tay nhúng vào. Nhưng khi mưa rào tiếp tục, nước sẽ dâng lên đến tận cõi Ābhassara.
Tasmā bhagavā devatāya paṭigāthaṃ vadanto natthi attasamaṃ pemantiādimāhāti.
Therefore, the Blessed One, in response to the deity's verse, spoke words beginning with "There is no love like self-love."
Do đó, Đức Thế Tôn, khi đáp lại bài kệ của vị thiên nhân, đã nói câu natthi attasamaṃ pema (không có tình yêu nào bằng tình yêu bản thân), v.v.
14. Catutthe khattiyo dvipadanti dvipadānaṃ rājā seṭṭho.
In the fourth*, "A warrior is best among two-footed beings"—the king is supreme among two-footed beings.
14. Trong bài kệ thứ tư, khattiyo dvipadaṃ (vị Sát-đế-lợi trong loài hai chân) nghĩa là vua là người tối thượng trong loài hai chân.
Komārīti kumārikāle gahitā.
"Komārī" means one taken in maidenhood.
Komārī (người phụ nữ trẻ) nghĩa là người được cưới từ khi còn là thiếu nữ.
Ayaṃ sesabhariyānaṃ seṭṭhāti vadati.
This implies that she is supreme among other wives.
Điều này nói rằng cô ấy là người tối thượng trong số các bà vợ khác.
Pubbajoti paṭhamaṃ jāto kāṇo vāpi hotu kuṇiādīnaṃ vā aññataro, yo paṭhamaṃ jāto, ayameva putto imissā devatāya vāde seṭṭho nāma hoti.
"The firstborn" (Pubbajo)—whether he is blind or crippled or otherwise, the one who is born first, this very son is considered supreme according to the deity's statement.
Pubbajo (người con đầu lòng) nghĩa là, dù người con đầu lòng có bị mù hay què, hay bất kỳ khuyết tật nào khác, người con đầu lòng này là người con tối thượng theo lập luận của vị thiên nhân này.
Yasmā pana dvipadādīnaṃ buddhādayo seṭṭhā, tasmā bhagavā paṭigāthaṃ āha.
However, since the Buddhas and others are supreme among two-footed beings and so on, the Blessed One spoke a counter-verse.
Tuy nhiên, vì Đức Phật và các vị khác là tối thượng trong số các loài hai chân, v.v., nên Đức Thế Tôn đã nói bài kệ đáp lại.
Tattha kiñcāpi bhagavā sabbesaṃyeva apadādibhedānaṃ sattānaṃ seṭṭho, uppajjamāno panesa sabbasattaseṭṭho dvipadesuyeva uppajjati, tasmā sambuddho dvipadaṃ seṭṭhoti āha.
Although the Blessed One is supreme among all beings, including those without feet, etc., when he arises, he arises among two-footed beings as the supreme of all beings. Therefore, it is said: "The Fully Awakened One is supreme among two-footed beings."
Trong đó, mặc dù Đức Thế Tôn là tối thượng trong tất cả các loài chúng sinh, dù không chân hay có chân, nhưng khi xuất hiện, Ngài xuất hiện trong loài hai chân là tối thượng trong tất cả chúng sinh, do đó Ngài nói: sambuddho dvipadaṃ seṭṭho (Đức Phật Chánh Đẳng Giác là tối thượng trong loài hai chân).
Dvipadesu uppannassa cassa sabbasattaseṭṭhabhāvo appaṭihatova hoti.
And his supremacy among all beings, having arisen among two-footed beings, is unimpeded.
Và khi Ngài xuất hiện trong loài hai chân, sự tối thượng của Ngài trong tất cả chúng sinh là không thể ngăn cản.
Ājānīyoti hatthī vā hotu assādīsu aññataro vā, yo kāraṇaṃ jānāti, ayaṃ ājānīyova catuppadānaṃ seṭṭhoti attho.
"Ājānīyo" means a knowledgeable one—whether an elephant or a horse or any other kind*, one who understands the situation; this knowledgeable one is supreme among quadrupeds.
Ājānīyo (giống tốt) nghĩa là, dù là voi hay bất kỳ loài ngựa nào khác, con vật nào biết nguyên nhân, con vật giống tốt đó là tối thượng trong loài bốn chân.
Kūṭakaṇṇarañño guḷavaṇṇaasso viya.
Like King Kūṭakaṇṇa's horse, Guḷavaṇṇa.
Như con ngựa Guḷavaṇṇa của Vua Kūṭakaṇṇa.
Rājā kira pācīnadvārena nikkhamitvā cetiyapabbataṃ gamissāmīti kalambanadītīraṃ sampatto, asso tīre ṭhatvā udakaṃ otarituṃ na icchati, rājā assācariyaṃ āmantetvā, ‘‘aho vata tayā asso sikkhāpito udakaṃ otarituṃ na icchatī’’ti āha.
It is said that the king, having departed through the eastern gate intending to go to Cetiyapabbata, reached the Kalambanadī riverbank. The horse stood at the bank and refused to enter the water. The king summoned the horse-trainer and said, "Alas, your horse has been trained in such a way that it does not want to enter the water."
Được biết, nhà vua đã ra khỏi cổng phía đông để đến núi Cetiyapabbata và đến bờ sông Kalambanadī. Con ngựa đứng trên bờ và không muốn xuống nước. Nhà vua gọi người huấn luyện ngựa và nói: “Ôi! Ngươi đã huấn luyện con ngựa thế nào mà nó không muốn xuống nước!”
Ācariyo ‘‘susikkhāpito deva asso, etassa hi cittaṃ – ‘sacāhaṃ udakaṃ otarissāmi, vālaṃ temissati, vāle tinte rañño aṅge udakaṃ pāteyyā’ti, evaṃ tumhākaṃ sarīre udakapātanabhayena na otarati, vālaṃ gaṇhāpethā’’ti āha.
The trainer said, "Your Majesty, the horse is well-trained. Its thought is, 'If I enter the water, my tail will get wet, and if my tail is wet, it might splash water on the king's body.' Thus, out of fear of splashing water on your body, it does not enter. Please hold its tail."
Người huấn luyện nói: “Tâu Đại vương, con ngựa đã được huấn luyện rất tốt. Tâm trí của nó nghĩ: ‘Nếu ta xuống nước, đuôi ta sẽ ướt, và khi đuôi ướt, nước sẽ bắn vào người Đại vương.’ Vì sợ bắn nước vào người Đại vương nên nó không xuống. Xin hãy giữ đuôi nó lại.”
Rājā tathā kāresi.
The king did so.
Nhà vua đã làm như vậy.
Asso vegena otaritvā pāraṃ gato.
The horse swiftly entered and crossed to the other side.
Con ngựa lập tức xuống và sang bờ bên kia.
Sussūsāti sussūsamānā.
"Sussūsā" refers to one who is eager to listen.
Sussūsā (người vâng lời) nghĩa là người đang vâng lời.
Kumārikāle vā gahitā hotu pacchā vā, surūpā vā virūpā vā, yā sāmikaṃ sussūsati paricarati toseti, sā bhariyānaṃ seṭṭhā.
Whether taken in girlhood or later, whether beautiful or plain, the wife who serves, attends to, and pleases her husband, she is the best among wives.
Dù được cưới khi còn trẻ hay sau này, dù xinh đẹp hay xấu xí, người vợ nào vâng lời, phục vụ và làm hài lòng chồng, người đó là tối thượng trong các bà vợ.
Assavoti āsuṇamāno.
Assavo means one who is obedient and listens.
Assavo (người tuân theo) nghĩa là người đang lắng nghe.
Jeṭṭho vā hi hotu kaniṭṭho vā, yo mātāpitūnaṃ vacanaṃ suṇāti, sampaṭicchati, ovādapaṭikaro hoti, ayaṃ puttānaṃ seṭṭho, aññehi sandhicchedakādicorehi puttehi ko attho devateti.
Whether he is the eldest or the youngest, the son who listens to the words of his parents, accepts them, and acts according to their advice, he is the best among sons. What is the use of other sons, O deity, who are like house-breaking thieves and so forth?
Dù là con lớn hay con nhỏ, người con nào lắng nghe lời cha mẹ, chấp nhận và tuân thủ lời khuyên dạy, người con ấy là bậc tối thượng trong số các con. Hỡi chư thiên, có ích gì với những người con khác là những kẻ trộm cắp, phá tường v.v.?
15. Pañcame ṭhite majjhanhiketi ṭhitamajjhanhike.
15. In the fifth, ṭhite majjhanhike means at high noon, when the sun stands directly overhead.
Trong kinh thứ năm, ṭhite majjhanhike nghĩa là khi mặt trời đứng bóng giữa trưa.
Sannisīvesūti yathā phāsukaṭṭhānaṃ upagantvā sannisinnesu vissamamānesu.
Sannisīvesu means when they are gathered and resting, having gone to a comfortable place.
Sannisīvesu nghĩa là khi chúng đã đến nơi thuận tiện và ngồi xuống nghỉ ngơi.
Ṭhitamajjhanhikakālo nāmesa sabbasattānaṃ iriyāpathadubbalyakālo.
This time of high noon is indeed the time when the physical postures of all beings are weak.
Thời điểm giữa trưa là thời điểm mà tất cả chúng sinh đều yếu ớt trong oai nghi.
Idha pana pakkhīnaṃyeva vasena dassito.
Here, however, it is shown specifically in relation to birds.
Ở đây, điều này được thể hiện chỉ riêng cho loài chim.
Saṇatevāti saṇati viya mahāviravaṃ viya muccati.
Saṇatevā means it sounds as if it is making a great roar, as if it is emitting a loud noise.
Saṇatevā nghĩa là như phát ra tiếng kêu, như phát ra một tiếng ồn lớn.
Saṇamānameva cettha ‘‘saṇatevā’’ti vuttaṃ.
Here, "saṇatevā" is said of that which is making a sound.
Ở đây, chính tiếng ồn đó được gọi là "saṇatevā".
Tappaṭibhāgaṃ nāmetaṃ.
This is a corresponding term.
Đây là một từ đồng nghĩa.
Nidāghasamayasmiñhi ṭhitamajjhanhikakāle catuppadagaṇesu ceva pakkhīgaṇesu ca sannisinnesu vātapūritānaṃ susirarukkhānañceva chiddaveṇupabbānañca khandhena khandhaṃ sākhāya sākhaṃ saṅghaṭṭayantānaṃ pādapānañca araññamajjhe mahāsaddo uppajjati.
Indeed, in the summer season, at high noon, when groups of quadrupeds and birds are gathered, a great sound arises in the middle of the forest from hollow trees filled with wind, and from hollow bamboo clumps, and from trees whose trunks strike against other trunks and whose branches strike against other branches.
Vào mùa nóng, giữa trưa, khi các loài động vật bốn chân và các loài chim đã ngồi xuống, một tiếng ồn lớn phát ra giữa rừng từ những cây rỗng ruột chứa đầy gió, từ những đốt tre rỗng, và từ những cây va chạm cành với cành, thân với thân.
Taṃ sandhāyetaṃ vuttaṃ.
It is with reference to that sound that this is said.
Điều này được nói đến để chỉ điều đó.
Taṃ bhayaṃ paṭibhāti manti taṃ evarūpe kāle mahāaraññassa saṇamānaṃ mayhaṃ bhayaṃ hutvā upaṭṭhāti.
Taṃ bhayaṃ paṭibhāti manti means that resounding of the great forest at such a time appears to me as fear.
Taṃ bhayaṃ paṭibhāti maṃ nghĩa là vào thời điểm như vậy, tiếng ồn ào của khu rừng lớn ấy hiện ra như một nỗi sợ hãi đối với tôi.
Dandhapaññā kiresā devatā tasmiṃ khaṇe attano nisajjaphāsukaṃ kathāphāsukaṃ dutiyakaṃ alabhantī evamāha.
This deity, being of dull wisdom, said this at that moment, not finding a companion comfortable for sitting or comfortable for conversation.
Vị thiên nhân này, được cho là có trí tuệ chậm lụt, đã nói như vậy vào khoảnh khắc đó khi không tìm được người thứ hai để chia sẻ sự thoải mái khi ngồi và sự thoải mái khi nói chuyện.
Yasmā pana tādise kāle piṇḍapātapaṭikkantassa vivitte araññāyatane kammaṭṭhānaṃ gahetvā nisinnassa bhikkhuno anappakaṃ sukhaṃ uppajjati, yaṃ sandhāya vuttaṃ –
However, because in such a time, great bliss arises for a bhikkhu who has returned from his alms round, and is sitting in a secluded forest hermitage, having taken up a meditation subject, concerning which it is said:
Tuy nhiên, vì vào thời điểm như vậy, một tỳ khưu đã trở về sau khi khất thực, ngồi xuống thiền định trong một khu rừng vắng vẻ, sẽ phát sinh một niềm an lạc không nhỏ, điều mà đã được nói đến để chỉ –
16. Chaṭṭhe niddāti, ‘‘abhijānāmahaṃ, aggivessana, gimhānaṃ pacchime māse niddaṃ okkamitā’’ti (ma. ni. 1.387) evarūpāya abyākataniddāya pubbabhāgāparabhāgesu sekhaputhujjanānaṃ sasaṅkhārikaakusale citte uppannaṃ thinamiddhaṃ.
16. In the sixth, niddā refers to thinamiddha (sloth and torpor) arisen in the unskillful minds of trainees and ordinary individuals in the periods preceding and following undeterminable sleep of this kind: "I recollect, Aggivessana, having fallen asleep in the last month of the hot season."
Trong kinh thứ sáu, niddā là sự hôn trầm (thīna-middha) phát sinh trong tâm bất thiện có tác ý của các bậc hữu học (sekha) và phàm phu (puthujjana) ở phần đầu và phần cuối của giấc ngủ vô ký (abyākata-niddā) như trong câu: “Này Aggivessana, ta biết rằng ta đã ngủ vào tháng cuối cùng của mùa hè.”
Tandīti aticchātātisītādikālesu uppannaṃ āgantukaṃ ālasiyaṃ.
Tandī refers to adventitious laziness arisen at times of excessive hunger or cold.
Tandī là sự lười biếng (ālasya) khách quan phát sinh vào những thời điểm quá đói hoặc quá lạnh.
Vuttampi cetaṃ – ‘‘tattha katamā tandī?
It is also said: "What is tandī there?
Điều này cũng đã được nói: “Ở đó, sự lười biếng nào? Đó là sự lười biếng, sự lười biếng, sự lười biếng, sự uể oải, sự uể oải, sự uể oải, đó được gọi là sự lười biếng.”
Yā tandī tandiyanā tandimanatā ālasyaṃ ālasyāyanā ālasyāyitattaṃ, ayaṃ vuccati tandī’’ti (vibha. 857).
That sluggishness, being sluggish, sluggishness of mind, idleness, being idle, state of being idle: this is called tandī."
Sự uể oải, sự lười biếng, sự lười nhác, sự biếng nhác, sự lười nhác hóa, sự trở nên lười nhác, đây được gọi là ‘tandī’ (sự uể oải).
Vijambhitāti kāyavijambhanā.
Vijambhitā means stretching of the body.
Vijambhitā là sự vươn vai của thân thể.
Aratīti akusalapakkhā ukkaṇṭhitatā.
Aratī means discontent, belonging to the unskillful side.
Aratī là sự chán nản thuộc về phe bất thiện.
Bhattasammadoti bhattamucchā bhattakilamatho.
Bhattasammado means food-intoxication, food-weariness.
Bhattasammado là sự say sưa do thức ăn, sự mệt mỏi do thức ăn.
Vitthāro pana tesaṃ – ‘‘tattha katamā vijambhitā?
Their elaboration is already given in the Abhidhamma in the manner beginning: "What is vijambhitā there?
Tuy nhiên, sự giải thích chi tiết về chúng – “Ở đó, sự vươn vai nào? Đó là sự vươn vai, sự vươn vai của thân thể” v.v. đã được trình bày trong Abhidhamma.
Yā kāyassa jambhanā vijambhanā’’tiādinā nayena abhidhamme āgatova.
That stretching, stretching of the body."
“Sự uể oải của thân, sự uể oải hoàn toàn của thân”, v.v. đã được đề cập trong Abhidhamma theo cách này.
Etenāti etena niddādinā upakkilesena upakkiliṭṭho nivāritapātubhāvo.
Etenā means stained by this defilement such as sloth, its manifestation is hindered.
Etenā nghĩa là bị ô nhiễm bởi những cấu uế như giấc ngủ này, sự hiện hữu bị ngăn cản.
Nappakāsatīti na jotati, na pātubhavatīti attho.
Nappakāsatī means it does not shine, it does not manifest. This is the meaning.
Nappakāsatī nghĩa là không tỏa sáng, không hiện hữu.
Ariyamaggoti lokuttaramaggo.
Ariyamaggo means the supramundane path.
Ariyamaggo là con đường siêu thế (lokuttara-magga).
Idhāti imasmiṃ loke.
Idhā means in this world.
Idhā là trong thế giới này.
Pāṇinanti sattānaṃ.
Pāṇinaṃ means for beings.
Pāṇinaṃ là của chúng sinh.
Vīriyenāti maggasahajātavīriyena.
Vīriyenā means by the effort concomitant with the path.
Vīriyenā là với tinh tấn đồng sinh với Đạo.
Naṃ paṇāmetvāti etaṃ kilesajātaṃ nīharitvā.
Naṃ paṇāmetvā means having removed this mass of defilements.
Naṃ paṇāmetvā là sau khi loại bỏ nhóm phiền não này.
Ariyamaggoti lokiyalokuttaramaggo.
Ariyamaggo means the mundane and supramundane path.
Ariyamaggo là con đường thế gian và siêu thế.
Iti maggeneva upakkilese nīharitvā maggassa visuddhi vuttāti.
Thus, by the path itself, having removed defilements, the purity of the path is declared.
Như vậy, sự thanh tịnh của Đạo đã được nói đến bằng cách loại bỏ các cấu uế chính bằng Đạo.
17. Sattame duttitikkhanti dukkhamaṃ duadhivāsiyaṃ.
17. In the seventh, duttitikkhaṃ means difficult to bear, difficult to endure.
Trong kinh thứ bảy, duttitikkhaṃ nghĩa là khó chịu đựng, khó nhẫn nại.
Abyattenāti bālena.
Abyattenā means by the foolish.
Abyattenā nghĩa là bởi người ngu si.
Sāmaññanti samaṇadhammo.
Sāmaññaṃ means the practice of a recluse.
Sāmaññaṃ là pháp của Sa-môn.
Iminā devatā idaṃ dasseti – yaṃ paṇḍitā kulaputtā dasapi vassāni vīsatipi saṭṭhipi vassāni dante abhidantamādhāya jivhāya tāluṃ āhaccapi cetasā cittaṃ abhiniggaṇhitvāpi ekāsanaṃ ekabhattaṃ paṭisevamānā āpāṇakoṭikaṃ brahmacariyaṃ carantā sāmaññaṃ karonti.
