176. Kālaparicchedaṃ katvāti samāpajjantehi nāma kālaparicchedo kātabbo.
The elucidation of the hidden meanings in the commentary on the Saṅkhārupapattisutta is concluded.
176. Kālaparicchedaṃ katvā (sau khi định thời gian) – những người nhập định phải định thời gian.
Thero pana bhagavato vattakaraṇatthaṃ kālaparicchedaṃ karoti, ‘‘ettake kāle vītivatte idaṃ nāma bhagavato kātabba’’nti.
The commentary on the Anupadavagga is finished.
Tuy nhiên, vị Trưởng lão định thời gian để thực hiện phận sự cho Đức Thế Tôn, rằng: "Sau khi thời gian này trôi qua, điều này phải được thực hiện cho Đức Thế Tôn."
So tatthakaṃyeva samāpattiṃ samāpajjitvā vuṭṭhāti, taṃ sandhāya vuttaṃ ‘‘kālaparicchedaṃ katvā’’ti.
3. Suññatavagga
Vị ấy nhập định trong khoảng thời gian đó rồi xuất định, ý nghĩa đó được nói đến khi nói "sau khi định thời gian".
Suññatāphalasamāpattiṃ appetvāti etena itare, ‘‘na sotāpannasakadāgāmī phalasamāpattiṃ samāpajjantī’’ti vadanti, taṃ vādaṃ paṭisedheti.
1. Cūḷasuññatasuttavaṇṇanā
Suññatāphalasamāpattiṃ appetvā (sau khi an trú vào quả định Không) – bằng điều này, bác bỏ luận điểm của những người khác nói rằng: "Bậc Dự Lưu và Nhất Lai không nhập quả định."
Suññatoti attasuññato ca niccasuññato ca saṅkhārā upaṭṭhahiṃsu.
176. " Having made a time limit": Those who enter jhāna should make a time limit.
Suññato (không) – các hành hiện hữu là không có tự ngã và không thường còn.
Sekkhānañhi suññatāpaṭivedho pādesiko subhasukhasaññānaṃ appahīnattā, tasmā so thero suññatākathaṃ sotukāmo jāto.
However, the Elder makes a time limit to attend to the Blessed One, thinking, "When this much time has passed, such and such should be done for the Blessed One."
Thật vậy, sự thể nhập tánh Không của các bậc Hữu Học là cục bộ, vì các tưởng tịnh và lạc chưa được đoạn trừ; do đó, vị Trưởng lão đó muốn nghe về tánh Không.
Dhurena dhuraṃ paharantena viyāti rathadhurena rathadhuraṃ paharantena viya katvā ujukameva suññatā…pe… vatthuṃ na sakkāti yojanā.
He enters that much concentration and emerges from it; it is with reference to this that it is said, "having made a time limit."
Dhurena dhuraṃ paharantena viyā (như đòn xe này đụng đòn xe kia) – nghĩa là: không thể đi thẳng vào đối tượng Không… vân vân… như đòn xe này đụng đòn xe kia.
Ekaṃ padanti ekaṃ suññatāpadaṃ.
By " Having attained the fruition of emptiness (suññatāphala-samāpatti)," he refutes the view of others who say, "Stream-enterers and Once-returners do not attain the fruition of concentration."
Ekaṃ padaṃ (một từ) – một từ về tánh Không.
Pubbepāhantiādinā bhagavā paṭhamabodhiyampi attano suññatāvihārabāhullaṃ pakāsetīti dassento ‘‘paṭhamabodhiyampī’’ti āha.
" Empty" means that formations arose, empty of self and empty of permanence.
Bằng cách nói "trước đây cũng đã nói" vân vân, để chỉ ra rằng Đức Thế Tôn đã tuyên bố sự thường xuyên an trú vào Không của Ngài ngay cả trong giai đoạn giác ngộ đầu tiên, nên đã nói "ngay cả trong giai đoạn giác ngộ đầu tiên".
Ekotiādi therassa suññatākathāya bhājanabhāvadassanatthaṃ.
For trainees (sekkhā), the penetration of emptiness is partial, due to the non-abandonment of perceptions of pleasantness and happiness; therefore, that Elder became desirous of hearing about emptiness.
Eko (một mình) vân vân – để chỉ ra rằng vị Trưởng lão là người thích hợp để nghe về tánh Không.
Sotunti aṭṭhiṃ katvā manasi katvā sabbacetasā samannāharitvā sotumpi.
" As if striking pole to pole" (dhurena dhuraṃ paharantena viya) means that it is not possible to directly address the subject of emptiness as if striking pole to pole of a chariot.
Sotuṃ (để nghe) – cũng là để nghe với sự chú tâm, quán niệm, tập trung toàn bộ tâm ý.
Uggahetumpiti yathābhūtaṃ dhammaṃ dhāraṇaparipucchāparicayavasena hadayena uggahitaṃ suvaṇṇabhājane pakkhittasīhavasā viya avinaṭṭhe kātumpi.
" One word" means one word related to emptiness.
Uggahetumpi (để nắm giữ) – cũng là để giữ gìn giáo pháp như thật đã được nắm giữ trong tâm bằng cách ghi nhớ, hỏi han và thực hành, giống như mỡ sư tử được đựng trong bình vàng không bị hư mất.
Kathetumpīti vitthārena paresaṃ dassetumpi sakkā.
By " I have said before," and so on, the Buddha proclaims his frequent abiding in the emptiness-abiding even during his first enlightenment (paṭhamabodhi), thus it is said: " Even during his first enlightenment."
Kathetumpi (để thuyết giảng) – cũng có thể trình bày chi tiết cho người khác.
Tatthāti migāramātupāsāde.
" Alone," and so on, is to show that the Elder is fit to receive the discourse on emptiness.
Tatthā (ở đó) – tại giảng đường Migāramātupāsāda.
Kaṭṭharūpapotthakarūpacittarūpavasena katāti thambhādīsu uttiritvā katānaṃ kaṭṭharūpānaṃ, niyyūhādīsu paṭimāvasena racitānaṃ potthakarūpānaṃ, sittipasse cittakammavasena viracitānaṃ cittarūpānañca katā niṭṭhapitā.
" To listen" means to listen with full attention, paying heed, with all one's mind, and being fully present.