By this, the deity shows that the noble practice which wise young men undertake—practicing the brahmacariya up to the end of life, for ten, twenty, or even sixty years, eating only one meal and sitting in one posture, pressing the lower teeth against the upper, pressing the tongue against the palate, and restraining the mind with the mind—
Qua đó, vị thiên nhân này cho thấy rằng: những người con của gia đình có trí tuệ, dù sống mười năm, hai mươi năm, hay sáu mươi năm, giữ răng dưới chạm răng trên, lưỡi chạm vòm miệng, và kìm nén tâm bằng ý chí, thực hành đời sống Phạm hạnh đến hơi thở cuối cùng, chỉ ăn một bữa và ngồi một chỗ, họ thực hành Sa-môn hạnh.
Taṃ bhagavā bālo abyatto kātuṃ na sakkotīti.
That the Blessed One, as a foolish and unskilled one, cannot perform it.
Đức Thế Tôn nói rằng một người ngu si, không khéo léo, không thể thực hành điều đó.
Bahū hi tattha sambādhāti tasmiṃ sāmaññasaṅkhāte ariyamagge bahū sambādhā maggādhigamāya paṭipannassa pubbabhāge bahū parissayāti dasseti.
Bahū hi tattha sambādhā indicates that in that noble path called the practice of a recluse, there are many obstacles; for one who has entered the path to attainment, there are many dangers in the initial stages, such as sensual thoughts.
Bahū hi tattha sambādhā cho thấy rằng trong con đường Thánh (ariyama-gga) được gọi là Sa-môn hạnh đó, có nhiều chướng ngại, nhiều hiểm nguy ở giai đoạn đầu đối với người đang thực hành để đạt đến Đạo.
Cittañce na nivārayeti yadi ayoniso uppannaṃ cittaṃ na nivāreyya, kati ahāni sāmaññaṃ careyya?
Cittañce na nivāraye means if one does not restrain the mind arisen unwisely, for how many days could one practice the recluse's life?
Cittañce na nivāraye nghĩa là nếu không kìm nén tâm đã phát sinh một cách không đúng đắn, thì người đó có thể thực hành Sa-môn hạnh được bao nhiêu ngày?
Ekadivasampi na careyya.
One could not practice even for a single day.
Thậm chí một ngày cũng không thể thực hành.
Cittavasiko hi samaṇadhammaṃ kātuṃ na sakkoti.
For one who is under the sway of the mind cannot perform the recluse's practice.
Vì người bị tâm chi phối không thể thực hành pháp Sa-môn.
Pade padeti ārammaṇe ārammaṇe.
Pade pade means at every object.
Pade pade nghĩa là ở mỗi đối tượng.
Ārammaṇañhi idha padanti adhippetaṃ.
Indeed, the object is here intended by "pada".
Ở đây, đối tượng được hiểu là "pada".
Yasmiṃ yasmiṃ hi ārammaṇe kileso uppajjati, tattha tattha bālo visīdati nāma.
For at whatever object defilement arises, there the fool sinks.
Vì ở mỗi đối tượng mà phiền não phát sinh, ở đó người ngu si sẽ chìm đắm.
Iriyāpathapadampi vaṭṭati.
The "pada" of posture is also applicable.
Từ "pada" cũng có thể chỉ oai nghi.
Gamanādīsu hi yattha yattha kileso uppajjati, tattha tattheva visīdati nāma.
For in whatever posture, such as walking, defilement arises, there one sinks.
Vì ở mỗi oai nghi như đi lại mà phiền não phát sinh, ở đó người đó sẽ chìm đắm.
Saṅkappānanti kāmasaṅkappādīnaṃ.
Saṅkappānaṃ refers to sensual thoughts and so forth.
Saṅkappānaṃ là của các tư duy như tư duy dục (kāmasaṅkappa).
Kummo vāti kacchapo viya.
Kummo vā means like a tortoise.
Kummo vā nghĩa là như con rùa.
Aṅgānīti gīvapañcamāni aṅgāni.
Aṅgāni means the limbs, with the neck as the fifth.
Aṅgāni là năm chi, với cổ là chi thứ năm.
Samodahanti samodahanto, samodahitvā vā.
Samodahaṃ means gathering, or having gathered.
Samodahanti nghĩa là đang thu mình lại, hoặc đã thu mình lại.
Manovitakketi manamhi uppannavitakke.
Manovitakke means thoughts arisen in the mind.
Manovitakke là các tư duy phát sinh trong tâm.
Ettāvatā idaṃ dasseti – yathā kummo soṇḍipañcamāni aṅgāni sake kapāle samodahanto siṅgālassa otāraṃ na deti, samodahitvā cassa appasayhataṃ āpajjati, evamevaṃ bhikkhu manamhi uppannavitakke sake ārammaṇakapāle samodahaṃ mārassa otāraṃ na deti, samodahitvā cassa appasayhataṃ āpajjatīti.
By this much, it shows that just as a tortoise, gathering its limbs (which are five, including its snout) into its own shell, gives no opportunity to the jackal, and by gathering them becomes unassailable to it, even so a bhikkhu, gathering the thoughts arisen in his mind into the shell of his own object (of meditation), gives no opportunity to Māra, and by gathering them becomes unassailable to him.
Qua đó, điều này được cho thấy rằng: giống như con rùa thu năm chi của mình (bốn chân và cổ) vào mai của nó, không cho chồn cơ hội, và khi đã thu mình lại thì không thể bị chồn tấn công; cũng vậy, một tỳ khưu thu các tư duy phát sinh trong tâm vào mai đối tượng của mình, không cho Māra cơ hội, và khi đã thu mình lại thì không thể bị Māra tấn công.
Anissitoti taṇhādiṭṭhinissayehi anissito hutvā.
Anissito means having become independent of the supports of craving and wrong view.
Anissito nghĩa là không nương tựa vào sự nương tựa của tham ái và tà kiến.
Aheṭhayānoti avihiṃsamāno.
Aheṭhayāno means not harming.
Aheṭhayāno nghĩa là không làm hại.
Parinibbutoti kilesanibbānena parinibbuto.
Parinibbuto means completely extinguished by the extinction of defilements.
Parinibbuto nghĩa là đã nhập Niết Bàn bằng sự diệt trừ phiền não (kilesa-nibbāna).
Nūpavadeyya kañcīti yaṃkiñci puggalaṃ ācāravipattiādīsu yāya kāyaci maṅkuṃ kātukāmo hutvā na vadeyya, ‘‘kālena vakkhāmi no akālenā’’tiādayo pana pañca dhamme ajjhattaṃ upaṭṭhapetvā ullumpanasabhāvasaṇṭhitena cittena kāruññataṃ paṭicca vadeyyāti.
Nūpavadeyya kañcī means one should not speak ill of any person, desiring to cause embarrassment regarding their misconduct and so forth; rather, having established the five qualities within oneself, such as "I will speak at the right time, not at the wrong time," one should speak out of compassion with a mind intent on deliverance from moral decline.
Nūpavadeyya kañcī nghĩa là không nên nói xấu bất cứ ai vì muốn làm cho họ xấu hổ về những lỗi lầm trong hành vi, v.v., mà nên đặt năm pháp như "Ta sẽ nói đúng lúc, không nói sai lúc" vào trong tâm, và với tâm ý muốn giúp đỡ, nói với lòng từ bi.
18. Aṭṭhame hirīnisedhoti hiriyā akusale dhamme nisedhetīti hirīnisedho.
18. In the eighth, hirīnisedho means one who restrains unskillful actions by modesty (hirī).
Trong kinh thứ tám, hirīnisedho là sự ngăn cấm các pháp bất thiện bằng sự hổ thẹn (hirī).
Koci lokasmiṃ vijjatīti koci evarūpo vijjatīti pucchati.
Koci lokasmiṃ vijjatī means "Is there anyone in the world of such a kind?" he asks.
Koci lokasmiṃ vijjatī là hỏi rằng có ai như vậy trong thế gian không.
Yo nindaṃ apabodhatīti yo garahaṃ apaharanto bujjhati.
Yo nindaṃ apabodhatī means one who awakens, removing blame.
Yo nindaṃ apabodhatī là người nào thức tỉnh bằng cách loại bỏ sự khiển trách.
Asso bhadro kasāmivāti yathā bhadro assājānīyo kasaṃ apaharanto bujjhati, patodacchāyaṃ disvā saṃvijjhanto viya kasāya attani nipātaṃ na deti, evameva yo bhikkhu bhūtassa dasaakkosavatthuno attani nipātaṃ adadanto nindaṃ apabodhati apaharanto bujjhati, evarūpo koci khīṇāsavo vijjatīti pucchati.
"Just as a noble thoroughbred horse understands by avoiding the whip, and seeing the shadow of the goad, it does not allow the whip to fall on itself, as if startled; in the same way, the devatā asks, 'Is there any such bhikkhu, an Arahant, who, not allowing the ten grounds of true abuse to fall upon himself, understands by warding off censure?'"
Như con ngựa hiền tránh roi – như con ngựa thuần thục, khi thấy bóng roi, biết tránh roi không để roi chạm vào mình, như thể giật mình khi thấy bóng roi không để roi chạm vào thân mình; cũng vậy, vị Tỷ-kheo nào không để mười điều mắng nhiếc có thật chạm vào thân mình, mà biết tránh sự quở trách, thì có vị A-la-hán nào như thế không? – vị thiên nhân hỏi.
Abhūtakkosena pana parimutto nāma natthi.
However, there is no one who is free from false accusation.
Nhưng không có ai thoát khỏi lời mắng nhiếc không có thật.
Tanuyāti tanukā, hiriyā akusale dhamme nisedhetvā carantā khīṇāsavā nāma appakāti attho.
Regarding tanuyā: "Few are the Arahants who live by restraining unwholesome states through hiri (moral shame)." This is the meaning.
Ít ỏi – nghĩa là ít ỏi; những vị A-la-hán sống bằng sự hổ thẹn (hiri) ngăn chặn các pháp bất thiện thì ít ỏi.
Sadā satāti niccakālaṃ sativepullena samannāgatā.
Regarding sadā satā: "They are always endowed with an abundance of mindfulness."
Luôn luôn chánh niệm – luôn luôn đầy đủ sự chánh niệm.
Antaṃ dukkhassa pappuyyāti vaṭṭadukkhassa koṭiṃ antabhūtaṃ nibbānaṃ pāpuṇitvā.
Regarding antaṃ dukkhassa pappuyyā: "Having reached Nibbāna, which is the end, the culmination of the suffering of saṃsāra."
Đạt đến cuối cùng của khổ đau – đạt đến Niết-bàn, là điểm cuối cùng của khổ đau luân hồi.
Sesaṃ vuttanayamevāti.
The rest is in the manner already explained.
Phần còn lại cũng theo cách đã nói.
19. Navame kacci te kuṭikāti ayaṃ devatā dasa māse antovasanaṭṭhānaṭṭhena mātaraṃ kuṭikaṃ katvā, yathā sakuṇā divasaṃ gocarapasutā rattiṃ kulāvakaṃ allīyanti, evamevaṃ sattā tattha tattha gantvāpi mātugāmassa santikaṃ āgacchanti, ālayavasena bhariyaṃ kulāvakaṃ katvā.
19. In the ninth*, regarding kacci te kuṭikā: This devatā, making her mother a "hut" (kuṭikā) in the sense of a dwelling place for ten months in the womb, and just as birds, busy foraging during the day, cling to their nests at night, so too beings, even after going hither and thither, come back to a woman's presence, making a wife a "nest" out of attachment.
19. Trong kinh thứ chín, Túp lều của ông có không? – vị thiên nhân này đã xem mẹ là túp lều vì đã ở trong bụng mẹ mười tháng; giống như chim chóc ban ngày đi kiếm ăn, ban đêm lại trở về tổ; cũng vậy, chúng sanh dù đi đến đâu rồi cũng trở về với người nữ, xem vợ là tổ ấm do sự luyến ái. Xem dòng dõi gia đình là sự nối tiếp, xem con cái là sự nối tiếp, xem tham ái là sự ràng buộc, vị ấy đã kết hợp những câu hỏi này thành một bài kệ và hỏi Đức Thế Tôn. Đức Thế Tôn cũng đã trả lời vị ấy, nói lời Chắc chắn rồi và những lời khác.
Kulapaveṇiṃ santānakaṭṭhena putte santānake katvā, taṇhaṃ bandhanaṃ katvā, gāthābandhanena ime pañhe samodhānetvā bhagavantaṃ pucchi, bhagavāpissā vissajjento tagghātiādimāha.
Making children "webs" in the sense of a lineage, binding them with craving as a "bond", and thus forming these questions into stanzas, he questioned the Blessed One. The Blessed One, in answering him, spoke the words beginning with tagghā.
Trong đó, Chắc chắn rồi (tagghā) là một trạng từ dùng để khẳng định.
Tattha tagghāti ekaṃsavacane nipāto.
Therein, tagghā is a particle indicating certainty.
Không có – vì đã từ bỏ và xuất gia, nên không còn sự tái sinh trong bụng mẹ, không còn sự nuôi dưỡng vợ con hay sự sinh con cái trong luân hồi.
Natthīti pahāya pabbajitattā vaṭṭasmiṃ vā puna mātukucchivāsassa dārabharaṇassa puttanibbattiyā vā abhāvato natthi.
Natthī (there is not) means there is not, due to having renounced and gone forth, and due to the absence of dwelling again in a mother's womb, or supporting a wife, or the arising of children in saṃsāra.
Vị thiên nhân suy nghĩ: “Ta đã hỏi những câu hỏi bí mật được chuẩn bị kỹ lưỡng, và vị Sa-môn này đã trả lời ngay khi được hỏi. Phải chăng Ngài biết được ý định của ta mà nói, hay Ngài không biết mà nói đại những gì xuất hiện trong miệng?” – rồi hỏi tiếp: Ta là gì của Ngài? và những lời khác.
Devatā ‘‘mayā sannāhaṃ bandhitvā guḷhā pañhā pucchitā, ayañca samaṇo pucchitamatteyeva vissajjesi, jānaṃ nu kho me ajjhāsayaṃ kathesi, udāhu ajānaṃ yaṃ vā taṃ vā mukhāruḷhaṃ kathesī’’ti cintetvā puna kintāhantiādimāha.
The devatā, thinking, "I asked a profound question, having tightly bound it, and this recluse answered as soon as it was asked. Did he speak knowing my intention, or did he speak whatever came to his lips without knowing it?", and then spoke the words beginning with kintāhaṃ.
Trong đó, kintāhaṃ là cách đọc rút gọn của “kiṃ te ahaṃ” (ta là gì của ngài).
Tattha kintāhanti kiṃ te ahaṃ.
Therein, kintāhaṃ means "What am I to you?"
Rồi Đức Thế Tôn đã giảng giải cho vị ấy, nói lời Mẹ và những lời khác.
Athassā bhagavā ācikkhanto mātarantiādimāha.
Then the Blessed One, explaining to him, spoke the words beginning with mātaraṃ.
Lành thay cho Ngài – sau khi hoan hỷ và vui mừng với bài kệ, vị ấy đã đảnh lễ Đức Thế Tôn, cúng dường bằng hương hoa và các thứ khác, rồi trở về cõi trời của mình.
Sāhu teti gāthāya anumoditvā sampahaṃsitvā bhagavantaṃ vanditvā gandhamālādīhi pūjetvā attano devaṭṭhānameva gatāti.
The devatā, having rejoiced and become greatly gladdened by the stanza, having venerated the Blessed One and honored him with perfumes, garlands, etc., went back to her own divine abode.
.
20. Dasame tapodārāmeti tapodassa tattodakassa rahadassa vasena evaṃ laddhanāme ārāme.
20. In the tenth*, tapodārāme means "in the Tapoda monastery", an ārāma that acquired this name because of the hot water spring (tapoda) and lake.
20. Trong kinh thứ mười, Tại công viên Tapoda – tại công viên được đặt tên như vậy do có hồ nước nóng (tapoda).
Vebhārapabbatassa kira heṭṭhā bhummaṭṭhakanāgānaṃ pañcayojanasatikaṃ nāgabhavanaṃ devalokasadisaṃ maṇimayena talena ārāmuyyānehi ca samannāgataṃ.
It is said that below the Vebhāra mountain, there is a five-hundred yojana long Nāga abode belonging to the earth-dwelling Nāgas, resembling a deva realm, endowed with a jeweled ground and parks and gardens.
Nghe nói, bên dưới núi Vebhāra, có một cung điện của chư Nāga sống dưới đất, dài năm trăm do-tuần, giống như cõi trời, với nền đất bằng ngọc báu và đầy đủ vườn tược.
Tattha nāgānaṃ kīḷanaṭṭhāne mahāudakarahado, tato tapodā nāma nadī sandati kuthitā uṇhodakā.
There, in the playing ground of the Nāgas, is a great hot water lake, from which a river called Tapodā flows, boiling with hot water.
Tại nơi vui chơi của chư Nāga có một hồ nước lớn, từ đó sông Tapodā chảy ra, nước sôi sùng sục, nóng bỏng.
Kasmā panesā edisā?
But why is it like this?
Tại sao nó lại như vậy?
Rājagahaṃ kira parivāretvā mahāpetaloko tiṭṭhati, tattha dvinnaṃ mahālohakumbhinirayānaṃ antarena ayaṃ tapodā āgacchati, tasmā kuthitā sandati.
It is said that a great realm of hungry ghosts (petas) surrounds Rājagaha, and there, this Tapodā river flows between two great Lohakumbhī hells; therefore, it flows boiling.
Nghe nói, thành Rājagaha được bao quanh bởi một cõi ngạ quỷ lớn, và sông Tapodā này chảy qua giữa hai địa ngục Loha Kumbhī lớn; do đó, nước sông sôi sùng sục.
Vuttampi cetaṃ –
And it was also said:
Điều này cũng đã được nói:
‘‘Yatāyaṃ, bhikkhave, tapodā sandati, so daho acchodako sītodako sātodako setodako suppatittho ramaṇīyo pahūtamacchakacchapo, cakkamattāni ca padumāni pupphanti.
"Monks, the lake from which this Tapodā flows has clear, cool, sweet, and clean water, with good landing places, delightful, and abundant with fish and turtles, and lotuses the size of cartwheels bloom there. But, monks, this Tapodā river flows through the midst of two great hells; that is why this Tapodā flows boiling."
“Này các Tỷ-kheo, nơi sông Tapodā chảy ra, hồ nước đó trong sạch, mát lạnh, ngọt ngào, trắng tinh, có bến tắm tốt đẹp, đáng yêu, có nhiều cá và rùa, và hoa sen nở to bằng bánh xe.
Apicāyaṃ, bhikkhave, tapodā dvinnaṃ mahānirayānaṃ antarikāya āgacchati, tenāyaṃ tapodā kuthitā sandatī’’ti (pārā. 231).
Furthermore, bhikkhus, this Tapodā comes through the interval of two great hells; therefore, this Tapodā flows boiling."
Nhưng này các Tỷ-kheo, sông Tapodā này chảy qua giữa hai đại địa ngục, do đó sông Tapodā này sôi sùng sục.”
Samiddhīti tassa kira therassa attabhāvo samiddho abhirūpo pāsādiko, tasmā ‘‘samiddhī’’tveva saṅkhaṃ gato.
Samiddhī: It is said that the body of that elder was prosperous, handsome, and pleasing; therefore, he was known simply as "Samiddhi".
Samiddhi – nghe nói, thân thể của vị Trưởng lão ấy đầy đủ (samiddho), rất đẹp đẽ (abhirūpo), và đáng kính (pāsādiko); do đó, Ngài được gọi là “Samiddhi”.
Gattāni parisiñcitunti padhānikatthero esa, balavapaccūse uṭṭhāyāsanā sarīraṃ utuṃ gāhāpetvā bahi saṭṭhihatthamatte mahācaṅkame aparāparaṃ caṅkamitvā ‘‘sedagahitehi gattehi paribhuñjamānaṃ senāsanaṃ kilissatī’’ti maññamāno gattāni parisiñcanatthaṃ sarīradhovanatthaṃ upasaṅkami.
Gattāni parisiñcituṃ: This elder was one devoted to exertion. Having risen from his seat in the early morning, and after warming his body by closing doors to block the wind, he walked back and forth on a great walking path about sixty cubits long outside. Thinking, "the lodging used with a body soaked in sweat will become dirty", he approached to sprinkle his body, to wash his body.
Để dội nước lên thân – vị Trưởng lão này là một vị tu tập tinh cần. Ngài thức dậy vào lúc rạng đông, rời chỗ ngồi, để thân thể thích nghi với khí hậu, rồi đi kinh hành tới lui trên một con đường kinh hành lớn dài sáu mươi cubit bên ngoài. Nghĩ rằng “chỗ nằm sẽ bị dơ bẩn nếu dùng khi thân thể còn đẫm mồ hôi”, Ngài đến để dội nước lên thân, tức là để tắm rửa thân thể.
Ekacīvaro aṭṭhāsīti nivāsanaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ hatthena gahetvā aṭṭhāsi.
Ekacīvaro aṭṭhāsī: He stood wearing his lower robe, with his waist-band tied, holding his outer robe in his hand.
Đứng với một y – Ngài mặc y nội, thắt dây lưng, cầm y tăng-già-lê bằng tay và đứng.
Gattāni pubbāpayamānoti gattāni pubbasadisāni vodakāni kurumāno.
Gattāni pubbāpayamāno: Making his body dry and without water droplets, like before (i.e., before getting wet with sweat).
Làm cho thân khô ráo – làm cho thân thể không còn nước, như trạng thái trước khi có mồ hôi.
Allasarīre pārutaṃ hi cīvaraṃ kilissati duggandhaṃ hoti, na cetaṃ vattaṃ.
For a robe worn on a wet body becomes dirty and ill-smelling, and this is not proper observance.
Thật vậy, y bị mặc trên thân thể ướt sẽ bị dơ bẩn và có mùi hôi, điều này không đúng với bổn phận (vatta).
Thero pana vattasampanno, tasmā vatte ṭhitova nhāyitvā paccuttaritvā aṭṭhāsi.
But the elder was perfect in his observances; therefore, he bathed while adhering to the observances, came out of the water, and stood.
Nhưng vị Trưởng lão này là người đầy đủ bổn phận, do đó, Ngài đã tắm rửa và bước ra khỏi nước, đứng yên trong khi giữ bổn phận.
Tattha idaṃ nhānavattaṃ – udakatitthaṃ gantvā yattha katthaci cīvarāni nikkhipitvā vegena ṭhitakeneva na otaritabbaṃ, sabbadisā pana oloketvā vivittabhāvaṃ ñatvā khāṇugumbalatādīni vavatthapetvā tikkhattuṃ ukkāsitvā avakujja ṭhitena uttarāsaṅgacīvaraṃ apanetvā pasāretabbaṃ, kāyabandhanaṃ mocetvā cīvarapiṭṭheyeva ṭhapetabbaṃ.
This is the bathing observance: One should not hastily enter the water by simply discarding the robes wherever, but should first look in all directions, ascertain the seclusion of the place, identify any stumps, bushes, vines, etc., clear one's throat three times, then, stooping down, remove the upper robe and spread it out. The waist-band should be untied and placed directly on the robe.
Trong đó, đây là bổn phận khi tắm: không nên vội vàng xuống nước ngay sau khi đến bến nước và đặt y ở bất cứ đâu, mà nên nhìn khắp các hướng, biết được nơi vắng vẻ, ghi nhớ các gốc cây, bụi rậm, dây leo, v.v., hắng giọng ba lần, rồi cúi người xuống, cởi y thượng y ra và trải ra; tháo dây lưng và đặt ngay trên y.
Sace udakasāṭikā natthi, udakante ukkuṭikaṃ nisīditvā nivāsanaṃ mocetvā sace sinnaṭṭhānaṃ atthi, pasāretabbaṃ.
If there is no bathing cloth, one should sit squatting by the water's edge, remove the lower robe, and if there is a sweaty spot, it should be spread out.
Nếu không có y tắm, hãy ngồi xổm bên bờ nước, tháo y nội ra, nếu có chỗ bị ướt mồ hôi thì trải ra.
No ce atthi, saṃharitvā ṭhapetabbaṃ.
If there is no sweaty spot, it should be folded and kept aside.
Nếu không có, hãy gấp lại và đặt sang một bên.
Udakaṃ otarantena saṇikaṃ nābhippamāṇamattaṃ otaritvā vīciṃ anuṭṭhāpentena saddaṃ akarontena nivattitvā āgatadisābhimukhena nimujjitabbaṃ, evaṃ cīvaraṃ rakkhitaṃ hoti.
When entering the water, one should descend slowly, only to the depth of the navel, without causing ripples, without making noise, and then, turning around to face the direction from which one came, immerse oneself. In this way, the robe is protected.
Khi xuống nước, nên từ từ xuống đến ngang rốn, không làm nổi sóng, không gây tiếng động, quay lại và lặn xuống hướng về phía mình đã đến; làm như vậy, y sẽ được bảo vệ.
Ummujjantenapi saddaṃ akarontena saṇikaṃ ummujjitvā nhānapariyosāne udakante ukkuṭikena nisīditvā nivāsanaṃ parikkhipitvā uṭṭhāya suparimaṇḍalaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ apārupitvāva ṭhātabbanti.
When emerging, one should also do so slowly and without making noise, and at the end of the bath, sit squatting by the water's edge, wrap the lower robe around, stand up, put on the lower robe neatly, tie the waist-band, and then stand with the outer robe put on.
Khi nổi lên cũng không gây tiếng động, từ từ nổi lên, sau khi tắm xong, ngồi xổm bên bờ nước, quấn y nội, đứng dậy, mặc y một cách ngay ngắn, thắt dây lưng, và chỉ nên đứng sau khi đã đắp y tăng-già-lê.
Theropi tathā nhāyitvā paccuttaritvā vigacchamānaudakaṃ kāyaṃ olokayamāno aṭṭhāsi.
The elder also bathed in this way, came out of the water, and stood watching his body as the water receded.
Vị Trưởng lão cũng đã tắm như vậy, rồi bước ra khỏi nước, đứng nhìn thân thể khô dần.
Tassa pakatiyāpi pāsādikassa paccūsasamaye sammā pariṇatāhārassa uṇhodakena nhātassa ativiya mukhavaṇṇo viroci, bandhanā pavuttatālaphalaṃ viya pabhāsampanno puṇṇacando viya taṅkhaṇavikasitapadumaṃ viya mukhaṃ sassirikaṃ ahosi, sarīravaṇṇopi vippasīdi.
His naturally pleasing countenance, after a proper meal in the early morning and a bath with hot water, shone exceedingly. His face was radiant, like a lustrous fully-risen moon, or a freshly bloomed lotus that had burst from its sheath, and his body's complexion also brightened.
Vốn dĩ Ngài đã có vẻ ngoài đoan trang, vào lúc rạng đông, sau khi đã tiêu hóa tốt thức ăn và tắm nước ấm, sắc mặt Ngài càng rạng rỡ hơn; khuôn mặt Ngài trở nên tươi tắn như một quả cau vừa rụng khỏi cuống, rạng ngời như trăng tròn, như hoa sen vừa nở, và sắc thân Ngài cũng trở nên trong sáng.
Tasmiṃ samaye vanasaṇḍe adhivatthā bhummadevatā pāsādikaṃ bhikkhuṃ olokayamānā samanaṃ niggahetuṃ asakkontī kāmapariḷāhābhibhūtā hutvā, ‘‘theraṃ palobhessāmī’’ti attabhāvaṃ uḷārena alaṅkārena alaṅkaritvā sahassavaṭṭipadīpaṃ pajjalamānā viya candaṃ uṭṭhāpayamānā viya sakalārāmaṃ ekobhāsaṃ katvā theraṃ upasaṅkamitvā avanditvāva vehāse ṭhitā gāthaṃ abhāsi.
At that time, a forest-dwelling earth devatā, looking at the pleasing bhikkhu, and being unable to subdue the recluse, became overcome by the burning of sensual desire, and thinking, "I will entice the elder," adorned herself with splendid ornaments, and like a lamp with a thousand wicks, or like raising the moon, she illuminated the entire monastery, approached the elder, and without venerating him, stood in the air and spoke a stanza.
Vào lúc đó, một vị địa thiên nữ sống trong khu rừng, nhìn thấy vị Tỷ-kheo đoan trang, không thể chế ngự được mình, bị dục vọng thiêu đốt, bèn nghĩ: “Ta sẽ cám dỗ vị Trưởng lão này.” Vị ấy trang điểm thân mình bằng những đồ trang sức lộng lẫy, như ngọn đèn ngàn bấc đang cháy sáng, như mặt trăng đang mọc, làm cho cả khu rừng sáng rực, rồi đến gần vị Trưởng lão, không đảnh lễ mà đứng trên không trung và nói lên bài kệ.
Tena vuttaṃ – ‘‘atha kho aññatarā devatā…pe… ajjhabhāsī’’ti.
Therefore, it is said: "Then a certain devatā…pe… addressed him."
Do đó, đã nói: “Rồi một vị thiên nữ… và… đã nói.”
Abhutvāti pañca kāmaguṇe aparibhuñjitvā.
Abhutvā means without enjoying the five sense pleasures.
Abhutvā có nghĩa là không thọ hưởng năm dục lạc.
Bhikkhasīti piṇḍāya carasi.
Bhikkhasī means you wander for alms.
Bhikkhasī có nghĩa là đi khất thực.
Mā taṃ kālo upaccagāti ettha kālo nāma pañcakāmaguṇapaṭisevanakkhamo daharayobbanakālo.
Regarding the phrase, " Mā taṃ kālo upaccagā," the word kālo refers to the time of youthful vigor, which is suitable for enjoying the five sense pleasures.
Ở đây, cụm từ mā taṃ kālo upaccagā có nghĩa là thời gian, tức là thời tuổi trẻ sung mãn, có thể thọ hưởng năm dục lạc.
Jarājiṇṇena hi obhaggena daṇḍaparāyaṇena pavedhamānena kāsasāsābhibhūtena na sakkā kāme paribhuñjituṃ.
Indeed, one who is old and decrepit, bent, dependent on a staff, trembling, and afflicted by cough and asthma, cannot enjoy sense pleasures.
Thật vậy, khi đã già nua, lưng còng, phải nương tựa vào gậy, run rẩy, bị ho hen và khó thở hành hạ, thì không thể thọ hưởng dục lạc được.
Iti imaṃ kālaṃ sandhāya devatā ‘‘mā taṃ kālo upaccagā’’ti āha.
It is with this time in mind that the deity said, "May this time not pass you by."
Vì vậy, vị devatā đã nói câu này, ám chỉ thời gian đó: “Thời gian đừng vượt qua ngươi.”
Tattha mā upaccagāti mā atikkami.
There, mā upaccagā means may it not pass by.
Trong đó, mā upaccagā có nghĩa là đừng vượt qua.
Tattha jīvitaṃ tāva ‘‘ettakameva, na ito para’’nti vavatthānābhāvato animittaṃ.
First, life is without sign, because there is no definite demarcation like "only this long, not beyond this."
Năm điều này trong thế gian chúng sinh, không có dấu hiệu, không thể biết trước.”
Kalalakālepi hi sattā maranti, abbuda-pesi-ghana-aḍḍhamāsa-ekamāsa-dvemāsa-temāsa-catumāsapañcamāsa…pe… dasamāsakālepi, kucchito nikkhantasamayepi, tato paraṃ vassasatassa antopi bahipi marantiyeva.
Indeed, beings die even in the kalala (fluid) stage, and in the abbuda (gelatinous), pesi (flesh), ghana (solid) stages, at one and a half months, one month, two months, three months, four months, five months… up to ten months, even at the time of emerging from the womb, and beyond that, within or outside of a hundred years, they still die.
Trong đó, jīvitaṃ (tuổi thọ) là vô tướng vì không có giới hạn “chỉ đến đây, không hơn nữa”. Thật vậy, chúng sinh chết ngay cả khi còn là hợp chất (kalala), khi là bọt (abbuda), khi là thịt (pesi), khi là khối cứng (ghana), khi được nửa tháng, một tháng, hai tháng, ba tháng, bốn tháng, năm tháng... cho đến mười tháng, ngay cả khi vừa ra khỏi bụng mẹ, và sau đó trong vòng một trăm năm hoặc hơn nữa, họ vẫn chết.
Byādhipi ‘‘imināva byādhinā sattā maranti, na aññenā’’ti vavatthānābhāvato animitto.
Illness is also without sign, because there is no definite demarcation like "beings die only from this illness, not from another."
Byādhi (bệnh tật) cũng là vô tướng vì không có giới hạn “chúng sinh chết vì bệnh này chứ không phải bệnh khác”.
Cakkhurogenapi hi sattā maranti sotarogādīnaṃ aññatarenapi.
Indeed, beings die even from eye diseases, or from any other ailment like ear diseases and so on.
Thật vậy, chúng sinh chết vì bệnh mắt hoặc bất kỳ bệnh nào khác như bệnh tai, v.v.
Kālopi, ‘‘imasmiṃ yeva kāle maritabbaṃ, na aññasmi’’nti evaṃ vavatthānābhāvato animitto.
Time is also without sign, because there is no definite demarcation like "one must die only at this time, not at another."
Kālo (thời gian) cũng là vô tướng vì không có giới hạn “phải chết vào thời điểm này chứ không phải thời điểm khác”.
Pubbaṇhepi hi sattā maranti majjhanhikādīnaṃ aññatarasmimpi.
Indeed, beings die even in the forenoon, or at any other time like midday and so on.
Thật vậy, chúng sinh chết vào buổi sáng hoặc vào bất kỳ thời điểm nào khác như buổi trưa, v.v.
Dehanikkhepanampi, ‘‘idheva mīyamānānaṃ dehena patitabbaṃ, na aññatthā’’ti evaṃ vavatthānābhāvato animittaṃ.
The laying down of the body is also without sign, because there is no definite demarcation like "the body of those dying must fall only here, not elsewhere."
Dehanikkhepana (nơi thân thể bị vứt bỏ) cũng là vô tướng vì không có giới hạn “khi chết, thân thể phải rơi ở đây chứ không phải ở nơi khác”.
Antogāme jātānañhi bahigāmepi attabhāvo patati, bahigāmepi jātānaṃ antogāmepi.
Indeed, for those born inside a village, their body may fall outside the village; and for those born outside a village, their body may fall inside the village.
Thật vậy, những người sinh ra trong làng cũng có thể chết bên ngoài làng, và những người sinh ra bên ngoài làng cũng có thể chết trong làng.
Tathā thalajānaṃ jale, jalajānaṃ thaleti anekappakārato vitthāretabbaṃ.
Similarly, for those born on land, in water; for those born in water, on land; this should be elaborated in many ways.
Tương tự, những sinh vật trên cạn chết dưới nước, những sinh vật dưới nước chết trên cạn, v.v., cần được giải thích theo nhiều cách khác nhau.
Gatipi, ‘‘ito cutena idha nibbattitabba’’nti evaṃ vavatthānābhāvato animittā.
Destiny is also without sign, because there is no definite demarcation like "having passed away from here, one must be reborn there."
Gati (cõi tái sinh) cũng là vô tướng vì không có giới hạn “sau khi chết ở đây, phải tái sinh ở đây”.
Devalokato hi cutā manussesupi nibbattanti, manussalokato cutā devalokādīnaṃ yattha katthaci nibbattantīti evaṃ yante yuttagoṇo viya gatipañcake loko samparivattati.
Indeed, those who pass away from the deva world are reborn among humans; those who pass away from the human world are reborn anywhere among the deva worlds and so on; thus, the world revolves in the five destinies like an ox yoked to a mill.
Thật vậy, chúng sinh sau khi chết từ cõi trời cũng tái sinh làm người, và sau khi chết từ cõi người cũng tái sinh ở bất cứ đâu trong các cõi trời, v.v., như một con bò được buộc vào cỗ xe, thế gian xoay vần trong năm cõi tái sinh.
Tassevaṃ samparivattato ‘‘imasmiṃ nāma kāle maraṇaṃ bhavissatī’’ti imaṃ maraṇassa kālaṃ vohaṃ na jānāmi.
Because it revolves in this way, I do not know this time of death, when death will occur.
Khi thế gian xoay vần như vậy, tôi không biết thời điểm chết này, tức là “cái chết sẽ xảy ra vào thời điểm nào”.
Channo kālo na dissatīti ayaṃ kālo mayhaṃ paṭicchanno avibhūto na paññāyati.
" Channo kālo na dissatī" means this time is hidden from me, not manifest, not discernible.
Channo kālo na dissatī có nghĩa là thời điểm này đối với tôi bị che khuất, không rõ ràng, không thể nhận biết.
Tasmāti yasmā ayaṃ kālo paṭicchanno na paññāyati, tasmā pañca kāmaguṇe abhutvāva bhikkhāmi.
Tasmā means, because this time is hidden and not discernible, therefore I wander for alms without enjoying the five sense pleasures.
Tasmā có nghĩa là vì thời điểm này bị che khuất và không thể nhận biết, nên tôi đi khất thực mà không thọ hưởng năm dục lạc.
Mā maṃ kālo upaccagāti ettha samaṇadhammakaraṇakālaṃ sandhāya ‘‘kālo’’ti āha.
In the phrase, " Mā maṃ kālo upaccagā," kālo refers to the time for practicing the ascetic life (samaṇadhamma).
Trong đó, cụm từ mā maṃ kālo upaccagā, “kālo” (thời gian) ám chỉ thời điểm thực hành pháp Sa-môn.