Kaṭṭharūpapotthakarūpacittarūpavasena katā (được làm bằng hình tượng gỗ, hình tượng vẽ, hình tượng điêu khắc) – được làm và hoàn thành bằng các hình tượng gỗ được chạm khắc trên các cột vân vân, các hình tượng vẽ được tạo hình như tượng trên các đầu hồi vân vân, và các hình tượng điêu khắc được vẽ trên các bức tường.
Vessavaṇamandhātādīnanti paṭimārūpena katānaṃ vessavaṇamandhātusakkādīnaṃ.
" To grasp" means to retain the Dharma as it truly is, through memorization, inquiry, and frequent practice, and to keep it intact in one's heart, like lion's fat placed in a gold vessel.
Vessavaṇamandhātādīnaṃ (của Vessavaṇa, Mandhātā vân vân) – của Vessavaṇa, Mandhātā, Sakka vân vân, được làm dưới dạng tượng.
Cittakammavasenāti ārāmādicittakammavasena.
" To explain" means it is possible to demonstrate it to others in detail.
Cittakammavasenā (bằng cách vẽ tranh) – bằng cách vẽ tranh các khu vườn vân vân.
Saṇṭhitampīti avayavabhāvena saṇṭhitaṃ hutvā ṭhitampi.
" There" refers to Migāramātu's Palace.
Saṇṭhitampī (ngay cả khi được sắp xếp) – ngay cả khi được sắp xếp thành các bộ phận và đứng vững.
Jiṇṇapaṭisaṅkharaṇatthanti jiṇṇānaṃ niyyūhakūṭāgārapāsādāvayavānaṃ abhisaṅkharaṇatthāya tasmiṃ tasmiṃ ṭhāne rahassasaññāṇena ṭhapitaṃ.
" Made in the manner of wooden figures, plastered figures, and painted figures" refers to the wooden figures made by carving on pillars and so on, the plastered figures formed as statues on cornices and so on, and the painted figures depicted as paintings on walls, all completed.
Jiṇṇapaṭisaṅkharaṇattha (để sửa chữa những hư hỏng) – được cất giữ ở những nơi bí mật bằng trí tuệ để sửa chữa các bộ phận hư hỏng của các đầu hồi, gác mái, giảng đường vân vân.
‘‘Paribhuñjissāmī’’ti tasmiṃ tasmiṃ kicce viniyuñjanavasena paribhuñjitabbassa.
" Of Vessavaṇa, Mandhātu, etc." refers to Vessavaṇa, Mandhātu, Sakka, and so on, made in the form of statues.
Paribhuñjitabbassa (của cái đáng được hưởng dụng) – bằng cách sử dụng vào các công việc đó, với ý nghĩ "ta sẽ hưởng dụng".
Etaṃ vuttanti, ‘‘ayaṃ migāramātupāsādo suñño’’tiādikaṃ vuttaṃ.
" By way of painting" means by way of painting monasteries and so on.
Etaṃ vutta (điều này đã được nói) – "Giảng đường Migāramātupāsāda này trống rỗng" vân vân, đã được nói.
Niccanti sabbakālaṃ rattiñca divā ca.
" That which is established" means that which remains established as a component part.
Niccaṃ (luôn luôn) – mọi lúc, cả ngày lẫn đêm.
Ekabhāvaṃ ekaṃ asuññatanti paccatte upayogavacanaṃ, ekattaṃ eko asuññatoti attho.
" For renovation of what is old" refers to what was placed with secret knowledge in various places for the renovation of old components such as cornices, pinnacles, and palace parts.
Ekabhāvaṃ ekaṃ asuññataṃ (một trạng thái, một không trống rỗng) – đây là cách dùng từ chỉ sự sở hữu, ý nghĩa là "một sự duy nhất, một sự không trống rỗng".
Gāmoti pavattanavasenāti gehasannivesavīthicaccarasiṅghāṭakādike upādāya gāmoti lokuppattivasena.
" To be enjoyed" means for the purpose of utilizing it for various tasks, with the thought, "I will enjoy this."
Gāmo (làng) ti pavattanavasenā (theo cách vận hành) – theo cách vận hành của thế gian, dựa trên các khu nhà ở, đường sá, ngã tư, quảng trường vân vân, được gọi là làng.
Kilesavasenāti tattha anunayapaṭighavasena.
" This was said," means "This Migāramātu's Palace is empty," and so on, was said.
Kilesavasenā (theo cách phiền não) – theo cách tham ái và sân hận ở đó.
Eseva nayoti iminā ‘‘pavattavasena vā kilesavasena vā uppannaṃ manussasañña’’nti imamatthaṃ atidisati.
" Always" means at all times, day and night.
Eseva nayo (cũng theo cách này) – điều này mở rộng ý nghĩa "tưởng về con người phát sinh theo cách vận hành hoặc theo cách phiền não".
Ettha ca yathā gāmaggahaṇena gharādisaññā saṅgahitā, evaṃ manussaggahaṇena itthipurisādisaññā saṅgahitā.
" A single state, a single non-emptiness" is an application of the locative case (upayoga-vacana) to express individuality, meaning "unity is a single non-emptiness."
Ở đây, cũng như với từ "làng" bao gồm tưởng về nhà cửa vân vân, thì với từ "con người" bao gồm tưởng về đàn ông, đàn bà vân vân.
Yasmā rukkhādike paṭicca araññasaññā tattha pabbatavanasaṇḍādayo antogadhā, tasmā tattha vijjamānampi taṃ vibhāgaṃ aggahetvā ekaṃ araññaṃyeva paṭicca araññasaññaṃ manasi karoti.
" Village (Gāma)" means by way of arising in the world, referring to settlements, streets, crossroads, squares, and so on, by way of their continuation.
Vì tưởng về rừng dựa trên cây cối vân vân, và trong đó bao gồm núi, rừng cây vân vân, nên ở đó, không nắm giữ sự phân biệt đó, mà chỉ chú tâm vào một tưởng về rừng dựa trên chính rừng.
Otaratīti anuppavisati.
" By way of defilements" means by way of attachment and aversion there.
Otaratī (đi vào) – thâm nhập.
Adhimuccatīti nicchinoti.
" The same method" means it extends this meaning: "the perception of humans that has arisen either by way of arising or by way of defilements."