Ayañhi samaṇadhammo nāma pacchime kāle tisso vayosīmā atikkantena obhaggena daṇḍaparāyaṇena pavedhamānena kāsasāsābhibhūtena na sakkā kātuṃ.
Indeed, this samaṇadhamma cannot be practiced in old age, when one has passed beyond the three stages of life, is bent, dependent on a staff, trembling, and afflicted by cough and asthma.
Thật vậy, pháp Sa-môn này không thể thực hành được khi đã ở tuổi xế chiều, vượt qua ba giai đoạn của tuổi thọ, lưng còng, phải nương tựa vào gậy, run rẩy, bị ho hen và khó thở hành hạ.
Tadā hi na sakkā hoti icchiticchitaṃ buddhavacanaṃ vā gaṇhituṃ, dhutaṅgaṃ vā paribhuñjituṃ, araññavāsaṃ vā vasituṃ, icchiticchitakkhaṇe samāpattiṃ vā samāpajjituṃ, padabhāṇa-sarabhaññadhammakathā-anumodanādīni vā kātuṃ, taruṇayobbanakāle panetaṃ sabbaṃ sakkā kātunti ayaṃ samaṇadhammakaraṇassa kālo mā maṃ upaccagā, yāva maṃ nātikkamati, tāva kāme abhutvāva samaṇadhammaṃ karomīti āha.
For then it is not possible to learn as much of the Buddha's words as one desires, nor to observe the dhutaṅgas, nor to dwell in the forest, nor to enter into samāpatti at will, nor to perform recitations (padabhāṇa), melodious chanting (sarabhañña), Dhamma talks, or rejoice at merits. But all this is possible in youthful vigor. Therefore, he said, "May this time for practicing the samaṇadhamma not pass me by; as long as it has not passed me by, I will practice the samaṇadhamma without enjoying sense pleasures."
Vì lúc đó không thể học được những lời Phật dạy mong muốn, không thể thực hành các pháp đầu đà (dhutaṅga), không thể sống trong rừng, không thể nhập định vào thời điểm mong muốn, cũng không thể thực hiện các bài tụng (padabhāṇa), tụng thơ (sarabhañña), thuyết pháp (dhammakathā), tùy hỷ (anumodanā), v.v. Nhưng tất cả những điều này đều có thể thực hiện được khi còn trẻ và sung sức. Vì vậy, vị Tỳ-kheo nói rằng: “Thời điểm thực hành pháp Sa-môn này đừng vượt qua tôi; chừng nào nó chưa vượt qua tôi, tôi sẽ thực hành pháp Sa-môn mà không thọ hưởng dục lạc.”
Pathaviyaṃ patiṭṭhahitvāti sā kira devatā – ‘‘ayaṃ bhikkhu samaṇadhammakaraṇassa kālaṃ nāma katheti, akālaṃ nāma katheti, sahetukaṃ katheti sānisaṃsa’’nti ettāvatāva there lajjaṃ paccupaṭṭhāpetvā mahābrahmaṃ viya aggikkhandhaṃ viya ca naṃ maññamānā gāravajātā ākāsā oruyha pathaviyaṃ aṭṭhāsi, taṃ sandhāyetaṃ vuttaṃ.
" Pathaviyaṃ patiṭṭhahitvā" means that deity, having realized that "this bhikkhu speaks of the proper time for practicing samaṇadhamma, and of the improper time, speaks with reason and with benefit," and having thus caused shame to arise in the Elder, descended from the sky and stood on the ground, revering him as if he were a Mahābrahmā or a blazing fire, referring to which this was said.
Pathaviyaṃ patiṭṭhahitvā (đứng trên mặt đất) có nghĩa là vị devatā đó, sau khi khiến vị Trưởng lão cảm thấy hổ thẹn bằng lời nói “Vị Tỳ-kheo này nói về thời điểm thực hành pháp Sa-môn, nói về thời điểm không thực hành, nói về nguyên nhân và lợi ích”, đã coi vị Trưởng lão như Đại Phạm Thiên hay một khối lửa, và với lòng tôn kính, đã từ trên không trung hạ xuống đứng trên mặt đất. Lời này được nói để ám chỉ điều đó.
Kiñcāpi pathaviyaṃ ṭhitā, yena panatthena āgatā, punapi tameva gahetvā daharo tvantiādimāha.
Although she stood on the ground, she took up her original intention and spoke again, starting with, " Daharo tvaṃ" (You are young).
Mặc dù đã đứng trên mặt đất, nhưng vị ấy vẫn giữ nguyên ý định ban đầu và tiếp tục nói: daharo tvaṃ (ngươi còn trẻ), v.v.
Tattha susūti taruṇo.
There, susū means very young.
Trong đó, susū có nghĩa là trẻ trung.
Kāḷakesoti suṭṭhu kāḷakeso.
Kāḷakeso means with very black hair.
Kāḷakeso có nghĩa là tóc đen nhánh.
Bhadrenāti bhaddakena.
Bhadrenā means with a beautiful (youth).
Bhadrenā có nghĩa là tốt lành.
Ekacco hi daharopi samāno kāṇo vā hoti kuṇiādīnaṃ vā aññataro, so bhadrena yobbanena samannāgato nāma na hoti.
For some, even though young, may be blind or afflicted by some other disability like a hunchback; such a one is not endowed with beautiful youth.
Thật vậy, có người dù còn trẻ nhưng lại bị mù hoặc bị tật nguyền, v.v., người đó không được xem là có tuổi trẻ tốt lành.
Yo pana abhirūpo hoti dassanīyo pāsādiko sabbasampattisampanno, yaṃ yadeva alaṅkāraparihāraṃ icchati, tena tena alaṅkato devaputto viya carati, ayaṃ bhadrena yobbanena samannāgato nāma hoti.
But one who is handsome, delightful, pleasing, endowed with all perfections, and adorns themselves as they wish with various ornaments and embellishments, walking like a divine prince, such a one is said to be endowed with beautiful youth.
Nhưng người nào có hình dáng đẹp đẽ, đáng chiêm ngưỡng, dễ thương, đầy đủ mọi phước lành, và muốn trang sức hay chăm sóc bản thân thế nào cũng được, trang điểm như một vị thiên tử, người đó được xem là có tuổi trẻ tốt lành.
Thero ca uttamarūpasampanno, tena naṃ evamāha.
The Elder was endowed with supreme beauty, therefore she spoke to him thus.
Vị Trưởng lão có hình dáng tối thượng, vì vậy vị devatā đã nói với ngài như vậy.
Anikkīḷitāvī kāmesūti kāmesu akīḷitakīḷo abhuttāvī, akatakāmakīḷoti attho.
" Anikkīḷitāvī kāmesū" means one who has not played in sense pleasures, has not experienced them, has not engaged in sensual play; this is the meaning.
Anikkīḷitāvī kāmesu có nghĩa là chưa từng vui đùa trong dục lạc, chưa từng thọ hưởng, chưa từng thực hiện trò chơi dục lạc.
Mā sandiṭṭhikaṃ hitvāti yebhuyyena hi tā adiṭṭhasaccā avītarāgā aparacittavidūniyo devatā bhikkhū dasapi vassāni vīsatimpi…pe… saṭṭhimpi vassāni parisuddhaṃ akhaṇḍaṃ brahmacariyaṃ caramāne disvā – ‘‘ime bhikkhū mānusake pañca kāmaguṇe pahāya dibbe kāme patthayantā samaṇadhammaṃ karontī’’ti saññaṃ uppādenti, ayampi tattheva uppādesi.
" Mā sandiṭṭhikaṃ hitvā" means that mostly these deities, who have not realized the truths, are not free from craving, and do not know the minds of others, when they see bhikkhus practicing the pure, unbroken holy life for ten, twenty... even sixty years, they generate the perception that "these bhikkhus abandon human sense pleasures, desiring divine pleasures, and thus practice the samaṇadhamma." This deity also generated the same perception.
Mā sandiṭṭhikaṃ hitvā (Đừng từ bỏ cái hiện tại) – Thật vậy, hầu hết các vị devatā chưa thấy chân lý, chưa thoát ly tham ái, và không biết tâm người khác, khi thấy các Tỳ-kheo thực hành Phạm hạnh thanh tịnh, không gián đoạn trong mười năm, hai mươi năm... cho đến sáu mươi năm, họ nghĩ rằng: “Các Tỳ-kheo này từ bỏ năm dục lạc của loài người, mong cầu dục lạc của chư thiên mà thực hành pháp Sa-môn.” Vị devatā này cũng nảy sinh suy nghĩ tương tự.
Tasmā mānusake kāme sandiṭṭhike, dibbe ca kālike katvā evamāha.
Therefore, making human pleasures "directly visible" (sandiṭṭhika) and divine pleasures "temporal" (kālika), she spoke thus.
Vì vậy, vị ấy coi dục lạc của loài người là sandiṭṭhika (hiện tại) và dục lạc của chư thiên là kālika (tương lai), rồi nói như vậy.
Na kho ahaṃ, āvusoti, āvuso, ahaṃ sandiṭṭhike kāme hitvā kālike kāme na anudhāvāmi na patthemi na pihemi.
" Na kho ahaṃ, āvuso" means, friend, I do not pursue, do not desire, do not long for temporal pleasures, having abandoned directly visible pleasures.
Na kho ahaṃ, āvuso (Này hiền giả, tôi không) – Này hiền giả, tôi không từ bỏ dục lạc hiện tại để theo đuổi, mong cầu hay yêu thích dục lạc tương lai.
Kalikañca kho ahaṃ, āvusoti ahaṃ kho, āvuso, kālikaṃ kāmaṃ hitvā sandiṭṭhikaṃ lokuttaradhammaṃ anudhāvāmi.
" Kalikañca kho ahaṃ, āvuso" means, friend, having abandoned temporal pleasures, I pursue directly visible supramundane Dhamma.
Kalikañca kho ahaṃ, āvuso (Này hiền giả, tôi từ bỏ cái tương lai) – Này hiền giả, tôi từ bỏ dục lạc tương lai để theo đuổi pháp siêu thế hiện tại.
Iti thero cittānantaraṃ aladdhabbatāya dibbepi mānusakepi pañca kāmaguṇe kālikāti akāsi, cittānantaraṃ laddhabbatāya lokuttaradhammaṃ sandiṭṭhikanti.
Thus, the Elder referred to both divine and human sense pleasures as " kālikā" (temporal) due to their not being attainable immediately after a thought, and the supramundane Dhamma as " sandiṭṭhika" (directly visible) due to its attainability immediately after a thought.
Như vậy, vị Trưởng lão đã gọi năm dục lạc của cả cõi trời và cõi người là kālika (tương lai) vì chúng không thể đạt được ngay lập tức sau khi tâm mong muốn khởi lên, và gọi pháp siêu thế là sandiṭṭhika (hiện tại) vì nó có thể đạt được ngay lập tức sau khi tâm mong muốn khởi lên.
Pañcakāmaguṇesu samohitesupi sampannakāmassāpi kāmino cittānantaraṃ icchiticchitārammaṇānubhavanaṃ na sampajjati.
Even for a person replete with sensual enjoyment, though sense pleasures may be accumulated, the experience of desired objects is not achieved immediately after a thought.
Ngay cả khi năm dục lạc được hội tụ đầy đủ, một người khao khát dục lạc cũng không thể trải nghiệm đối tượng mong muốn ngay lập tức sau khi tâm khởi lên.
Cakkhudvāre iṭṭhārammaṇaṃ anubhavitukāmena hi cittakārapotthakārarūpakārādayo pakkosāpetvā, ‘‘idaṃ nāma sajjethā’’ti vattabbaṃ hoti.
Indeed, one who wishes to experience a desirable object through the eye-door must summon painters, sculptors, artisans, etc., and instruct them, "Prepare such and such a thing."
Thật vậy, một người muốn trải nghiệm đối tượng khả ái qua nhãn môn phải gọi thợ vẽ, thợ điêu khắc, thợ tạo hình, v.v., và nói: “Hãy sắp đặt điều này.”
Etthantare anekakoṭisatasahassāni cittāni uppajjitvā nirujjhanti.
In the meantime, hundreds of thousands of crores of thoughts arise and cease.
Trong khoảng thời gian đó, hàng trăm ngàn vạn tâm đã sinh khởi rồi diệt đi.
Atha pacchā taṃ ārammaṇaṃ sampāpuṇāti.
Then, only afterwards, does that object arrive.
Sau đó, đối tượng đó mới được đạt đến.
Sesadvāresupi eseva nayo.
The same method applies to the other doors (senses).
Đối với các môn khác cũng vậy.
Sotāpattimaggānantaraṃ pana sotāpattiphalameva uppajjati, antarā aññassa cittassa vāro natthi.
However, immediately after the path of stream-entry (sotāpattimagga), the fruit of stream-entry (sotāpattiphala) itself arises; there is no interval for any other thought.
Tuy nhiên, ngay sau Sơ đạo (Sotāpattimagga), Sơ quả (Sotāpattiphala) liền sinh khởi, không có tâm nào khác xen vào giữa.
Sesaphalesupi eseva nayoti.
The same method applies to the other fruits.
Đối với các quả vị còn lại cũng vậy. Đó là ý nghĩa.
So tamevatthaṃ gahetvā kālikā hi, āvusotiādimāha.
Taking this very meaning, he said, " Kālikā hi, āvuso," and so on.
Vị ấy đã nắm bắt ý nghĩa đó và nói: kālikā hi, āvuso, v.v.
Tattha kālikāti vuttanayena samohitasampattināpi kālantare pattabbā.
There, kālikā means attainable after a period of time, even for one with accumulated perfections, as explained.
Trong đó, kālikā (tương lai) có nghĩa là phải đạt được vào một thời điểm khác, ngay cả với sự hội tụ đầy đủ như đã nói.
Bahudukkhāti pañca kāmaguṇe nissāya pattabbadukkhassa bahutāya bahudukkhā.
Bahudukkhā means having much suffering, due to the abundance of suffering to be experienced dependent on the five sense pleasures.
Bahudukkhā (nhiều khổ đau) có nghĩa là nhiều khổ đau vì khổ đau phải chịu đựng do năm dục lạc là rất nhiều.
Taṃvatthukasseva upāyāsassa bahutāya bahupāyāsā.
The state of having many struggles (bahupāyāsā) because of the abundance of severe weariness, which has that same suffering as its basis.
Do sự phiền não (upāyāsa) có cùng một đối tượng (vatthu) ấy rất nhiều nên được gọi là nhiều phiền não (bahupāyāsā).
Ādīnavo ettha bhiyyoti pañca kāmaguṇe nissāya laddhabbasukhato ādīnavo bhiyyo, dukkhameva bahutaranti attho.
More disadvantage here means that the disadvantage is greater than the happiness to be gained by relying on the five sense pleasures, meaning that suffering is much more abundant.
Sự nguy hiểm ở đây nhiều hơn có nghĩa là: sự nguy hiểm nhiều hơn so với lạc thú có được nhờ nương tựa năm dục lạc, tức là khổ đau nhiều hơn.
Sandiṭṭhiko ayaṃ dhammoti ayaṃ lokuttaradhammo yena yena adhigato hoti, tena tena parasaddhāya gantabbataṃ hitvā paccavekkhaṇañāṇena sayaṃ daṭṭhabboti sandiṭṭhiko.
This Dhamma is directly visible (sandiṭṭhika) means that this supramundane Dhamma, by whomever it is attained, should be seen by that person himself with the knowledge of review (paccavekkhaṇañāṇa), abandoning the need to go by the faith of another. Hence, it is sandiṭṭhika.
Pháp này thiết thực hiện tại (sandiṭṭhiko ayaṃ dhammo) là: Pháp siêu thế này, do vị nào chứng đắc, vị ấy tự mình phải thấy bằng tuệ quán xét, bỏ qua việc phải đi theo niềm tin của người khác, nên gọi là thiết thực hiện tại (sandiṭṭhiko).
Attano phaladānaṃ sandhāya nāssa kāloti akālo, akāloyeva akāliko.
Regarding its fruit-giving, there is no time for it (nāssa kālo), thus it is timeless (akālo); this timelessness itself is immediate (akāliko).
Không có thời gian (kāla) để tự mình mang lại quả, nên không có thời gian, chính là không có thời gian (akāliko).
Yo ettha ariyamaggadhammo, so attano pavattisamanantarameva phalaṃ detīti attho.
The meaning is that the noble path Dhamma here yields its fruit immediately after its arising.
Pháp Thánh đạo ở đây, tức là tự nó mang lại quả ngay sau khi phát sinh.
‘‘Ehi passa imaṃ dhamma’’nti evaṃ pavattaṃ ehipassavidhiṃ arahatīti ehipassiko.
It is inviting to come and see (ehipassiko) because it is worthy of the "come and see this Dhamma" method of proclamation.
Nó xứng đáng với lời mời gọi “Hãy đến mà thấy pháp này” như vậy, nên gọi là đến để mà thấy (ehipassiko).
Ādittaṃ celaṃ vā sīsaṃ vā ajjhupekkhitvāpi bhāvanāvasena attano citte upanayaṃ arahatīti opaneyyiko.
It is leading inwards (opaneyyiko) because it is worthy of being brought into one's own mind through meditation, even after neglecting a burning cloth or a burning head.
Nó xứng đáng được đưa vào tâm mình bằng cách tu tập, thậm chí bỏ qua chiếc y đang cháy hoặc cái đầu đang cháy, nên gọi là có khả năng hướng thượng (opaneyyiko).
Sabbehi ugghaṭitaññūādīhi viññūhi ‘‘bhāvito me maggo, adhigataṃ phalaṃ, sacchikato nirodho’’ti attani attani veditabboti paccattaṃ veditabbo viññūhīti.
It is to be personally experienced by the wise (paccattaṃ veditabbo viññūhi), for all the wise, such as the ugghaṭitaññū, should know for themselves: "The path has been cultivated by me, the fruit has been attained, Nibbāna has been realized."
Tất cả những người trí, như bậc ugghaṭitaññū và những người khác, đều phải tự mình biết rằng: “Đạo đã được tôi tu tập, quả đã được tôi chứng đắc, Niết bàn đã được tôi thực chứng”, nên gọi là người trí tự mình chứng biết (paccattaṃ veditabbo viññūhī).
Ayamettha saṅkhepo, vitthāro pana visuddhimagge (visuddhi. 1.146 ādayo) dhammānussativaṇṇanāyaṃ vutto.
This is the brief explanation here; the detailed account is given in the description of Dhammānussati in the Visuddhimagga.
Đây là phần tóm tắt, còn phần chi tiết đã được trình bày trong phần giải thích về Tùy niệm Pháp (Dhammānussati) trong bộ Thanh Tịnh Đạo (Visuddhimagga).
Idāni sā devatā andho viya rūpavisesaṃ therena kathitassa atthe ajānantī kathañca bhikkhūtiādimāha.
Now, that deity, like a blind person unaware of special forms, not understanding the meaning of what the Elder had spoken, said: And how, bhikkhu? and so forth.
Bây giờ, vị thiên nữ ấy, giống như người mù không hiểu được ý nghĩa của những gì vị Trưởng lão đã nói về sự đặc biệt của sắc, đã nói câu “Bạch Tỳ-kheo, như thế nào…” và những câu tương tự.
Tattha kathañcātipadassa ‘‘kathañca bhikkhu kālikā kāmā vuttā bhagavatā, kathaṃ bahudukkhā, kathaṃ bahupāyāsā’’ti?
Here, the word kathañcāti (and how) should be understood as connected with all the words thus: "And how, bhikkhu, were sensual pleasures said by the Blessed One to be kālika, how to be full of suffering, how to be full of struggle?"
Trong đó, từ “kathañcā” phải được hiểu là: “Bạch Tỳ-kheo, Đức Thế Tôn đã nói các dục là kālika (có thời gian) như thế nào? Chúng nhiều khổ như thế nào? Chúng nhiều phiền não như thế nào?”
Evaṃ sabbapadehi sambandho veditabbo.
This connection should be understood with all the terms.
Như vậy, phải hiểu sự liên kết với tất cả các từ.
Navopi ekacco sattaṭṭhavassakāle pabbajitvā dvādasaterasavassāni sāmaṇerabhāveneva atikkanto cirapabbajito hoti, ahaṃ pana acirapabbajitoti vadati.
Even a new bhikkhu, having gone forth at seven or eight years of age, and having spent twelve or thirteen years as a sāmaṇera, may be long-ordained. But I am not long-ordained, he says.
Một số Tỳ-kheo mới, dù xuất gia từ bảy, tám tuổi, nhưng đã trải qua mười hai, mười ba năm trong thân phận Sa-di, nên là người xuất gia lâu năm. Còn tôi thì mới xuất gia, vị ấy nói.
Imaṃ dhammavinayanti imaṃ dhammañca vinayañca.
This Dhamma-Vinaya means this Dhamma and this Vinaya.
Pháp và Luật này (imaṃ dhammavinayaṃ): Pháp này và Luật này.
Ubhayampetaṃ sāsanasseva nāmaṃ.
Both of these are names for the Dispensation itself.
Cả hai điều này đều là tên gọi của Giáo pháp.
Dhammena hettha dve piṭakāni vuttāni, vinayena vinayapiṭakaṃ, iti tīhi piṭakehi pakāsitaṃ paṭipattiṃ adhunā āgatomhīti vadati.
Here, Dhamma refers to the two Piṭakas, and Vinaya refers to the Vinaya Piṭaka. Thus, he says, "I have recently come to this practice (paṭipatti) proclaimed by the three Piṭakas."
Ở đây, Pháp (Dhamma) được nói đến là hai Tạng (Sutta và Abhidhamma), Luật (Vinaya) là Tạng Luật (Vinayapiṭaka). Như vậy, vị ấy nói: “Tôi mới đến với sự thực hành được công bố bởi ba Tạng.”
Akkheyyasaññinoti ettha ‘‘devo, manusso, gahaṭṭho, pabbajito, satto, puggalo, tisso, phusso’’tiādinā nayena akkheyyato sabbesaṃ akkhānānaṃ sabbāsaṃ kathānaṃ vatthubhūtato pañcakkhandhā ‘‘akkheyyā’’ti vuccanti.
Here, in akkheyyasaññino (perceiving what can be expressed), the five aggregates are called "akkheyyā" (what can be expressed) because they are the basis for all designations and all talks, such as "deva, human, householder, renunciant, being, person, Tissa, Phussa," and so forth.
Trong từ “akkheyyasaññino” này, năm uẩn được gọi là “akkheyya” (đối tượng để gọi) vì chúng là đối tượng của tất cả các cách gọi, của tất cả các lời nói theo cách như: “chư thiên, loài người, gia chủ, xuất gia, chúng sanh, cá nhân, Tissa, Phussa,” v.v.
‘‘Satto naro poso puggalo itthī puriso’’ti evaṃ saññā etesaṃ atthīti saññino, akkheyyesveva saññinoti akkheyyasaññino, pañcasu khandhesu sattapuggalādisaññinoti attho.
They have the perception "being, man, person, individual, woman, man," and so forth; thus, they are saññino (perceiving). They are akkheyyasaññino (perceiving what can be expressed) because they perceive only in terms of what can be expressed, meaning they perceive beings, individuals, and so forth, in the five aggregates.
Họ có nhận thức (saññā) như “chúng sanh, người, cá nhân, đàn bà, đàn ông,” v.v., nên gọi là saññino (người có nhận thức); họ có nhận thức chỉ trong các akkheyya, nên gọi là akkheyyasaññino, nghĩa là họ có nhận thức về chúng sanh, cá nhân, v.v., trong năm uẩn.
Akkheyyasmiṃ patiṭṭhitāti pañcasu khandhesu aṭṭhahākārehi patiṭṭhitā.
Established in what can be expressed (akkheyyasmiṃ patiṭṭhitā) means established in the five aggregates by eight modes.
An trú trong akkheyya (akkheyyasmiṃ patiṭṭhitā): An trú trong năm uẩn bằng tám cách.
Ratto hi rāgavasena patiṭṭhito hoti, duṭṭho dosavasena, mūḷho mohavasena, parāmaṭṭho diṭṭhivasena, thāmagato anusayavasena, vinibaddho mānavasena, aniṭṭhaṅgato vicikicchāvasena, vikkhepagato uddhaccavasena patiṭṭhito hoti.
One who is infatuated (ratto) is established by way of passion (rāga); one who is malicious (duṭṭho) is established by way of hatred (dosa); one who is deluded (mūḷho) is established by way of delusion (moha); one who grasps (parāmaṭṭho) is established by way of wrong view (diṭṭhi); one who is firmly rooted (thāmagato) is established by way of underlying tendencies (anusaya); one who is bound (vinibaddho) is established by way of conceit (māna); one who is uncertain (aniṭṭhaṅgato) is established by way of doubt (vicikicchā); one who is distracted (vikkhepagato) is established by way of restlessness (uddhacca).
Thật vậy, người tham đắm an trú theo cách tham ái; người sân hận an trú theo cách sân hận; người si mê an trú theo cách si mê; người chấp thủ an trú theo cách tà kiến; người kiên cố an trú theo cách tùy miên; người bị trói buộc an trú theo cách mạn; người không quyết định an trú theo cách hoài nghi; người bị phóng dật an trú theo cách trạo cử.
Akkheyyaṃ apariññāyāti pañcakkhandhe tīhi pariññāhi aparijānitvā.
Not fully understanding what can be expressed (akkheyyaṃ apariññāyā) means not fully understanding the five aggregates through the three types of full understanding (pariññā).
Không liễu tri akkheyya (akkheyyaṃ apariññāyā): Không liễu tri năm uẩn bằng ba sự liễu tri.
Yogamāyanti maccunoti maccuno yogaṃ payogaṃ pakkhepaṃ upakkhepaṃ upakkamaṃ abbhantaraṃ āgacchanti, maraṇavasaṃ gacchantīti attho.
They approach the bond of death (yogamāyanti maccuno) means they enter into the use, application, imposition, successive imposition, and inner sphere of Death, meaning they fall under the power of death.
Đi đến sự trói buộc của tử thần (yogamāyanti maccuno): Nghĩa là họ đi đến sự trói buộc, sự áp dụng, sự ném vào, sự ném xuống, sự xâm nhập vào bên trong của tử thần; họ đi đến sự kiểm soát của cái chết.
Evamimāya gāthāya kālikā kāmā kathitā.
Thus, with this verse, kālika sensual pleasures are described.
Như vậy, bằng bài kệ này, các dục kālika đã được nói đến.
Pariññāyāti ñātapariññā, tīraṇapariññā, pahānapariññāti imāhi tīhi pariññāhi parijānitvā.
Pariññāyā means having fully understood through the three kinds of full understanding: full understanding by knowing (ñātapariññā), full understanding by scrutinizing (tīraṇapariññā), and full understanding by abandoning (pahānapariññā).
Liễu tri (pariññāyā): Liễu tri bằng sự biết rõ (ñātapariññā), sự thẩm định (tīraṇapariññā), và sự đoạn trừ (pahānapariññā) này.
Tattha katamā ñātapariññā? Pañcakkhandhe parijānāti – ‘‘ayaṃ rūpakkhandho, ayaṃ vedanākkhandho, ayaṃ saññākkhandho, ayaṃ saṅkhārakkhandho, ayaṃ viññāṇakkhandho, imāni tesaṃ lakkhaṇarasapaccupaṭṭhānapadaṭṭhānānī’’ti, ayaṃ ñātapariññā.
Among these, what is ñātapariññā? It is when one fully understands the five aggregates, saying, "This is the rūpakkhandha, this is the vedanākkhandha, this is the saññakkhandha, this is the saṅkhārakkhandha, this is the viññāṇakkhandha, and these are their characteristics, functions, manifestations, and proximate causes." This is ñātapariññā.
Trong đó, ñātapariññā là gì? Liễu tri năm uẩn rằng: “Đây là sắc uẩn, đây là thọ uẩn, đây là tưởng uẩn, đây là hành uẩn, đây là thức uẩn, đây là các đặc tính, chức năng, biểu hiện, và nguyên nhân gần của chúng.” Đây là ñātapariññā.
Katamā tīraṇapariññā? Evaṃ ñātaṃ katvā pañcakkhandhe tīreti aniccato dukkhato rogatoti dvācattālīsāya ākārehi.
What is tīraṇapariññā? It is when, having known the five aggregates in this way, one scrutinizes them in forty-two ways as impermanent, suffering, and diseased.
Tīraṇapariññā là gì? Sau khi biết rõ như vậy, vị ấy thẩm định năm uẩn bằng bốn mươi hai phương diện như vô thường, khổ, bệnh.
Ayaṃ tīraṇapariññā.
This is tīraṇapariññā.
Đây là tīraṇapariññā.
Katamā pahānapariññā? Evaṃ tīrayitvā aggamaggena pañcasu khandhesu chandarāgaṃ pajahati.
What is pahānapariññā? It is when, having scrutinized them in this way, one abandons sensual desire (chandarāga) for the five aggregates through the highest path.
Pahānapariññā là gì? Sau khi thẩm định như vậy, vị ấy đoạn trừ tham ái (chandarāga) trong năm uẩn bằng Thánh đạo cao nhất.
Ayaṃ pahānapariññā.
This is pahānapariññā.
Đây là pahānapariññā.
Akkhātāraṃ na maññatīti evaṃ tīhi pariññāhi pañcakkhandhe parijānitvā khīṇāsavo bhikkhu akkhātāraṃ puggalaṃ na maññati.
He does not conceive of the 'speaker' (akkhātāraṃ na maññati) means that a bhikkhu who has destroyed the asavas (khīṇāsava), having fully understood the five aggregates through these three kinds of full understanding, does not conceive of a 'person who can be spoken of'.
Không nhận thức về người được nói đến (akkhātāraṃ na maññatī): Vị Tỳ-kheo đã diệt tận các lậu hoặc (khīṇāsava), sau khi liễu tri năm uẩn bằng ba sự liễu tri như vậy, không nhận thức về người được nói đến.
Akkhātāranti kammavasena kāraṇaṃ veditabbaṃ, akkhātabbaṃ kathetabbaṃ puggalaṃ na maññati, na passatīti attho.
Akkhātāraṃ should be understood as the agent in the sense of action; it means he does not conceive of or see a person who can be spoken of or described.
Người được nói đến (akkhātāraṃ): Phải hiểu là nguyên nhân theo nghiệp; nghĩa là không nhận thức, không thấy người đáng được nói đến, đáng được kể đến.
Kinti akkhātabbanti?
How should one be spoken of?
Nói đến điều gì?
‘‘Tisso’’ti vā ‘‘phusso’’ti vā evaṃ yena kenaci nāmena vā gottena vā pakāsetabbaṃ.
One to be described by some name or clan, such as "Tissa" or "Phussa."
Được công bố bằng bất kỳ tên hay dòng họ nào như “Tissa” hay “Phussa” chẳng hạn.
Tañhi tassa na hotīti taṃ tassa khīṇāsavassa na hoti.
For that is not his (tañhi tassa na hotī) means that is not for that khīṇāsava.
Điều đó không thuộc về vị ấy (tañhi tassa na hotī): Điều đó không thuộc về vị Tỳ-kheo đã diệt tận các lậu hoặc.
Yena naṃ vajjāti yena naṃ ‘‘rāgena ratto’’ti vā ‘‘dosena duṭṭho’’ti vā ‘‘mohena mūḷho’’ti vāti koci vadeyya, taṃ kāraṇaṃ tassa khīṇāsavassa natthi.
By which one might name him (yena naṃ vajjā) means that there is no such cause for that khīṇāsava by which someone might say of him, "He is infatuated with passion," or "He is corrupted by hatred," or "He is deluded by delusion."
Bởi vì điều đó không thể được nói về vị ấy (yena naṃ vajjā): Nghĩa là không có nguyên nhân nào mà người ta có thể nói về vị Tỳ-kheo đã diệt tận các lậu hoặc đó rằng: “Vị ấy bị tham ái trói buộc,” hay “Vị ấy bị sân hận làm ô uế,” hay “Vị ấy bị si mê che lấp.”
Sace vijānāsi vadehīti sace evarūpaṃ khīṇāsavaṃ jānāsi, ‘‘jānāmī’’ti vadehi.
If you know, tell (sace vijānāsi vadehi) means if you know such a khīṇāsava, say, "I know."
Nếu bạn biết, hãy nói (sace vijānāsi vadehi): Nếu bạn biết một vị A-la-hán như vậy, hãy nói “Tôi biết.”
No ce jānāsi, atha ‘‘na jānāmī’’ti vadehi.
If you do not know, then say, "I do not know."
Nếu bạn không biết, thì hãy nói “Tôi không biết.”
Yakkhāti devataṃ ālapanto āha.
Yakkha he said, addressing the deity.
Hỡi Dạ-xoa (yakkhā): Vị ấy nói khi gọi thiên nữ.
Iti imāya gāthāya sandiṭṭhiko navavidho lokuttaradhammo kathito.
Thus, with this verse, the ninefold supramundane Dhamma, which is directly visible (sandiṭṭhika), is described.
Như vậy, bằng bài kệ này, chín loại pháp siêu thế thiết thực hiện tại đã được nói đến.
Sādhūti āyācanatthe nipāto.
Sādhu is a particle in the sense of a request.
Sādhu là một từ bất biến trong ý nghĩa cầu xin.
Yo maññatīti yo attānaṃ ‘‘ahaṃ samo’’ti vā ‘‘visesī’’ti vā ‘‘nihīno’’ti vā maññati.
He who conceives (yo maññati) means he who conceives himself to be "I am equal," or "superior," or "inferior."
Người nào nhận thức (yo maññatī): Người nào nhận thức mình là “bằng người khác” hay “hơn người khác” hay “thấp kém hơn người khác.”
Etena ‘‘seyyohamasmī’’tiādayo tayo mānā gahitāva.
By this, the three kinds of conceit, "I am superior," etc., are included.
Bằng cách này, ba loại kiêu mạn như “Tôi hơn người” đã được bao gồm.
Tesu gahitesu nava mānā gahitāva honti.
When these are included, the nine kinds of conceit are included.
Khi ba loại đó được bao gồm, chín loại kiêu mạn cũng được bao gồm.
So vivadetha tenāti so puggalo teneva mānena yena kenaci puggalena saddhiṃ – ‘‘kena maṃ tvaṃ pāpuṇāsi, kiṃ jātiyā pāpuṇāsi, udāhu gottena, kulapadesena, vaṇṇapokkharatāya, bāhusaccena, dhutaguṇenā’’ti evaṃ vivadeyya.
He would dispute with that (so vivadetha tenā) means that person, with that very conceit, would dispute with any person, saying, "How do you reach me? Do you reach me by birth, or by clan, by family origin, by complexion, by great learning, or by ascetic qualities (dhutaguṇa)?"
Người đó sẽ tranh cãi với điều đó (so vivadetha tenā): Người đó, với chính sự kiêu mạn ấy, sẽ tranh cãi với bất kỳ người nào rằng: “Ngươi đạt được ta bằng cách nào? Ngươi đạt được ta bằng chủng tộc ư, hay bằng dòng họ, bằng địa vị gia đình, bằng vẻ đẹp, bằng sự học rộng, hay bằng hạnh đầu đà?”
Iti imāyapi upaḍḍhagāthāya kālikā kāmā kathitā.
Thus, with this half-verse too, kālika sensual pleasures are described.
Như vậy, bằng nửa bài kệ này, các dục kālika cũng đã được nói đến.
Tīsu vidhāsūti tīsu mānesu.
In the three vidhās means in the three forms of conceit.
Tīsu vidhāsū có nghĩa là trong ba loại kiêu mạn.
‘‘Ekavidhena rūpasaṅgaho’’tiādīsu (dha. sa. 584) hi koṭṭhāso ‘‘vidho’’ti vutto.
Indeed, in passages like “the comprehension of material form by one vidhā (mode),” a component is called vidhā.
Trong các câu như “Ekavidhena rūpasaṅgaho” (Sự tập hợp sắc theo một cách), v.v., “vidho” được nói đến như một phần.
‘‘Kathaṃvidhaṃ sīlavantaṃ vadanti, kathaṃvidhaṃ paññavantaṃ vadantī’’tiādīsu (saṃ. ni. 1.95) ākāro.
In passages like “What kind of virtuous one do they call, what kind of wise one do they call?” it means an aspect.
Trong các câu như “Kathaṃvidhaṃ sīlavantaṃ vadanti, kathaṃvidhaṃ paññavantaṃ vadantī” (Họ nói người có giới là loại người như thế nào? Họ nói người có tuệ là loại người như thế nào?), v.v., nó có nghĩa là đặc tính.
‘‘Tisso imā, bhikkhave, vidhā.
“Bhikkhus, these are three vidhās.
“Này các Tỳ-khưu, có ba loại kiêu mạn này.
Katamā tisso?
Which three?
Thế nào là ba loại?
Seyyohamasmīti vidhā, sadisohamasmīti vidhā, hīnohamasmīti vidhā’’tiādīsu (saṃ. ni. 5.162) māno ‘‘vidhā’’ti vutto.
The vidhā ‘I am superior,’ the vidhā ‘I am equal,’ the vidhā ‘I am inferior’”—in these, māna (conceit) is called vidhā.
Kiêu mạn ‘Ta hơn’, kiêu mạn ‘Ta bằng’, kiêu mạn ‘Ta kém’”, v.v. trong các câu này, kiêu mạn được gọi là “vidhā”.
Idhāpi mānova.
Here too, it is just māna.
Ở đây cũng chính là kiêu mạn.
Tena vuttaṃ ‘‘tīsu vidhāsūti tīsu mānesū’’ti.
Therefore, it is said, “‘in the three vidhās’ means in the three forms of conceit.”