Adhimuccatī (quyết định) – xác định.
Pavattadarathāti tathārūpāya passaddhiyā abhāvato oḷārikadhammappavattisiddhā darathā.
Here, just as the apprehension of a village includes the perception of houses and so on, so too the apprehension of humans includes the perception of men, women, and so on.
Pavattadarathā (sự bận tâm về sự vận hành) – sự bận tâm phát sinh do sự hiện hữu của các pháp thô thiển vì không có sự an tịnh như vậy.
Kilesadarathāti anunayapaṭighasambhavā kilesadarathā.
Because the perception of a forest, based on trees and so on, includes mountains, groves, and so on, present there, one attends to the perception of a forest based on a single forest, without apprehending that division.
Kilesadarathā (sự bận tâm về phiền não) – sự bận tâm về phiền não phát sinh từ tham ái và sân hận.
Dutiyapadeti ‘‘ye assu darathā manussasaññaṃ paṭiccā’’ti imasmiṃ pade.
" He enters" means he penetrates.
Dutiyapade (trong câu thứ hai) – trong câu "ye assu darathā manussasaññaṃ paṭiccā" (những sự bận tâm nào phát sinh do tưởng về con người).
Manasikārasantatāya, – ‘‘nāyaṃ pubbe viya oḷārikā, dhammappavattī’’ti saṅkhāradassanadarathānaṃ sukhumatā sallahukatā ca caritatthāti āha ‘‘pavattadarathamattā atthī’’ti.
" He determines" means he ascertains.
Do sự liên tục của tác ý, sự tinh tế và nhẹ nhàng của sự bận tâm về các hành và sự bận tâm về sự vận hành được thực hiện, rằng "sự vận hành của các pháp này không còn thô thiển như trước", vì vậy đã nói "chỉ có sự bận tâm về sự vận hành".
Yaṃ kilesadarathajātaṃ, taṃ imissā darathasaññāya na hotīti yojanā.
Whatever distress born of defilements arises, that does not occur with this perception of distress—this is the connection.
Điều phiền não khổ não sanh khởi, điều ấy không còn do tưởng khổ não này, là cách kết hợp.
Pavattadarathamattaṃ avasiṭṭhaṃ hoti, vijjamānameva atthi idanti pajānātīti yojanā.
Only the arisen distress remains; one understands that this exists as it is present—this is the connection.
Chỉ có sự khổ não hiện hành còn lại, biết rõ rằng điều này chỉ có thật sự hiện hữu, là cách kết hợp.
Suññatā nibbattīti suññatanti pavatti.
"The arising of emptiness" means emptiness is the arising.
Sự phát sanh của tánh không (Suññatā nibbattī) nghĩa là tánh không là sự hiện hành.
Suññatā sahacaritañhi suññaṃ, idha suññatāti vuttā.
Emptiness is indeed accompanied by the void; here it is called emptiness.
Thật vậy, cái gì cùng tồn tại với tánh không là không, ở đây được gọi là tánh không.
177. Assāti bhagavato evaṃ idāni vuccamānākārena cittappavatti ahosi.
177. "To him" means the mind-process of the Blessed One was thus, in the manner now being stated.
177. Của Ngài ấy (Assā) nghĩa là của Đức Thế Tôn, như vậy (evaṃ) nghĩa là sự vận hành của tâm đã xảy ra theo cách thức đang được nói đến bây giờ.
Accantasuññatanti ‘‘paramānuttara’’nti vuttaṃ arahattaṃ desessāmīti.
"Utter emptiness" means, "I shall teach arahatta, which is said to be 'supreme and unsurpassed'."
Tánh không tuyệt đối (Accantasuññataṃ) nghĩa là “vô thượng tối cao” (paramānuttaraṃ) là A-la-hán quả mà tôi sẽ thuyết giảng.
Araññasaññāya visesānadhigamanatoti, ‘‘araññaṃ arañña’’nti manasikārena jhānādivisesassa adhigamābhāvato, ‘‘pathavī’’ti manasikārena visesādhigamanato.
"Because no distinction is attained through the perception of a wilderness" means due to the non-attainment of distinctions like jhānas through the advertence "wilderness, wilderness,"* due to the attainment of distinction through the advertence "earth."
Do không đạt được sự thù thắng của tưởng khu rừng (Araññasaññāya visesānadhigamanato) nghĩa là do không đạt được sự thù thắng của thiền định v.v… bằng cách tác ý “khu rừng, khu rừng”, nhưng đạt được sự thù thắng bằng cách tác ý “đất” (pathavī).
Idāni tamevatthaṃ upamāya vibhāvetuṃ ‘‘yathā hī’’tiādi vuttaṃ.
Now, to illustrate that very meaning with an analogy, "just as" and so on was stated.
Bây giờ, để làm rõ ý nghĩa đó bằng ví dụ, đã nói “ví như” (yathā hi) v.v…
Evaṃ santeti evaṃ vapite sāliādayo sampajjanti.
"This being so" means when sown in this way, rice and so on come to fruition.
Khi đã như vậy (Evaṃ sante) nghĩa là khi đã gieo như vậy, lúa v.v… sanh khởi (sampajjanti).
Dhuvasevananti niyatasevanaṃ pārihāriyakammaṭṭhānaṃ.
"Constant practice" means regular practice, a protective meditation subject.
Sự thực hành thường xuyên (Dhuvasevanaṃ) là sự thực hành nhất định, là đề mục thiền định bảo hộ.
Paṭiccāti ettha ‘‘sambhūta’’nti vacanaseso icchitoti āha ‘‘paṭicca sambhūta’’nti.
"Dependent upon": here the remainder of the phrase "produced" is intended, so he says, "produced dependent upon."
Ở đây, trong từ “nương vào” (paṭiccā), muốn có phần còn lại của câu là “sanh khởi” (sambhūtaṃ), nên đã nói “sanh khởi do nương vào” (paṭicca sambhūtaṃ).
Pathaviṃ paṭicca sambhūtā hi saññāti.
For indeed, perception is produced dependent upon the earth.
Thật vậy, tưởng sanh khởi do nương vào đất.
Pathavīkasiṇe so pathavīsaññī hoti, na pakatipathaviyaṃ.
In the earth kasiṇa, he has the perception of earth, not in the ordinary earth.
Trong địa biến xứ (pathavīkasiṇe) vị ấy có tưởng về đất (so pathavīsaññī hoti), không phải trong đất thông thường.
Tassāti pathavīkasiṇassa.
"Of that" refers to the earth kasiṇa.
Của nó (Tassā) nghĩa là của địa biến xứ.
Tehīti gaṇḍādīhi.
"By those" refers to lumps and so on.
Bởi những thứ ấy (Tehi) nghĩa là bởi những cục đất v.v…
Suṭṭhu vihatanti yathā valīnaṃ lesopi na hoti, evaṃ sammadeva ākoṭitaṃ.
"Thoroughly beaten" means completely pounded so that not even a trace of folds remains.
Đã được đập nát kỹ lưỡng (Suṭṭhu vihataṃ) nghĩa là đã được đập nát hoàn toàn đến mức không còn một chút nếp nhăn nào.
Nadītaḷākādīnaṃ tīrappadeso udakassa ākaraṭṭhena kūlaṃ, unnatabhāvato uggataṃ kūlaṃ viyāti ukkūlaṃ, bhūmiyā uccaṭṭhānaṃ.
The riverbank region of rivers, lakes, etc., is a bank by being a source of water, and because it is raised, it is like a raised bank, hence ukkūlaṃ (raised bank), a high place of the ground.
Phần bờ sông, hồ v.v… là bờ (kūlaṃ) do là nơi chứa nước, là chỗ cao của đất giống như bờ nhô cao, nên gọi là ukkūlaṃ (chỗ đất cao).
Vigataṃ kūlanti vikkūlaṃ, nīcaṭṭhānaṃ.
A bank devoid of, hence vikkūlaṃ (uneven bank), a low place.
Bờ đã mất (vigataṃ kūlaṃ) là vikkūlaṃ (chỗ đất thấp).
Tenāha ‘‘uccanīca’’nti.
Therefore he says "high and low."
Vì thế đã nói “cao thấp” (uccanīcaṃ).
Ekaṃ saññanti ekaṃ pathavītisaññaṃyeva.
"One perception" means only one perception of earth.
Một tưởng (Ekaṃ saññaṃ) nghĩa là chỉ một tưởng về đất.
183. Vipassanāya paṭivipassananti dhammānañca puna vipassanaṃ.
183. "Insight into insight" means further insight into phenomena.
183. Sự quán lại trong tuệ quán (Vipassanāya paṭivipassanaṃ) nghĩa là sự quán lại các pháp.
Idhāti attano paccakkhabhūtayathādhigatamaggaphalaṃ vadatīti āha – ‘‘ariyamagge ceva ariyaphale cā’’ti.
"Here" means he speaks of the path and fruit directly experienced and attained by oneself, so he says, "in the Noble Path and the Noble Fruit."
Ở đây (Idha) nghĩa là vị ấy nói về đạo quả mà mình đã chứng đắc trực tiếp, nên đã nói – “trong Thánh đạo và Thánh quả” (ariyamagge ceva ariyaphale ca).
Upādisesadarathadassanatthanti sabbaso kilesupadhiyā pahīnāya khandhopadhi avisiṭṭhā, tappaccayā darathā upādisesadarathā, taṃ dassanatthaṃ.
"For showing the distress of remaining substrata" means when the defilement-substrata are completely abandoned, the khandha-substrata are not distinct; the distress caused by that is the distress of remaining substrata, to show that.
Để thấy sự khổ não còn dư y (Upādisesadarathadassanatthaṃ) nghĩa là khi mọi phiền não và chấp thủ đã được đoạn trừ hoàn toàn, thì chấp thủ về uẩn không khác, những khổ não phát sanh do đó là khổ não còn dư y, để thấy điều đó.
Yasmā visayato gāmasaññā oḷārikā, manussasaññā sukhumā, tasmā manussasaññāya gāmasaññaṃ nivattetvā.
Since village perception is gross in terms of object, and human perception is subtle, therefore having eliminated village perception by human perception.
Bởi vì tưởng làng thô thiển hơn tưởng người về mặt đối tượng, nên sau khi đoạn trừ tưởng làng bằng tưởng người (manussasaññāya gāmasaññaṃ nivattetvā).
Yasmā pana manussasaññāpi sabhāgavatthupariggahato oḷārikā, sabhāgavatthuto araññasaññā sukhumā, tasmā araññasaññāya manussasaññaṃ nivattetvā.
However, since human perception is also gross due to grasping objects of its own kind, and wilderness perception is subtle compared to objects of its own kind, therefore having eliminated human perception by wilderness perception.
Nhưng bởi vì tưởng người cũng thô thiển do nắm giữ đối tượng tương đồng, còn tưởng khu rừng vi tế hơn đối tượng tương đồng, nên sau khi đoạn trừ tưởng người bằng tưởng khu rừng (araññasaññāya manussasaññaṃ nivattetvā).
Pathavīsaññādinivattane kāraṇaṃ heṭṭhā suttantaresu ca vuttameva.
The reason for eliminating earth perception and so on has already been stated in other suttas below.
Nguyên nhân của việc đoạn trừ tưởng đất v.v… đã được nói trong các kinh khác ở dưới.
Anupubbenāti maggappaṭipāṭiyā.
"Gradually" means in the sequence of the path.
Theo thứ tự (Anupubbena) nghĩa là theo thứ tự của đạo.
Niccasārādīnaṃ sabbaso avatthutāya accantameva suññattā accantasuññatā.
Because permanence, essence, and so on are completely without substance, being utterly void, it is "utter emptiness."
Do hoàn toàn không có đối tượng của thường hằng v.v… nên hoàn toàn trống rỗng, gọi là tánh không tuyệt đối (accantasuññatā).
184. Suññataphalasamāpattinti suññatavimokkhassa phalabhūtattā, suññatānupassanāya vasena samāpajjitabbattā ca suññataphalasamāpattinti laddhanāmaṃ arahattaphalasamāpattiṃ.
184. "Accomplishment of the fruit of emptiness" refers to the accomplishment of the fruit of arahatta, which is named the accomplishment of the fruit of emptiness because it is the fruit of the emptiness liberation, and because it is to be attained by way of insight into emptiness.