Vì thế đã nói “tīsu vidhāsūti tīsu mānesū” (tīsu vidhāsū có nghĩa là trong ba loại kiêu mạn).
Avikampamānoti so puggalo etesu saṅkhepato tīsu, vitthārato navasu mānesu na kampati, na calati.
Unshaken: that person is not agitated, not disturbed by these three forms of conceit in brief, or nine in detail.
Avikampamāno có nghĩa là người đó không run rẩy, không dao động trước ba loại kiêu mạn này (tóm tắt) và chín loại (chi tiết).
Samo visesīti na tassa hotīti tassa pahīnamānassa khīṇāsavassa ‘‘ahaṃ sadiso’’ti vā ‘‘seyyo’’ti vā ‘‘hīno’’ti vā na hotīti dasseti.
‘Equal, superior—these do not exist for him’: this shows that for that one whose conceit is abandoned, the arahat, there is no thought of “I am equal,” or “I am superior,” or “I am inferior.”
Samo visesīti na tassa hotī cho thấy rằng đối với bậc A-la-hán đã đoạn trừ kiêu mạn, không có ý niệm “ta bằng” hay “ta hơn” hay “ta kém”.
Pacchimapadaṃ vuttanayameva.
The latter clause is in accordance with the method stated before.
Vế sau cũng theo cách đã nói.
Iti imāyapi upaḍḍhagāthāya navavidho sandiṭṭhiko lokuttaradhammo kathito.
Thus, with this latter half of the verse too, the ninefold immediately visible supramundane Dhamma has been taught.
Như vậy, với nửa bài kệ này, Pháp siêu thế hiện tiền (sandiṭṭhika lokuttaradhamma) chín loại đã được thuyết giảng.
Pahāsi saṅkhanti, ‘‘paṭisaṅkhā yoniso āhāraṃ āhāretī’’tiādīsu (saṃ. ni. 4.120, 239) paññā ‘‘saṅkhā’’ti āgatā.
He abandoned reckoning: In passages like “having reflected wisely, he takes his food,” wisdom is referred to as saṅkhā.
Pahāsi saṅkha (đoạn trừ saṅkhā). Trong các câu như “paṭisaṅkhā yoniso āhāraṃ āhāretī” (sau khi quán xét kỹ lưỡng, thọ dụng vật thực), v.v., tuệ được gọi là “saṅkhā”.
‘‘Atthi te koci gaṇako vā muddiko vā saṅkhāyako vā, yo pahoti gaṅgāya vālukaṃ gaṇetu’’nti (saṃ. ni. 4.410) ettha gaṇanā.
In “Is there any calculator, counter, or reckoner of yours who is able to count the sands of the Ganges?” here it means calculation.
Ở đây, trong câu “Atthi te koci gaṇako vā muddiko vā saṅkhāyako vā, yo pahoti gaṅgāya vālukaṃ gaṇetuṃ” (Ngươi có người đếm, người tính, hay người tính toán nào có thể đếm cát sông Hằng không?), là sự đếm.
‘‘Saññānidānā hi papañcasaṅkhā’’tiādīsu (su. ni. 880) koṭṭhāso.
In passages like “For the proliferations of conceiving arise from perception,” it means a component.
Trong các câu như “Saññānidānā hi papañcasaṅkhā” (Vì các khái niệm về sự phóng dật có nguồn gốc từ tưởng), v.v., là một phần.
‘‘Yā tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā’’ti (dha. sa. 1313-1315) ettha paṇṇatti ‘‘saṅkhā’’ti āgatā.
In “the designation, the appellation of those various phenomena,” here paññatti (concept) is referred to as saṅkhā.
Trong câu “Yā tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā” (Cái được gọi là saṅkhā, samaññā của các pháp ấy), khái niệm được gọi là “saṅkhā”.
Idhāpi ayameva adhippetā.
Here, this very meaning is intended.
Ở đây, chính điều này được đề cập.
Pahāsi saṅkhanti padassa hi ayamevattho – ratto duṭṭho mūḷho iti imaṃ paṇṇattiṃ khīṇāsavo pahāsi jahi pajahīti.
Indeed, the meaning of the phrase He abandoned reckoning is this: the arahat has abandoned, given up, utterly relinquished this designation of being infatuated, hateful, or deluded.
Vì ý nghĩa của cụm từ pahāsi saṅkha chính là: bậc A-la-hán đã đoạn trừ, từ bỏ, hoàn toàn từ bỏ khái niệm “người tham ái, người sân hận, người si mê”.
Na vimānamajjhagāti navabhedaṃ tividhamānaṃ na upagato.
He did not arrive at a dwelling means he did not approach the ninefold, threefold conceit.
Na vimānamajjhagā có nghĩa là không đạt đến chín loại kiêu mạn, ba loại kiêu mạn.
Nivāsaṭṭhena vā mātukucchi ‘‘vimāna’’nti vuccati, taṃ āyatiṃ paṭisandhivasena na upagacchītipi attho.
Alternatively, the mother’s womb is called a “dwelling” by way of being a place of abode; the meaning is also that he will not approach it in the future by way of rebirth-linking.
Hoặc cũng có nghĩa là: bụng mẹ được gọi là “vimāna” theo nghĩa là nơi trú ngụ, và người đó sẽ không tái sinh vào đó trong tương lai.
Anāgatatthe atītavacanaṃ.
The past tense is used for a future meaning.
Động từ quá khứ được dùng cho ý nghĩa tương lai.
Acchecchīti chindi.
He cut off means he severed.
Acchecchī có nghĩa là đã cắt đứt.
Chinnaganthanti cattāro ganthe chinditvā ṭhitaṃ.
With ties severed means having severed the four ties.
Chinnagantha có nghĩa là đã cắt đứt bốn kiết sử.
Anīghanti niddukkhaṃ.
Unhindered means free from suffering.
Anīgha có nghĩa là không khổ đau.
Nirāsanti nittaṇhaṃ.
Without longing means free from craving.
Nirāsa có nghĩa là không tham ái.
Pariyesamānāti olokayamānā.
Searching means looking for.
Pariyesamānā có nghĩa là đang tìm kiếm.
Nājjhagamunti na adhigacchanti na vindanti na passanti.
They do not find means they do not attain, do not discover, do not see.
Nājjhagamu có nghĩa là không đạt được, không tìm thấy, không nhìn thấy.
Vattamānatthe atītavacanaṃ.
The past tense is used for a present meaning.
Động từ quá khứ được dùng cho ý nghĩa hiện tại.
Idha vā huraṃ vāti idhaloke vā paraloke vā.
Here or beyond means in this world or in the next world.
Idha vā huraṃ vā có nghĩa là ở đời này hay ở đời sau.
Sabbanivesanesūti tayo bhavā, catasso yoniyo, pañca gatiyo, satta viññāṇaṭṭhitiyo, nava sattāvāsā, iti imesupi sabbesu sattanivesanesu evarūpaṃ khīṇāsavaṃ kāyassa bhedā uppajjamānaṃ vā uppannaṃ vā na passantīti attho.
In all abodes means the three existences, the four kinds of birth, the five destinies, the seven stations of consciousness, the nine abodes of beings—in all these abodes of beings, they do not see an arahat of such a nature either arising after the breaking up of the body or already arisen.
Sabbanivesanesū có nghĩa là ở tất cả các nơi cư ngụ của chúng sinh này – ba cõi, bốn loài sinh, năm nẻo luân hồi, bảy trú xứ của thức, chín trú xứ của chúng sinh – họ không nhìn thấy một bậc A-la-hán như vậy đang sinh ra hay đã sinh ra sau khi thân hoại mạng chung.
Imāya gāthāya sandiṭṭhikaṃ lokuttaradhammameva kathesi.
With this verse, too, the immediately visible supramundane Dhamma has been taught.
Với bài kệ này, Ngài đã thuyết giảng về Pháp siêu thế hiện tiền (sandiṭṭhika lokuttaradhamma).
Imañca gāthaṃ sutvā sāpi devatā atthaṃ sallakkhesi, teneva kāraṇena imassa khvāhaṃ, bhantetiādimāha.
Having heard this verse, that deity also apprehended its meaning, and for that very reason, she spoke the words beginning, “ I understand this, Venerable Sir.”
Vị thiên nhân đó sau khi nghe bài kệ này cũng đã hiểu ý nghĩa, chính vì lý do đó mà vị ấy đã nói “Imassa khvāhaṃ, bhante” (Bạch Thế Tôn, con đã hiểu điều này), v.v.
Tattha pāpaṃ na kayirāti gāthāya dasakusalakammapathavasenapi kathetuṃ vaṭṭati aṭṭhaṅgikamaggavasenapi.
In that, the verse “ One should do no evil” can be explained both in terms of the tenfold wholesome courses of action and in terms of the Noble Eightfold Path.
Trong đó, bài kệ Pāpaṃ na kayirā (không làm điều ác) có thể được giải thích theo mười thiện nghiệp đạo hoặc theo Bát Chánh Đạo.
Dasakusalakammapathavasena tāva vacasāti catubbidhaṃ vacīsucaritaṃ gahitaṃ.
First, in terms of the tenfold wholesome courses of action, by word includes the fourfold wholesome verbal conduct.
Trước hết, theo mười thiện nghiệp đạo, vacasā (bằng lời nói) bao gồm bốn loại thiện hạnh về lời nói.
Manasāti tividhaṃ manosucaritaṃ gahitaṃ.
By mind includes the threefold wholesome mental conduct.
Manasā (bằng ý) bao gồm ba loại thiện hạnh về ý.
Kāyena vā kiñcana sabbaloketi tividhaṃ kāyasucaritaṃ gahitaṃ.
Or by body anything in the whole world includes the threefold wholesome bodily conduct.
Kāyena vā kiñcana sabbaloke (bằng thân, bất cứ điều gì trên thế gian) bao gồm ba loại thiện hạnh về thân.
Ime tāva dasakusalakammapathadhammā honti.
These are, first, the Dhamma of the tenfold wholesome courses of action.
Đây là mười pháp thiện nghiệp đạo.
Kāme pahāyāti iminā pana kāmasukhallikānuyogo paṭikkhitto.
By the phrase abandoning sensual pleasures, however, the devotion to sensual pleasures is rejected.
Tuy nhiên, với câu Kāme pahāyā (đoạn trừ các dục), sự chấp trước vào lạc thú của dục đã bị bác bỏ.
Satimā sampajānoti iminā dasakusalakammapathakāraṇaṃ satisampajaññaṃ gahitaṃ.
By the phrase mindful and clearly comprehending, the mindfulness and clear comprehension that are the cause of the tenfold wholesome courses of action are included.
Với câu Satimā sampajāno (người có niệm và tỉnh giác), niệm và tỉnh giác là nguyên nhân của mười thiện nghiệp đạo đã được bao gồm.
Dukkhaṃ na sevetha anatthasaṃhitanti iminā attakilamathānuyogo paṭisiddho.
By the phrase he should not indulge in suffering that is associated with harm, the devotion to self-mortification is prohibited.
Với câu Dukkhaṃ na sevetha anatthasaṃhitaṃ (không nên theo đuổi khổ đau không lợi ích), sự chấp trước vào việc hành hạ bản thân đã bị bác bỏ.
Iti devatā ‘‘ubho ante vivajjetvā kāraṇehi satisampajaññehi saddhiṃ dasakusalakammapathadhamme tumhehi kathite ājānāmi bhagavā’’ti vadati.
Thus, the deity says, “Having avoided both extremes, I understand the tenfold wholesome courses of action taught by you, together with their causes, mindfulness and clear comprehension, O Blessed One.”
Như vậy, vị thiên nhân nói: “Bạch Thế Tôn, con đã hiểu mười pháp thiện nghiệp đạo mà Ngài đã thuyết giảng, cùng với niệm và tỉnh giác, sau khi tránh xa cả hai cực đoan”.
Aṭṭhaṅgikamaggavasena pana ayaṃ nayo – tasmiṃ kira ṭhāne mahatī dhammadesanā ahosi.
In terms of the Noble Eightfold Path, the method is as follows: It is said that a great Dhamma discourse took place at that time.
Tuy nhiên, theo Bát Chánh Đạo, cách giải thích như sau: Tại nơi đó, có một bài pháp rất lớn đã được thuyết giảng.
Desanāpariyosāne devatā yathāṭhāne ṭhitāva desanānusārena ñāṇaṃ pesetvā sotāpattiphale patiṭṭhāya attanā adhigataṃ aṭṭhaṅgikaṃ maggaṃ dassentī evamāha.
At the conclusion of the discourse, the deity, remaining in her place, applied her knowledge according to the discourse, became established in the fruit of stream-entry, and, revealing the Noble Eightfold Path she had attained, spoke thus.
Khi bài pháp kết thúc, vị thiên nhân vẫn đứng tại chỗ, quán chiếu bằng trí tuệ theo lời dạy, đạt được quả Tu-đà-hoàn, và sau đó đã nói bài kệ này để chỉ ra con đường tám chi phần mà mình đã chứng đắc.
Tattha vacasāti sammāvācā gahitā, mano pana aṅgaṃ na hotīti manasāti maggasampayuttakaṃ cittaṃ gahitaṃ.
There, by word includes right speech, but since mind is not a factor, by mind includes the consciousness associated with the path.
Trong đó, vacasā (bằng lời nói) bao gồm Chánh Ngữ, nhưng vì ý không phải là một chi phần, nên manasā (bằng ý) bao gồm tâm tương ưng với đạo.
Kāyena vā kiñcana sabbaloketi sammākammanto gahito, ājīvo pana vācākammantapakkhikattā gahitova hoti.
Or by body anything in the whole world includes right action, and right livelihood is also included because it belongs to the category of right speech and right action.
Kāyena vā kiñcana sabbaloke (bằng thân, bất cứ điều gì trên thế gian) bao gồm Chánh Nghiệp, và Chánh Mạng đã được bao gồm vì nó thuộc về Chánh Ngữ và Chánh Nghiệp.
Satimāti iminā vāyāmasatisamādhayo gahitā.
By the phrase mindful, right effort, right mindfulness, and right concentration are included.
Satimā (người có niệm) bao gồm Chánh Tinh Tấn, Chánh Niệm và Chánh Định.
Sampajānotipadena sammādiṭṭhisammāsaṅkappā.
By the word clearly comprehending, right view and right intention are included.
Với từ Sampajāno (tỉnh giác), Chánh Kiến và Chánh Tư Duy được bao gồm.
Kāme pahāya, dukkhaṃ na sevethātipadadvayena antadvayavajjanaṃ.
By the two phrases abandoning sensual pleasures and he should not indulge in suffering, the avoidance of the two extremes is included.
Hai cụm từ Kāme pahāya, dukkhaṃ na sevethā (đoạn trừ các dục, không nên theo đuổi khổ đau) bao gồm việc tránh xa hai cực đoan.
Iti ime dve ante anupagamma majjhimaṃ paṭipadaṃ tumhehi kathitaṃ, ājānāmi bhagavāti vatvā tathāgataṃ gandhamālādīhi pūjetvā padakkhiṇaṃ katvā pakkāmīti.
Thus, having said, “Having not approached these two extremes, I understand the Middle Path taught by you, O Blessed One,” she honored the Tathāgata with fragrances, garlands, and so forth, circumambulated him clockwise, and departed.
Như vậy, sau khi nói: “Bạch Thế Tôn, con đã hiểu Trung Đạo mà Ngài đã thuyết giảng, không theo đuổi hai cực đoan này”, vị ấy đã cúng dường Như Lai bằng hương hoa, v.v., đi nhiễu hữu và rời đi.
21. Sattivaggassa paṭhame sattiyāti desanāsīsametaṃ.
21. In the first sutta of the Sattivagga, by a spear is the heading of the discourse.
21. Trong kinh Satti đầu tiên của chương Sattivagga, sattiyā là tiêu đề của bài pháp.
Ekatokhārādinā satthenāti attho.
The meaning is by a weapon such as a one-edged knife.
Có nghĩa là bằng vũ khí có một lưỡi, v.v.
Omaṭṭhoti pahato.
Pierced means struck.
Omaṭṭho có nghĩa là bị đánh.
Cattāro hi pahārā omaṭṭho ummaṭṭho maṭṭho vimaṭṭhoti.
Indeed, there are four kinds of blows: omaṭṭha (struck down), ummaṭṭha (struck up), maṭṭha (pierced through), and vimaṭṭha (all other kinds of blows).
Có bốn loại đòn đánh: omaṭṭho, ummaṭṭho, maṭṭho, vimaṭṭho.
Tattha upari ṭhatvā adhomukhaṃ dinnapahāro omaṭṭho nāma; heṭṭhā ṭhatvā uddhaṃmukhaṃ dinno ummaṭṭho nāma; aggaḷasūci viya vinivijjhitvā gato maṭṭho nāma; seso sabbopi vimaṭṭho nāma.
Among these, a blow delivered downwards while standing above is called omaṭṭha; a blow delivered upwards while standing below is called ummaṭṭha; a blow that pierces through like a door bolt is called maṭṭha; and all other remaining blows are called vimaṭṭha.
Trong đó, đòn đánh từ trên xuống dưới được gọi là omaṭṭho; đòn đánh từ dưới lên trên được gọi là ummaṭṭho; đòn đánh xuyên qua như chốt cửa được gọi là maṭṭho; tất cả các loại còn lại được gọi là vimaṭṭho.
Imasmiṃ pana ṭhāne omaṭṭho gahito.
However, in this context, omaṭṭha is taken.
Tuy nhiên, ở đây, omaṭṭho được đề cập.
So hi sabbadāruṇo duruddharasallo duttikiccho antodoso antopubbalohitova hoti, pubbalohitaṃ anikkhamitvā vaṇamukhaṃ pariyonandhitvā tiṭṭhati.
For it is the most cruel, with a difficult-to-extract dart, hard to treat, full of internal pus and blood, where the pus and blood do not flow out but instead surround the mouth of the wound and remain.
Vì nó là loại tàn bạo nhất, có mũi tên khó rút, khó chữa trị, bên trong có mủ và máu, mủ và máu không chảy ra mà bịt kín miệng vết thương.
Pubbalohitaṃ niharitukāmehi mañcena saddhiṃ bandhitvā adhosiro kātabbo hoti, maraṇaṃ vā maraṇamattaṃ vā dukkhaṃ pāpuṇāti.
Those who wish to extract the pus and blood must be tied to a bed and held upside down; they experience either death or suffering akin to death.
Những người muốn lấy mủ và máu ra phải buộc người bệnh vào giường và để đầu chúc xuống, người đó sẽ phải chịu đau đớn đến chết hoặc gần chết.
Paribbajeti vihareyya.
He should wander means he should dwell.
Paribbaje có nghĩa là nên sống.
Atha bhagavā cintesi – imāya devatāya upamā tāva daḷhaṃ katvā ānītā, atthaṃ pana parittakaṃ gahetvā ṭhitā, punappunaṃ kathentīpi hesā kāmarāgassa vikkhambhanapahānameva katheyya.