184. Định quả tánh không (Suññataphalasamāpattiṃ) nghĩa là định quả A-la-hán, được gọi là định quả tánh không do là quả của giải thoát tánh không và do được nhập bằng cách quán tánh không.
Yasmā atīte paccekasambuddhā ahesuṃ, anāgate bhavissanti, idāni pana buddhasāsanassa dharamānattā paccekabuddhā na vattanti, tasmā paccekabuddhaggahaṇaṃ akatvā, ‘‘etarahipi buddhabuddhasāvakasaṅkhātā’’icceva vuttaṃ.
Since Paccekabuddhas existed in the past and will exist in the future, but currently, as the Buddha's dispensation endures, Paccekabuddhas do not appear, therefore, not taking Paccekabuddhas, it was stated "even now those referred to as Buddhas and Buddha's disciples."
Bởi vì trong quá khứ đã có các vị Độc Giác Phật, trong tương lai sẽ có, nhưng hiện tại do giáo pháp của Đức Phật đang tồn tại nên không có các vị Độc Giác Phật, vì thế không nói đến việc thọ nhận Độc Giác Phật, mà chỉ nói “ngay cả bây giờ là các vị Phật và các vị đệ tử Phật” (etarahipi buddhabuddhasāvakasaṅkhātā) như vậy.
Na hi buddhasāsane dharante paccekabuddhā bhavanti.
For Paccekabuddhas do not appear while the Buddha's dispensation endures.
Thật vậy, khi giáo pháp của Đức Phật còn tồn tại thì không có các vị Độc Giác Phật.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
Yadi saṃsayo nāma natthi, ‘‘sambahulā nu kho’’ti idaṃ kathanti āha ‘‘vitakkapubbabhāgā’’tiādi.
If there is no doubt, how is "are there many?" stated? He says, "preceded by thought," and so on.
Nếu không có sự nghi ngờ, thì câu “Phải chăng có nhiều Tỳ-khưu ở đây?” (sambahulā nu kho) này là gì? Nên đã nói “là phần khởi đầu của tầm” (vitakkapubbabhāgā) v.v…
Tattha vitakko pubbabhāgo etissāti vitakkapubbabhāgā, pucchā.
Therein, that which is preceded by thought is "preceded by thought," a question.
Trong đó, cái gì có tầm là phần khởi đầu thì đó là phần khởi đầu của tầm (vitakkapubbabhāgā), là câu hỏi (pucchā).
Sā ‘‘sambahulā no ettha bhikkhūviharantī’’ti vacanaṃ, vitakko pana ‘‘sambahulā nu kho idha bhikkhū viharantī’’ti iminā ākārena tadā bhagavato uppanno cittasaṅkappo, tassa parivitakkassa tabbhāvajotanoyaṃ nu-kāro vuttoti dassento āha – ‘‘vitakkapubbabhāge cāyaṃ nu-kāro nipātamatto’’ti.
That statement "are there many bhikkhus dwelling here?" is a thought; the thought, however, is a mental conception that arose in the Blessed One at that time in the form "are there many bhikkhus dwelling here?"; indicating that this particle nu serves to highlight the nature of that reflection, he says, "and this particle nu in a thought-preceded statement is merely an intensifier."
Câu hỏi đó là lời nói “Phải chăng có nhiều Tỳ-khưu ở đây?” (sambahulā no ettha bhikkhū viharantī), còn tầm là tâm tư sanh khởi của Đức Thế Tôn lúc đó theo cách thức “Phải chăng có nhiều Tỳ-khưu ở đây?” (sambahulā nu kho idha bhikkhū viharantī), để chỉ ra rằng chữ “nu” này là một từ nghi vấn chỉ trạng thái của tầm đó, nên đã nói – “chữ ‘nu’ này chỉ là một từ nghi vấn trong phần khởi đầu của tầm” (vitakkapubbabhāge cāyaṃ nu-kāro nipātamatto).
Kiñcāpi gacchanto disvā, ‘‘sambahulā no ettha bhikkhū viharantī’’ti pucchāvasena bhagavatā vutto, atha kho ‘‘na kho, ānanda, bhikkhu sobhati saṅgaṇikārāmo’’tiādi (ma. ni. 3.185) uparidesanāvasena matthakaṃ gacchante avinicchito nāma na hoti, atha kho visuṃ vinicchito eva hoti, disvā nicchinitvāva kathāsamuṭṭhāpanatthaṃ tathā pucchati.
Although the Blessed One, seeing as he was going, stated "are there many bhikkhus dwelling here?" in the form of a question, it is not an undecided matter when it reaches its conclusion by way of the subsequent teaching "indeed, Ānanda, a bhikkhu does not shine who delights in company" and so on; rather, it is definitely decided; having seen and decided, he questions thus for the purpose of initiating the discourse.
Mặc dù Đức Thế Tôn đã nói câu “Phải chăng có nhiều Tỳ-khưu ở đây?” (sambahulā no ettha bhikkhū viharantī) như một câu hỏi sau khi thấy, nhưng khi đi đến phần kết thúc của lời dạy ở trên như “Này Ānanda, Tỳ-khưu không đẹp khi yêu thích tụ tập” (ma. ni. 3.185) v.v… thì không phải là chưa được quyết định, mà thật sự đã được quyết định rõ ràng, sau khi thấy và quyết định, Ngài hỏi như vậy để khởi đầu câu chuyện.
Tathā hi vuttaṃ – ‘‘jānantāpi tathāgatā pucchantī’’ti (pārā. 16).
For thus it is said, "Even those who know, Tathāgatas question."
Thật vậy, đã nói – “Các Như Lai hỏi dù đã biết” (pārā. 16).
Tenāha ‘‘ito kirā’’tiādi.
Therefore he says, "from here indeed," and so on.
Vì thế đã nói “chắc chắn từ đây” (ito kirā) v.v…
Yathā nadīotiṇṇaṃ udakaṃ yathāninnaṃ pakkhandati, evaṃ sattā dhātuso saṃsandanti, tasmā ‘‘gaṇavāso nadīotiṇṇaudakasadiso’’ti vuttaṃ.
Just as water that has entered a river flows downwards, so do beings associate according to their elements; therefore, "dwelling in company is like water that has entered a river" was stated.
Giống như nước chảy vào sông thì chảy theo chỗ trũng, các chúng sanh cũng hòa hợp theo chủng loại, vì thế đã nói “việc sống theo nhóm giống như nước chảy vào sông” (gaṇavāso nadīotiṇṇaudakasadiso).
Idāni tamatthaṃ vitthārato dassetuṃ – ‘‘nirayatiracchānayonī’’tiādi vuttaṃ.
Now, to show that meaning in detail, "hell, animal realm," and so on was stated.
Bây giờ, để trình bày ý nghĩa đó một cách chi tiết hơn, đã nói “cõi địa ngục, cõi súc sanh” (nirayatiracchānayonī) v.v…
Kuruvindādinhānīyacuṇṇāni saṇhasukhumabhāvato nāḷiyaṃ pakkhittāni nirantarāneva tiṭṭhantīti āha – ‘‘cuṇṇabharitā nāḷi viyā’’ti.
Powders for bathing, such as kuruvinda, being fine and subtle, remain compact when put into a tube, so he says, "like a tube filled with powder."
Bột tắm kuruvinda v.v… do mịn màng và vi tế nên khi cho vào ống thì chúng nằm sát nhau, vì thế đã nói – “giống như ống chứa đầy bột” (cuṇṇabharitā nāḷi viyā).
Sattapaṇṇāsa kulasatasahassānīti sattasatasahassādhikāni paññāsa kulānaṃyeva satasahassāni, manussānaṃ pana vasena satta koṭiyo tadā tattha vasiṃsu.
"Seven hundred and fifty thousand families" means five hundred thousand families plus seven hundred thousand; but in terms of people, seven crores dwelt there at that time.
Năm mươi bảy trăm ngàn gia đình (Sattapaṇṇāsa kulasatasahassāni) nghĩa là bảy trăm ngàn gia đình cộng thêm năm mươi trăm ngàn gia đình, nhưng lúc đó có bảy mươi triệu người sống ở đó.
Tato cintesi, kathaṃ?
Then he thought, how?
Từ đó Ngài suy nghĩ, suy nghĩ thế nào?
Kāmañcāyaṃ lokapakati, mayhaṃ pana sāsane ayuttova soti āha – ‘‘mayā’’tiādi.
Although this is the nature of the world, it is indeed inappropriate in my dispensation, so he says, "by me," and so on.
Mặc dù đây là bản chất của thế gian, nhưng trong giáo pháp của ta thì điều này không phù hợp, nên đã nói “do ta” (mayā) v.v…
Dhammanti sabhāvasiddhaṃ.
"The Dhamma" means naturally established.
Pháp (Dhammaṃ) nghĩa là cái đã được xác lập một cách tự nhiên.
Saṃvegoti sahottappañāṇaṃ vuccati.
"Sense of urgency" is called wisdom accompanied by remorse.
Sự xúc động (Saṃvego) được gọi là trí tuệ có kèm theo hổ thẹn.
Na kho panetaṃ sakkā gilānupaṭṭhānaovādānusāsaniādivasena samāgamassa icchitabbattā.
"But this is not possible" because company is desired for attending to the sick, giving advice, instructing, and so on.
Nhưng điều đó không thể được (Na kho panetaṃ sakkā) do mong muốn tụ tập để chăm sóc người bệnh, khuyên răn, giáo huấn v.v…
Gaṇabhedananti gaṇasaṅgaṇikāya vivecanaṃ.
"Breaking up the group" means separating from company, from association.
Sự chia rẽ nhóm (Gaṇabhedanaṃ) là sự tách rời khỏi việc tụ tập theo nhóm.
Sakagaṇena sahabhāvato saṅgaṇikāti āha ‘‘sakaparisasamodhāna’’nti.
Because of being with one's own group, it is "company," so he says, "gathering of one's own assembly."
Do ở cùng với nhóm của mình nên gọi là tụ tập (saṅgaṇikā), nên đã nói “sự tụ họp của đoàn thể của mình” (sakaparisasamodhānaṃ).
Gaṇoti pana idha janasamūhoti vuttaṃ ‘‘nānājanasamodhāna’’nti.
"Group" here, however, is said to be a multitude of people, so "gathering of various people" was stated.
Còn nhóm (Gaṇo) ở đây được nói là “sự tụ họp của nhiều người” (nānājanasamodhānaṃ).
Sobhati yathānusiṭṭhaṃ paṭipajjamānato.
Shines by practicing as instructed.
Rực rỡ do thực hành theo như đã được chỉ dạy.
Kāmato nikkhamatīti nikkhamo, evaṃ nikkhamavasena uppannaṃ sukhaṃ.
Departing from sensual pleasures is renunciation; the happiness thus arisen through renunciation.
Do thoát ly khỏi dục lạc nên gọi là sự thoát ly (nikkhamo); an lạc (sukhaṃ) phát sinh theo cách thoát ly như vậy.
Gaṇasaṅgaṇikākilesasaṅgaṇikāhi pavivitti paviveko.
Withdrawal from association with groups and association with defilements is seclusion.
Sự vắng lặng khỏi sự tụ tập đông người và sự tụ tập phiền não là sự độc cư (paviveko).
Pavivekavasena uppannaṃ sukhaṃ.
The happiness arisen by way of seclusion.
An lạc phát sinh theo cách độc cư.
Rāgādīnaṃ upasamāvahaṃ sukhaṃ upasamasukhaṃ.
The happiness that brings the cessation of lust and so forth is the happiness of tranquility.
An lạc mang lại sự tịnh chỉ tham ái và các phiền não khác là an lạc tịnh chỉ (upasamasukhaṃ).
Maggasambodhāvahaṃ sukhaṃ sambodhisukhaṃ.
The happiness that brings enlightenment of the path is the happiness of enlightenment.
An lạc mang lại sự giác ngộ đạo là an lạc giác ngộ (sambodhisukhaṃ).
Nikāmetabbassa, nikāmaṃ vā lābhī nikāmalābhī.
One who obtains what is desired, or obtains it at will, is nikāmalābhī.
Kẻ mong muốn, hoặc đạt được điều mình mong muốn là người đạt được như ý (nikāmalābhī).
Nidukkhaṃ sukheneva labhatīti adukkhalābhī.