Then the Blessed One thought: “This deity has presented a strong simile, but she has grasped only a small part of the meaning. Even if she were to speak again and again, she would only talk about suppressing and abandoning sensual passion.
Rồi Đức Thế Tôn suy nghĩ – ví dụ của vị thiên nữ này được đưa ra rất mạnh mẽ, nhưng ý nghĩa lại rất ít ỏi, dù có nói đi nói lại thì cũng chỉ nói về sự trấn áp và đoạn trừ dục ái mà thôi.
Yāva ca kāmarāgo maggena na samugghāṭiyati, tāva anubaddhova hoti.
And as long as sensual passion is not eradicated by the path, it remains persistent.”
Và chừng nào dục ái chưa được nhổ tận gốc bằng Đạo, chừng đó nó vẫn còn đeo bám.
Iti tameva opammaṃ gahetvā paṭhamamaggavasena desanaṃ vinivaṭṭetvā desento dutiyaṃ gāthamāha.
Thus, taking that same simile, and turning the teaching around according to the first path, he taught, uttering the second verse.
Như vậy, lấy chính ví dụ đó, và chuyển hướng bài thuyết pháp theo Đạo thứ nhất (Sơ Đạo), Ngài đã nói bài kệ thứ hai.
Tassattho purimānusāreneva veditabboti.
Its meaning should be understood in accordance with the preceding explanation.
Ý nghĩa của bài kệ đó cần được hiểu theo cách tương tự như bài trước.
Paṭhamaṃ.
First (sutta explanation is complete).
Thứ nhất.
22. Dutiye nāphusantaṃ phusatīti kammaṃ aphusantaṃ vipāko na phusati, kammameva vā aphusantaṃ kammaṃ na phusati.
22. In the second (sutta), regarding the statement "it does not befall one who does not touch," it means that the vipāka (result) does not befall one who has not touched kamma, or alternatively, kamma itself does not befall one who has not touched kamma.
22. Trong bài thứ hai, nāphusantaṃ phusatīti (điều không chạm thì không chạm tới) nghĩa là quả báo không chạm tới người không tạo nghiệp; hoặc nghiệp không chạm tới người không tạo nghiệp.
Kammañhi nākaroto kariyati.
For kamma is not done by one who does not act.
Quả thật, nghiệp không được tạo ra bởi người không hành động.
Phusantañca tato phuseti kammaṃ phusantaṃ vipāko phusati, kammameva vā phusati.
"And it befalls one who touches, from that" means that vipāka befalls one who has touched kamma, or alternatively, kamma itself befalls (them).
Phusantañca tato phuseti (điều chạm tới thì từ đó chạm tới) nghĩa là quả báo chạm tới người tạo nghiệp; hoặc chính nghiệp chạm tới (người tạo nghiệp).
Kammañhi karoto kariyati.
For kamma is done by one who acts.
Quả thật, nghiệp được tạo ra bởi người hành động.
Tasmā phusantaṃ phusati, appaduṭṭhapadosinanti yasmā na aphusantaṃ phusati, phusantañca phusati, ayaṃ kammavipākānaṃ dhammatā, tasmā yo ‘‘appaduṭṭhassa narassa dussati, suddhassa posassa anaṅgaṇassā’’ti evaṃ vutto appaduṭṭhapadosī puggalo, taṃ puggalaṃ kammaṃ phusantameva kammaṃ phusati, vipāko vā phusati.
"Therefore, it befalls one who touches, the one who offends the unoffending": Since it does not befall one who does not touch, and it befalls one who touches—this is the nature of kamma and its results—therefore, if a person, as stated, "offends a blameless person, a pure and stainless individual," it is that person (the offender) whom kamma, having touched (done by him), befalls, or whose vipāka befalls him.
Tasmā phusantaṃ phusati, appaduṭṭhapadosinanti (Vì vậy, điều chạm tới thì chạm tới, đối với người không làm hại mà lại bị hại) nghĩa là vì điều không chạm tới thì không chạm tới, còn điều chạm tới thì chạm tới—đây là bản chất của nghiệp và quả báo. Vì vậy, đối với người được gọi là appaduṭṭhapadosī (người không làm hại mà lại bị hại), như đã nói: “kẻ nào làm hại người không làm hại, người trong sạch không tì vết”, thì nghiệp chạm tới chính người đó khi người đó tạo nghiệp, hoặc quả báo chạm tới người đó.
So hi parassa upaghātaṃ kātuṃ sakkoti vā mā vā, attā panānena catūsu apāyesu ṭhapito nāma hoti.
For he may or may not be able to harm others, but he has certainly placed himself in the four miserable states (apāya).
Người đó có thể làm hại người khác hay không, nhưng chắc chắn người đó đã đặt mình vào bốn cõi khổ.
Tenāha bhagavā – ‘‘tameva bālaṃ pacceti pāpaṃ, sukhumo rajo paṭivātaṃva khitto’’ti.
Therefore, the Blessed One said: "Evil returns to that fool, like fine dust thrown against the wind."
Do đó, Đức Thế Tôn đã dạy: “Chính ác nghiệp đó quay trở lại kẻ ngu, như bụi mịn bị gió thổi ngược.”
Dutiyaṃ.
Second (sutta explanation is complete).
Thứ hai.
23. Tatiye antojaṭāti gāthāyaṃ jaṭāti taṇhāya jāliniyā adhivacanaṃ.
23. In the third (sutta), in the verse "Within is a tangle (antojaṭā)", the word jaṭā is a designation for craving, which is a network.
23. Trong bài thứ ba, trong bài kệ antojaṭāti, jaṭā là tên gọi của ái (taṇhā) như một lưới.
Sā hi rūpādīsu ārammaṇesu heṭṭhupariyavasena punappunaṃ uppajjanato saṃsibbanaṭṭhena veḷugumbādīnaṃ sākhājālasaṅkhātā jaṭā viyāti jaṭā.
For, because it arises repeatedly, upwards and downwards, in objects such as rūpa, and because it entwines, it is like the tangled branches of bamboo thickets and so on, hence it is called jaṭā (tangle).
Vì nó liên tục phát sinh trong các đối tượng như sắc (rūpa) theo cách lên xuống, nên nó được gọi là jaṭā, giống như một mạng lưới cành cây của bụi tre, v.v., do tính chất đan xen của nó.
Sā panesā sakaparikkhāraparaparikkhāresu sakaattabhāva-paraattabhāvesu ajjhattikāyatana-bāhirāyatanesu ca uppajjanato antojaṭā bahijaṭāti vuccati.
And this (craving) is called antojaṭā (internal tangle) and bahijaṭā (external tangle) because it arises in one's own requisites and others' requisites, in one's own being and others' beings, and in internal and external sense-bases.
Và vì nó phát sinh trong các vật sở hữu của mình và của người khác, trong tự thân và thân người khác, và trong các xứ nội và xứ ngoại, nên nó được gọi là antojaṭā bahijaṭā (mạng lưới bên trong, mạng lưới bên ngoài).
Tāya evaṃ uppajjamānāya jaṭāya jaṭitā pajā.
Due to that jaṭā thus arising, "the people are tangled by a tangle."
Với sự phát sinh như vậy của ái, jaṭāya jaṭitā pajā (chúng sinh bị mạng lưới ái trói buộc).
Yathā nāma veḷujaṭādīhi veḷuādayo, evaṃ tāya taṇhājaṭāya sabbāpi ayaṃ sattanikāyasaṅkhātā pajā jaṭitā vinaddhā, saṃsibbitāti attho.
Just as bamboo thickets and so on are tangled by bamboo tangles and so on, so too, all these beings, collectively known as people, are entangled and entwined by that tangle of craving. This is the meaning.
Cũng như bụi tre, v.v., bị trói buộc bởi mạng lưới tre, v.v., thì tất cả chúng sinh này, được gọi là quần chúng, đều bị trói buộc, bị đan xen bởi mạng lưới ái đó; đó là ý nghĩa.
Yasmā ca evaṃ jaṭitā, taṃ taṃ gotama pucchāmīti tasmā taṃ pucchāmi.
And because they are thus tangled, "I ask you, Gotama." Therefore, I ask you.
Và vì bị trói buộc như vậy, taṃ taṃ gotama pucchāmīti (vì vậy, này Gotama, tôi hỏi Ngài).
Gotamāti bhagavantaṃ gottena ālapati.
He addresses the Blessed One by his clan name, Gotama.
Gotamāti (Gotama) là gọi Đức Thế Tôn bằng họ.
Ko imaṃ vijaṭaye jaṭanti imaṃ evaṃ tedhātukaṃ jaṭetvā ṭhitaṃ jaṭaṃ ko vijaṭeyya, vijaṭetuṃ ko samatthoti pucchati.
"Who can untangle this tangle?" He asks, "Who can untangle this tangle that has entwined the three realms? Who is capable of untangling it?"
Ko imaṃ vijaṭaye jaṭanti (Ai có thể gỡ bỏ mạng lưới này?) là hỏi: Ai có thể gỡ bỏ mạng lưới này, thứ đã trói buộc ba cõi như vậy? Ai có khả năng gỡ bỏ nó?
Athassa bhagavā tamatthaṃ vissajjento sīle patiṭṭhāyātiādimāha.
Then, the Blessed One, explaining that meaning to him, uttered the statement beginning with "Established in virtue (sīle patiṭṭhāya)" and so on.
Sau đó, Đức Thế Tôn đã giải thích ý nghĩa đó, bắt đầu bằng sīle patiṭṭhāyāti (an trú trong giới).
Tattha sīle patiṭṭhāyāti catupārisuddhisīle ṭhatvā.
Therein, "Established in virtue" means standing firm in the four-fold purity of virtue.
Ở đây, sīle patiṭṭhāyāti nghĩa là an trú trong Tứ Thanh Tịnh Giới (catupārisuddhisīla).
Ettha ca bhagavā jaṭāvijaṭanaṃ pucchito sīlaṃ ārabhanto na ‘‘aññaṃ puṭṭho aññaṃ kathetī’’ti veditabbo.
Here, when the Blessed One, being asked about untangling the tangle, begins to speak of virtue, it should not be understood that "being asked one thing, he speaks of another."
Ở đây, khi được hỏi về việc gỡ bỏ mạng lưới ái, Đức Thế Tôn đã bắt đầu bằng giới, không nên hiểu rằng “Ngài được hỏi một điều lại nói một điều khác”.
Jaṭāvijaṭakassa hi patiṭṭhādassanatthamettha sīlaṃ kathitaṃ.
For here, virtue is spoken of to show the foundation for one who untangles the tangle.
Thật vậy, giới được nói ở đây để chỉ ra nền tảng cho người gỡ bỏ mạng lưới ái.
Naroti satto.
Naro (man) means a being.
Naroti (người) là chúng sinh.
Sapaññoti kammajatihetukapaṭisandhipaññāya paññavā.
Sapañño (wise) means possessed of wisdom, that is, the wisdom of rebirth conditioned by kamma.
Sapaññoti (có trí tuệ) là người có trí tuệ do nghiệp tái sinh có ba nhân (tihetuka-paṭisandhipaññā).
Cittaṃ paññañca bhāvayanti samādhiñceva vipassanañca bhāvayamāno.
Bhāvayaṃ cittañca paññañca (developing mind and wisdom) means cultivating both samādhi and vipassanā.
Cittaṃ paññañca bhāvayanti (tu tập tâm và tuệ) là tu tập cả định (samādhi) và tuệ quán (vipassanā).
Cittasīsena hettha aṭṭha samāpattiyo kathitā, paññānāmena vipassanā.
Here, the eight attainments are spoken of by the heading of citta, and vipassanā by the name of paññā.
Ở đây, tám thiền chứng (aṭṭha samāpattiyo) được nói đến dưới tên tâm (citta), và tuệ quán (vipassanā) dưới tên tuệ (paññā).
Ātāpīti vīriyavā.
Ātāpī (ardent) means diligent (vīriyavā).
Ātāpīti (tinh cần) là người có tinh tấn (vīriya).
Vīriyañhi kilesānaṃ ātāpanaparitāpanaṭṭhena ‘‘ātāpo’’ti vuccati, tadassa atthīti ātāpī.
For diligence is called "ātāpa" (ardor) because of its nature of burning up and consuming defilements; one who possesses that is ātāpī.
Tinh tấn (vīriya) được gọi là “ātāpo” vì nó có khả năng đốt cháy và làm phiền não các phiền não (kilesa); người có điều đó thì gọi là ātāpī.
Nipakoti nepakkaṃ vuccati paññā, tāya samannāgatoti attho.
Nipako (skillful) means paññā is called 'nepakka'; thus, it means endowed with that (wisdom).
Nipakoti (khôn ngoan) là paññā (trí tuệ) được gọi là nepakka (sự khôn ngoan); người có trí tuệ đó là ý nghĩa.
Iminā padena pārihāriyapaññaṃ dasseti.
By this word, pārihāriya-paññā (skillful wisdom for maintaining practice) is shown.
Với từ này, Ngài chỉ ra pārihāriyapaññā (trí tuệ quản lý).
Pārihāriyapaññā nāma ‘‘ayaṃ kālo uddesassa, ayaṃ kālo paripucchāyā’’tiādinā nayena sabbattha kārāpitā pariharitabbapaññā.
Pārihāriya-paññā is the wisdom that should be maintained and applied in all situations, such as, "This is the time for study, this is the time for inquiry," and so on.
Pārihāriyapaññā (trí tuệ quản lý) là trí tuệ cần được quản lý mọi lúc, theo cách như “đây là thời gian học hỏi, đây là thời gian hỏi đáp”, v.v.
Imasmiñhi pañhābyākaraṇe tikkhattuṃ paññā āgatā.
Indeed, in this explanation of the problem, wisdom (paññā) has appeared three times.
Trong lời giải đáp vấn đề này, trí tuệ (paññā) đã được đề cập ba lần.
Tattha paṭhamā jātipaññā, dutiyā vipassanāpaññā, tatiyā sabbakiccapariṇāyikā pārihāriyapaññā.
Among these, the first is innate wisdom (jāti-paññā), the second is insight wisdom (vipassanā-paññā), and the third is the skillful wisdom that guides all duties (pārihāriya-paññā).
Trong đó, trí tuệ đầu tiên là jātipaññā (trí tuệ bẩm sinh), trí tuệ thứ hai là vipassanāpaññā (trí tuệ tuệ quán), và trí tuệ thứ ba là pārihāriyapaññā (trí tuệ quản lý) hướng dẫn mọi công việc.
Ettāvatā sekhabhūmiṃ kathetvā idāni jaṭaṃ vijaṭetvā ṭhitaṃ mahākhīṇāsavaṃ dassento yesantiādimāha.
Having thus explained the stage of the Sekha (trainee), the Buddha now wishing to show the great Arahant who has untangled the tangle, uttered the statement beginning with "For whom" (yesaṃ).
Sau khi nói về giai đoạn của người còn hữu học (sekhabhūmi) đến đây, bây giờ Ngài nói yesanti (những ai), v.v., để chỉ ra vị A-la-hán vĩ đại đã gỡ bỏ mạng lưới ái.
Evaṃ jaṭaṃ vijaṭetvā ṭhitaṃ khīṇāsavaṃ dassetvā puna jaṭāya vijaṭanokāsaṃ dassento yattha nāmañcātiādimāha.
Having thus shown the Arahant who has untangled the tangle, he then, wishing to show the place where the tangle is untangled, uttered the statement beginning with "Where name" (yattha nāmañca) and so on.
Sau khi chỉ ra vị A-la-hán đã gỡ bỏ mạng lưới ái như vậy, Ngài lại nói yattha nāmañcāti (nơi danh và), v.v., để chỉ ra nơi mạng lưới ái được gỡ bỏ.
Tattha nāmanti cattāro arūpino khandhā.
Therein, nāma means the four immaterial aggregates.
Ở đây, nāmanti (danh) là bốn uẩn vô sắc (arūpino khandhā).
Paṭighaṃ rūpasaññā cāti ettha paṭighasaññāvasena kāmabhavo gahito, rūpasaññāvasena rūpabhavo.
In "Paṭighaṃ rūpasaññā ca" (sense-impression and perception of form), kāma-bhava is taken by way of paṭigha-saññā (perception of impingement), and rūpa-bhava by way of rūpa-saññā (perception of form).
Trong paṭighaṃ rūpasaññā cāti (xúc chạm và tưởng sắc), cõi dục (kāmabhava) được bao gồm theo nghĩa tưởng xúc chạm (paṭighasaññā), và cõi sắc (rūpabhava) theo nghĩa tưởng sắc (rūpasaññā).
Tesu dvīsu gahitesu arūpabhavo gahitova hoti bhavasaṅkhepenāti.
When these two are taken, arūpa-bhava is also included by way of a summary of existences.
Khi hai cõi này được bao gồm, cõi vô sắc (arūpabhava) cũng được bao gồm trong sự tóm tắt các cõi.
Etthesā chijjate jaṭāti ettha tebhūmakavaṭṭassa pariyādiyanaṭṭhāne esā jaṭā chijjati, nibbānaṃ āgamma chijjati nirujjhatīti ayaṃ attho dassito hoti.
"Here this tangle is cut" (etthesā chijjate jaṭā) means that in this place where the three-fold saṃsāra comes to an end, this tangle is cut; that is, it is cut and ceases upon attaining Nibbāna. This meaning is shown.
Etthesā chijjate jaṭāti (ở đây, mạng lưới ái này bị cắt đứt) nghĩa là mạng lưới ái này bị cắt đứt tại nơi ba cõi (tebhūmakavaṭṭa) chấm dứt; ý nghĩa được chỉ ra là nó bị cắt đứt và diệt trừ khi đạt đến Nibbāna.
Tatiyaṃ.
Third (sutta explanation is complete).
Thứ ba.
24. Catutthe yato yatoti pāpato vā kalyāṇato vā.
24. In the fourth (sutta), yato yato (from whatever) means from evil or from good.
24. Trong bài thứ tư, yato yatoti (từ bất cứ điều gì) là từ điều ác hoặc điều thiện.
Ayaṃ kira devatā ‘‘yaṃkiñci kusalādibhedaṃ lokiyaṃ vā lokuttaraṃ vā mano, taṃ nivāretabbameva, na uppādetabba’’nti evaṃladdhikā.
This deity, it is said, held the view that "whatever mind, whether mundane or supramundane, of good or other kinds, should be restrained; it should not be allowed to arise."
Vị thiên nhân này có tín điều rằng: “Bất kỳ tâm nào, dù là thế gian hay siêu thế, thuộc loại thiện hay bất thiện, đều phải được ngăn chặn, không được phát sinh.”
Sa sabbatoti so sabbato.
Sa sabbato (he from all) means that one from all.
Sa sabbatoti (người đó từ mọi mặt) là người đó từ mọi mặt.
Atha bhagavā – ‘‘ayaṃ devatā aniyyānikakathaṃ katheti, mano nāma nivāretabbampi atthi bhāvetabbampi, vibhajitvā namassā dassessāmī’’ti cintetvā dutiyagāthaṃ āha.