One who obtains without suffering, but only with happiness, is adukkhalābhī.
Đạt được không đau khổ, chỉ bằng an lạc nên gọi là đạt được không đau khổ (adukkhalābhī).
Kasiraṃ vuccati appakanti āha – ‘‘akasiralābhīti vipulalābhī’’ti.
Kasira means little, hence it is said: "Akasiralābhī means one who obtains abundantly."
Kasira được gọi là ít ỏi, nên nói: “akasiralābhī nghĩa là đạt được dồi dào”.
Sāmāyikanti samaye kilesavimuccanaṃ accantamevāti sāmāyikaṃ ma-kāre a-kārassa dīghaṃ katvā.
Sāmāyika refers to the complete release from defilements at a particular time, by lengthening the a vowel in the ma syllable.
Sāmāyika là sự giải thoát khỏi phiền não tại thời điểm đó, hoàn toàn như vậy, bằng cách kéo dài nguyên âm ‘a’ trong âm ‘ma’.
Tenāha – ‘‘appitappitasamaye kilesehi vimutta’’nti.
Therefore, it is said: "released from defilements at each appointed time."
Vì thế, nói: “giải thoát khỏi phiền não tại những thời điểm đã được ấn định”.
Kantanti aṅgasantatāya ārammaṇasantatāya ca kamanīyaṃ manorammaṃ.
Kanta means desirable, delightful, due to the continuity of factors and continuity of objects.
Kanta là điều đáng mong muốn, đáng yêu thích do sự liên tục của các chi phần và sự liên tục của đối tượng.
Asāmāyikaṃ accantavimuttaṃ.
Asāmāyika means absolutely released.
Asāmāyika là sự giải thoát hoàn toàn.
Te paṭhamaṃ ‘‘saṅgaṇikārāmo’’tiādinā vibhāvetvā itaraṃ vibhāvetuṃ, ‘‘idāni dosuppattiṃ dassento’’tiādi vuttaṃ.
Having first explained the former with "delight in company" and so forth, in order to explain the latter, "now showing the arising of faults," and so forth, was said.
Trước tiên, sau khi giải thích loại thứ nhất bằng câu “saṅgaṇikārāmo” và những câu tiếp theo, để giải thích loại thứ hai, đã nói: “bây giờ, khi trình bày sự phát sinh của các lỗi lầm” và những câu tiếp theo.
‘‘Aṭṭhiñca paṭicca nhāruñca paṭicca cammañca paṭicca maṃsañca paṭicca ākāso parivārito rūpantveva saṅkhaṃ gacchatī’’tiādīsu (ma. ni. 1.306) viya idha rūpasaddo karajakāyapariyāyoti ‘‘rūpanti sarīra’’nti āha.
As in "dependent on bone, dependent on sinew, dependent on skin, dependent on flesh, space surrounded by these comes to be reckoned as form" (MN 1.306), here the word rūpa is a synonym for the body born of kamma, therefore it is said: "rūpa means body."
Giống như trong các câu “nương tựa vào xương, nương tựa vào gân, nương tựa vào da, nương tựa vào thịt, không gian được bao bọc, chỉ được gọi là sắc” (Ma. Ni. 1.306), ở đây từ rūpa là đồng nghĩa với thân thể do nghiệp tạo thành, nên nói: “rūpa là thân thể”.
‘‘Nāhaṃ, ānanda…pe… domanassupāyāsā’’ti kasmā vuttaṃ?
"I am not, Ānanda...pe...grief and lamentation"—why was this said?
“Này Ānanda, Ta không… (v.v.)… ưu phiền, khổ não” – tại sao lại nói như vậy?
Nanu kāye ca jīvite ca anapekkhacittānaṃ āraddhavipassakānampi asappāyavajjanasappāyasevanavasena kāyassa pariharaṇaṃ hotīti?
Is it not true that even for those who are indifferent to the body and life, and who have commenced vipassanā, the body is taken care of by avoiding what is unsuitable and attending to what is suitable?
Chẳng phải đối với những người có tâm không bám víu vào thân và mạng sống, những hành giả tinh tấn quán chiếu, việc chăm sóc thân thể vẫn xảy ra bằng cách tránh những điều không thích hợp và thực hành những điều thích hợp sao?
Saccaṃ, taṃ pana yo kallasarīraṃ nissāya dhammasādhanāya anuyuñjitukāmo hoti, tasseva dhammasādhanatāvasena.
It is true, but that care is only for one who, relying on a healthy body, wishes to diligently practice the Dhamma, for the sake of attaining the Dhamma.
Đúng vậy, nhưng điều đó chỉ xảy ra khi một người mong muốn nương tựa vào một thân thể khỏe mạnh để thực hành Pháp, theo cách thực hành Pháp của người đó.
Dhammasādhanabhāvañhi apekkhitvā asappāyaṃ vajjetvā sappāyavasena posetvā suṭṭhutaraṃ hutvā anuyuñjanato kāyassa pariharaṇaṃ, na so kāye abhirato nāma hoti paccavekkhaṇāyattattā apekkhāya vinoditabbo tādisoti.
Indeed, the body is taken care of when one attends diligently, with superior quality, by avoiding what is unsuitable and fostering what is suitable, with the aim of accomplishing the Dhamma; such a person is not attached to the body, because their concern is conditioned by reflection, and thus attachment must be removed.
Vì khi mong muốn thực hành Pháp, tránh những điều không thích hợp, nuôi dưỡng thân thể bằng những điều thích hợp, trở nên tốt đẹp hơn và tinh tấn thực hành, thì việc chăm sóc thân thể là cần thiết, nhưng người đó không phải là người ưa thích thân thể, vì sự bám víu phải được loại bỏ do phụ thuộc vào sự quán xét của người như vậy.
Upāligahapatinoti etthāpi ‘‘dasabalasāvakattupagamanasaṅkhātenā’’ti ānetvā yojetabbaṃ.
In Upāligahapatino, it should also be construed by bringing in "by way of becoming a disciple of the Ten Powers."
Trong câu “Upāligahapatino”, cũng nên thêm vào và kết hợp với “do sự quy y mười lực và các đệ tử của Ngài”.