Then the Blessed One, thinking, "This deity is speaking a discourse that does not lead to release. The mind, indeed, has aspects that should be restrained and aspects that should be developed. I shall teach him by differentiating," uttered the second verse.
Sau đó, Đức Thế Tôn nghĩ: “Vị thiên nhân này đang nói một điều không dẫn đến giải thoát (aniyyānikakatha). Tâm có những điều cần được ngăn chặn và những điều cần được tu tập. Ta sẽ phân tích và chỉ ra cho vị ấy,” và Ngài đã nói bài kệ thứ hai.
Tattha na mano saṃyatattamāgatanti, yaṃ vuttaṃ ‘‘na sabbato mano nivāraye’’ti, kataraṃ taṃ mano, yaṃ taṃ sabbato na nivāretabbanti ce.
Therein, regarding "The mind that has come to be restrained" (na mano saṃyatattamāgataṃ) and the statement "One should not restrain the mind from all," if one asks, "Which mind is that which should not be restrained from all?"
Ở đây, na mano saṃyatattamāgatanti (tâm không đạt đến sự tự chế), nếu nói rằng “không nên ngăn chặn tâm từ mọi mặt”, thì tâm nào là tâm không nên ngăn chặn từ mọi mặt?
Mano saṃyatattaṃ āgataṃ, yaṃ mano yattha saṃyatabhāvaṃ āgataṃ, ‘‘dānaṃ dassāmi, sīlaṃ rakkhissāmī’’tiādinā nayena uppannaṃ, etaṃ mano na nivāretabbaṃ, aññadatthu brūhetabbaṃ vaḍḍhetabbaṃ.
The mind that has come to be restrained, the mind that has reached a state of discipline, arising with intentions such as "I will give dana, I will observe sīla," should not be restrained. On the contrary, it should be nurtured and developed.
Tâm đã đạt đến sự tự chế, tức là tâm đã đạt đến trạng thái tự chế, phát sinh theo cách như “tôi sẽ bố thí, tôi sẽ giữ giới”, v.v., tâm này không nên bị ngăn chặn, mà phải được nuôi dưỡng và phát triển.
Yato yato ca pāpakanti yato yato akusalaṃ uppajjati, tato tato ca taṃ nivāretabbanti.
"And from whatever is evil" (yato yato ca pāpakaṃ): From whatever source unwholesome states arise, from that source one should restrain it.
Yato yato ca pāpakanti (từ bất cứ điều ác nào) nghĩa là từ bất cứ nơi nào bất thiện (akusala) phát sinh, từ đó tâm đó phải được ngăn chặn.
Catutthaṃ.
Fourth (sutta explanation is complete).
Thứ tư.
25. Pañcame katāvīti catūhi maggehi katakicco.
25. In the fifth (sutta), katāvī (one who has done) means one who has completed the task through the four paths.
25. Trong bài thứ năm, katāvīti (đã hoàn thành công việc) là đã hoàn thành công việc bằng bốn Đạo.
Ahaṃ vadāmīti ayaṃ devatā vanasaṇḍavāsinī, sā āraññakānaṃ bhikkhūnaṃ ‘‘ahaṃ bhuñjāmi, ahaṃ nisīdāmi, mama patto, mama cīvara’’ntiādikathāvohāraṃ sutvā cintesi – ‘‘ahaṃ ime bhikkhū ‘khīṇāsavā’ti maññāmi, khīṇāsavānañca nāma evarūpā attupaladdhinissitakathā hoti, na hoti nu kho’’ti jānanatthaṃ evaṃ pucchati.
Ahaṃ vadāmī (I say): This deity, dwelling in a forest grove, heard the forest bhikkhus speaking such words as "I eat, I sit, my bowl, my robe," and so on. She thought, "I consider these bhikkhus to be Arahants. Do Arahants truly speak such words based on self-attribution, or not?" Thus, she asked to ascertain this.
Ahaṃ vadāmīti (tôi nói) là vị thiên nhân này sống trong rừng. Nghe các Tỳ-khưu sống trong rừng nói chuyện như “tôi ăn, tôi ngồi, bát của tôi, y của tôi”, v.v., vị ấy nghĩ: “Tôi nghĩ những Tỳ-khưu này là A-la-hán. Liệu các A-la-hán có những lời nói dựa trên quan niệm về tự ngã như vậy không, hay không?” để biết, vị ấy hỏi như vậy.
Sāmaññanti lokaniruttiṃ lokavohāraṃ.
Sāmañña means the language of the world, the worldly convention.
Sāmaññanti (thuật ngữ thông thường) là cách nói thông thường, cách dùng từ trong thế gian.
Kusaloti khandhādīsu kusalo.
Kusalo means skilled in the aggregates (khandhas) and so forth.
Kusaloti (khéo léo) là khéo léo trong các uẩn, v.v.
Vohāramattenāti upaladdhinissitakathaṃ hitvā vohārabhedaṃ akaronto ‘‘ahaṃ, mamā’’ti vadeyya.
Vohāramattena means abandoning speech based on a conception of self (upaladdhi) and not disrupting conventional usage, one might say, "I" or "mine."
Vohāramattenā (chỉ bằng cách dùng quy ước) có nghĩa là từ bỏ lời nói dựa trên quan niệm về tự ngã (atta), không phá vỡ quy ước giao tiếp, mà nói rằng: “tôi, của tôi.”
‘‘Khandhā bhuñjanti, khandhā nisīdanti, khandhānaṃ patto, khandhānaṃ cīvara’’nti hi vutte vohārabhedo hoti, na koci jānāti.
For if one were to say, "The aggregates eat, the aggregates sit, the aggregates' bowl, the aggregates' robe," it would disrupt conventional usage, and no one would understand.
Bởi vì, nếu nói rằng: “Các uẩn thọ hưởng, các uẩn ngồi, bát của các uẩn, y của các uẩn,” thì sẽ phá vỡ quy ước giao tiếp, và không ai hiểu được.
Tasmā evaṃ avatvā lokavohārena voharatīti.
Therefore, not speaking thus, one speaks according to worldly convention.
Do đó, không nói như vậy mà nói theo quy ước của thế gian.
Atha devatā – ‘‘yadi diṭṭhiyā vasena na vadati, mānavasena nu kho vadatī’’ti cintetvā puna yo hotīti pucchi.
Then the deity, thinking, "If he does not speak due to wrong view (diṭṭhi), does he speak due to conceit (māna)?" asked again with "Who is?"
Rồi vị thiên nhân suy nghĩ: “Nếu vị ấy không nói theo quan điểm chấp thủ, thì có phải vị ấy nói theo sự kiêu mạn chăng?” và lại hỏi: Yo hoti (người nào có).
Tattha mānaṃ nu khoti so bhikkhu mānaṃ upagantvā mānavasena vadeyya nu khoti.
There, "Mānaṃ nu kho" means: might that bhikkhu, having approached conceit, speak due to conceit?
Ở đây, mānaṃ nu kho (có phải là kiêu mạn chăng) có nghĩa là: vị Tỳ-khưu ấy có rơi vào kiêu mạn và nói theo sự kiêu mạn chăng?
Atha bhagavā – ‘‘ayaṃ devatā khīṇāsavaṃ samānaṃ viya karotī’’ti cintetvā, ‘‘khīṇāsavassa navavidhopi māno pahīno’’ti dassento paṭigāthaṃ āha.
Then the Fortunate One, thinking, "This deity makes it seem as if the arahant (khīṇāsava) has conceit," and showing that "the nine kinds of conceit are abandoned for an arahant," spoke the counter-verse.
Rồi Thế Tôn suy nghĩ: “Vị thiên nhân này đang xem một vị A-la-hán như thể còn kiêu mạn,” và để chỉ ra rằng “chín loại kiêu mạn đều đã được đoạn trừ đối với một vị A-la-hán,” Ngài đã đáp lại bằng kệ ngôn.
Tattha vidhūpitāti vidhamitā.
There, vidhūpitā means dispelled.
Ở đây, vidhūpitā có nghĩa là đã được xua tan.
Mānaganthassāti mānā ca ganthā ca assa.
Mānaganthassa means conceit and fetters are his.
Mānaganthassā có nghĩa là có kiêu mạn và các kiết sử.
Maññatanti maññanaṃ.
Maññataṃ means the act of conceiving.
Maññataṃ có nghĩa là sự tưởng tri (maññana).
Tividhampi taṇhā-diṭṭhi-māna-maññanaṃ so vītivatto, atikkantoti attho.
He has transcended (vītivatto) the three kinds of conceiving: craving (taṇhā), wrong view (diṭṭhi), and conceit (māna); this is the meaning.
Vị ấy đã vượt qua, đã vượt lên trên ba loại tưởng tri (maññana) là tham ái, tà kiến và kiêu mạn; đó là ý nghĩa.
Sesaṃ uttānatthamevāti.
The rest is of obvious meaning.
Phần còn lại có nghĩa rõ ràng.
Pañcamaṃ.
The Fifth.
Thứ năm.
26. Chaṭṭhe puṭṭhunti pucchituṃ.
In the sixth (sutta), puṭṭhuṃ means to ask.
Trong kinh thứ sáu, puṭṭhuṃ có nghĩa là để hỏi.
Kathaṃ jānemūti kathaṃ jāneyyāma.
Kathaṃ jānemu means: How might we know?
Kathaṃ jānemū có nghĩa là làm sao chúng ta có thể biết?
Divārattinti divā ca rattiñca.
Divārattiṃ means day and night.
Divārattiṃ có nghĩa là ngày và đêm.
Tattha tatthāti yattha yattheva pajjalito hoti, tattha tattha.
Tattha tattha means wherever it shines, there, there.
Tattha tatthā có nghĩa là bất cứ nơi nào ánh sáng bùng cháy, ở đó.
Esā ābhāti esā buddhābhā.
Esā ābhā means this is the Buddha's radiance.
Esā ābhā có nghĩa là ánh sáng của chư Phật này.
Katamā pana sāti?
But what is it?
Vậy đó là gì?
Ñāṇāloko vā hotu pītiāloko vā pasādāloko vā dhammakathāāloko vā, sabbopi buddhānaṃ pātubhāvā uppanno āloko buddhābhā nāma.
Whether it be the light of knowledge (ñāṇāloka), or the light of joy (pītiāloka), or the light of serenity (pasādāloka), or the light of Dhamma teaching (dhammakathāāloka), all light that arises from the manifestation of the Buddhas is called buddhābhā.
Dù đó là ánh sáng của trí tuệ, ánh sáng của hỷ lạc, ánh sáng của tịnh tín, hay ánh sáng của Pháp thoại, tất cả ánh sáng phát sinh từ sự xuất hiện của chư Phật đều được gọi là buddhābhā (ánh sáng của chư Phật).
Ayaṃ anuttarā sabbaseṭṭhā asadisāti.
This is unsurpassed, supreme among all, incomparable.
Đây là vô thượng, tối thắng trong tất cả, không gì sánh bằng.
Chaṭṭhaṃ.
The Sixth.
Thứ sáu.
28. Aṭṭhame nidhānagataṃ muttasārādi mahantaṃ dhanametesanti mahaddhanā.
In the eighth (sutta), mahaddhanā means those who possess great wealth, such as pearls and gems, stored as treasure.
Trong kinh thứ tám, những người có tài sản lớn như ngọc trai, đá quý được cất giấu, được gọi là mahaddhanā (giàu có).
Suvaṇṇarajatabhājanādi mahābhogo etesanti mahābhogā.
Mahābhogā means those who possess great enjoyments, such as gold and silver vessels.
Những người có tài sản lớn như đồ dùng bằng vàng bạc, được gọi là mahābhogā (có nhiều của cải).
Aññamaññābhigijjhantīti aññamaññaṃ abhigijjhanti patthenti pihenti.
Aññamaññābhigijjhanti means they covet, long for, and desire each other's possessions.
Aññamaññābhigijjhantī có nghĩa là họ khao khát, mong muốn, và thèm muốn tài sản của nhau.
Analaṅkatāti atittā apariyattajātā.
Analaṅkatā means unsatisfied, unfulfilled.
Analaṅkatā có nghĩa là không thỏa mãn, không bao giờ đủ.
Ussukkajātesūti nānākiccajātesu anuppannānaṃ rūpādīnaṃ uppādanatthāya uppannānaṃ anubhavanatthāya ussukkesu.
Ussukkajātesu means those who are diligent, active in various tasks for the production of unproduced forms (rūpādis) and for the experience of those already produced.
Ussukkajātesū có nghĩa là những người bận rộn với nhiều công việc khác nhau, nỗ lực để tạo ra những thứ chưa có như sắc pháp, và để trải nghiệm những thứ đã có.
Bhavasotānusārīsūti vaṭṭasotaṃ anusarantesu.
Bhavasotānusārīsu means those who follow the current of existence (vaṭṭasota).
Bhavasotānusārīsū có nghĩa là những người theo dòng luân hồi.
Anussukāti avāvaṭā.
Anussukā means not diligent, not busy.
Anussukā có nghĩa là không bận rộn.
Agāranti mātugāmena saddhiṃ gehaṃ.
Agāraṃ means a home with a woman.
Agāraṃ có nghĩa là một ngôi nhà cùng với một người phụ nữ.
Virājiyāti virājetvā.
Virājiyā means having abandoned attachment.
Virājiyā có nghĩa là đã thoát ly.
Sesaṃ uttānamevāti.
The rest is obvious.
Phần còn lại có nghĩa rõ ràng.
Aṭṭhamaṃ.
The Eighth.
Thứ tám.
29. Navame catucakkanti catuiriyāpathaṃ.
In the ninth (sutta), catucakkaṃ means the four postures.
Trong kinh thứ chín, catucakkaṃ có nghĩa là bốn oai nghi.
Iriyāpatho hi idha cakkanti adhippeto.
For here, posture (iriyāpatha) is intended as a wheel (cakka).
Ở đây, oai nghi được hiểu là bánh xe.
Navadvāranti navahi vaṇamukhehi navadvāraṃ.
Navadvāraṃ means the body with nine doors, through the nine openings of wounds.
Navadvāraṃ có nghĩa là chín cánh cửa, qua chín lỗ hở của vết thương.
Puṇṇanti asucipūraṃ.
Puṇṇaṃ means full of impurity.
Puṇṇaṃ có nghĩa là đầy những thứ bất tịnh.
Lobhena saṃyutanti taṇhāya saṃyuttaṃ.
Lobhena saṃyuttaṃ means bound by craving (taṇhā).
Lobhena saṃyutaṃ có nghĩa là bị trói buộc bởi tham ái.
Kathaṃ yātrā bhavissatīti etassa evarūpassa sarīrassa kathaṃ niggamanaṃ bhavissati, kathaṃ mutti parimutti samatikkamo bhavissatīti pucchati.
Kathaṃ yātrā bhavissati means how will there be an escape from such a body? How will there be release, complete liberation, transcendence? This is what is asked.
Kathaṃ yātrā bhavissatī (làm sao có thể đi qua) có nghĩa là hỏi: làm sao thân thể như vậy có thể thoát ra, làm sao có thể giải thoát, giải thoát hoàn toàn, vượt qua?
Naddhinti upanāhaṃ, pubbakāle kodho, aparakāle upanāhoti evaṃ pavattaṃ balavakodhanti attho.
Naddhiṃ means resentment (upanāha); in early times it is anger (kodha), later it is resentment (upanāha); thus, it refers to strong anger that arises in this way.
Naddhiṃ có nghĩa là sự thù hận, sự phẫn nộ mạnh mẽ phát sinh như sự giận dữ ban đầu và sự thù hận sau đó; đó là ý nghĩa.
Varattanti ‘‘chetvā naddhi varattañca, sandānaṃ sahanukkama’’nti gāthāya (dha. pa. 398; su. ni. 627) taṇhā varattā, diṭṭhi sandānaṃ nāma jātaṃ.
Varattaṃ means: in the verse, "Having cut off resentment (naddhi) and the thong (varatta), and the bond (sandāna) together with the underlying tendencies (anukkama)," craving is called varattā, and wrong view (diṭṭhi) is called sandānaṃ.
Varattaṃ: Trong kệ ngôn (Dhp. 398; Sn. 627) “Chetvā naddhi varattañca, sandānaṃ sahanukkamaṃ” (Đoạn trừ thù hận, dây trói, và dây buộc cùng với sự tùy miên), tham ái được gọi là varattā, và tà kiến được gọi là sandānaṃ.
Idha pana pāḷiniddiṭṭhe kilese ṭhapetvā avasesā ‘‘varattā’’ti veditabbā, iti kilesavarattañca chetvāti attho.
Here, however, setting aside the defilements specifically mentioned in the Pāḷi, the remaining defilements (such as wrong view and doubt) are to be understood as varattā; thus, it means having cut off the thongs of defilements.
Tuy nhiên, ở đây, ngoài các phiền não được đề cập trong Pāḷi, các phiền não còn lại được hiểu là varattā; đó là ý nghĩa của việc đoạn trừ dây trói phiền não.
Icchā lobhanti ekoyeva dhammo icchanaṭṭhena icchā, lubbhanaṭṭhena lobhoti vutto.
Icchā lobhaṃ means that it is one and the same phenomenon, called icchā in the sense of desiring, and lobha in the sense of coveting.
Icchā lobhaṃ có nghĩa là cùng một pháp được gọi là icchā (mong muốn) theo nghĩa mong cầu, và lobha (tham ái) theo nghĩa ham muốn.
Paṭhamuppattikā vā dubbalā icchā, aparāparuppattiko balavā lobho.
Alternatively, weak desire (lobha) that arises first is icchā, while strong attachment (lobha) that arises repeatedly is lobha.
Hoặc, icchā là sự mong muốn yếu ớt xuất hiện lần đầu, còn lobha là sự tham ái mạnh mẽ xuất hiện lặp đi lặp lại.
Aladdhapatthanā vā icchā, paṭiladdhavatthumhi lobho.
Alternatively, wishing for what is not yet obtained is icchā, while attachment to what is already obtained is lobha.
Hoặc, icchā là sự khao khát những thứ chưa đạt được, còn lobha là sự tham ái đối với những thứ đã đạt được.
Samūlaṃ taṇhanti avijjāmūlena samūlakaṃ taṇhaṃ.
Samūlaṃ taṇhaṃ means craving (taṇhā) with its root, with ignorance (avijjā) as its root.
Samūlaṃ taṇhaṃ có nghĩa là tham ái tận gốc rễ, với vô minh làm gốc rễ.
Abbuyhāti aggamaggena uppāṭetvā.
Abbuyhā means having uprooted by the Noble Path (aggamagga).
Abbuyhā có nghĩa là nhổ tận gốc bằng đạo lộ tối thượng.
Sesaṃ uttānamevāti.
The rest is obvious.
Phần còn lại có nghĩa rõ ràng.
Navamaṃ.
The Ninth.
Thứ chín.