187. Mahākaruṇāvasena parivutāya parisāya majjhe nisinnopi ekantavivekajjhāsayattā ekakova.
187. Although seated amidst the assembly, surrounded by great compassion, he is alone, due to his utterly secluded meditative inclination.
187. Ngay cả khi ngồi giữa hội chúng được bao quanh bởi lòng đại bi, Ngài vẫn đơn độc một mình do ý hướng hoàn toàn độc cư.
Etena satthuno pavivittassa pavivekattena vivittataṃ dasseti.
By this, the seclusion of the Teacher who is secluded is shown as seclusion.
Điều này cho thấy sự độc cư của Đức Phật là do chính sự độc cư.
Rūpārūpapaṭibhāganimittehi nivattanatthaṃ ‘‘rūpādīnaṃ saṅkhatanimittāna’’nti vuttaṃ.
"Of conditioned signs like rūpa" was said to indicate withdrawal from the corresponding signs of rūpa and arūpa.
Để ngăn chặn các tướng đối tượng sắc và vô sắc, đã nói: “các tướng hữu vi như sắc và những thứ khác”.
Ativiya santatarapaṇītatamabhāvena visesato sinoti bandhatīti visayo, so eva sasantatipariyāpannatāya ajjhattaṃ.
That which especially binds, due to its exceedingly tranquil and refined nature, is visaya (object); that same, being within one's own continuum, is ajjhatta (internal).
Do bản chất vô cùng thanh tịnh và vi diệu, nó đặc biệt gắn bó, ràng buộc nên gọi là visaya (phạm vi); chính nó, do thuộc về dòng tương tục của bản thân, nên gọi là ajjhattaṃ (nội tại).
Kiṃ pana tanti āha – ‘‘suññatanti suññataphalasamāpatti’’nti.
What is it then? he asks, and replies: "suññatā means the attainment of the fruition of emptiness."
Vậy đó là gì? Ngài nói: “suññatā là sự nhập định quả Không”.
Upadhivivekatāya asaṅkhatā dhātu idha vivekoti adhippetoti āha – ‘‘vivekaninnenā’’tiādi.
The asaṅkhata dhātu, which is the seclusion from upadhi, is here intended as viveka; hence it is said: "vivekaninna" and so forth.
Vì sự giải thoát khỏi các phiền não cấu uế, yếu tố vô vi ở đây được hiểu là sự độc cư, nên nói: “vivekaninnena” và những câu tiếp theo.
Bhaṅgamattampi asesetvā āsavaṭṭhāniyānañca dhammānaṃ tattha vigatattā tesaṃ vasena vigatantena, evaṃbhūtaṃ tesaṃ byantibhāvaṃ pattanti pāḷiyaṃ ‘‘byantibhūtenā’’ti vuttaṃ.
As not even a trace of dissolution remains, and defilement-causing states are absent there, it is vigatanta due to their absence; the Pāli text says "byantibhūtena" meaning they have attained such a state of cessation.
Do không còn sót lại một chút nào của sự hoại diệt, và các pháp là nguyên nhân của lậu hoặc cũng đã biến mất ở đó, nên theo nghĩa đó, vigatantena (đã chấm dứt); việc đạt đến sự chấm dứt của chúng như vậy được nói trong kinh là “byantibhūtena” (đã hoàn toàn chấm dứt).
Uyyojanaṃ vissajjanaṃ, taṃ etassa atthi, uyyojeti vissajjetīti vā uyyojanikaṃ.
Uyyojana means dismissal, bidding farewell; this belongs to it, or it dismisses, it bids farewell, hence uyyojanika.
Uyyojana là sự giải tán, sự từ bỏ; điều đó có ở đây, hoặc là uyyojanika vì nó giải tán, từ bỏ.
Yasmā na sabbakathā uyyojanavaseneva pavattati, tasmā vuttaṃ ‘‘uyyojanikapaṭisaṃyutta’’nti.
Since not all talks proceed by way of dismissal, it is said: "connected with dismissal."
Vì không phải tất cả các bài pháp đều diễn ra theo cách giải tán, nên đã nói: “uyyojanikapaṭisaṃyutta” (liên quan đến sự giải tán).
Telapākaṃ gaṇhanto viyāti yathā telapāko nāma paricchinnakālo na atikkamitabbo, evaṃ attano samāpattikālaṃ anatikkamitvā.
As if taking oil during boiling, just as the boiling of oil has a definite time that must not be exceeded, so too, without exceeding one's own time of attainment.
Giống như khi nấu dầu – giống như việc nấu dầu có thời gian giới hạn không được vượt quá, cũng vậy, không vượt quá thời gian nhập định của mình.
Yathā hi kusalo vejjo telaṃ pacanto taṃ taṃ telakiccaṃ cintetvā yadi vā patthinnapāko, yadi vā majjhimapāko, yadi vā kharapāko icchitabbo, tassa kālaṃ upadhāretvā pacati, evaṃ bhagavā dhammaṃ desento veneyyānaṃ ñāṇaparipākaṃ upadhāretvā taṃ taṃ kālaṃ anatikkamitvā dhammaṃ desetvā parisaṃ uyyojento ca vivekaninneneva cittena uyyojeti.
For just as a skilled physician, boiling oil, considers the various purposes for the oil—whether a light boil, a medium boil, or a hard boil is desired—and then boils it after determining the time; similarly, the Blessed One, teaching the Dhamma, having determined the maturity of the comprehension of those to be guided, and without exceeding that particular time, teaches the Dhamma and dismisses the assembly, dismisses them with a mind inclined to seclusion.
Thật vậy, giống như một thầy thuốc giỏi khi nấu dầu, sau khi suy xét về từng công dụng của dầu, nếu muốn dầu chín vừa, chín trung bình, hay chín kỹ, sẽ tính toán thời gian và nấu; cũng vậy, Đức Thế Tôn khi thuyết Pháp, sau khi quán sát sự chín muồi của trí tuệ của những người có thể được giáo hóa, không vượt quá thời gian đó, thuyết Pháp và khi giải tán hội chúng, Ngài giải tán với tâm thiên về độc cư (vivekaninneneva cittena uyyojeti).
Dve pañcaviññāṇānipi tadabhinīhatamanoviññāṇavasena nibbānaninnāneva.
Even the two fivefold consciousnesses are inclined towards Nibbāna through the associated mind-consciousness.
Ngay cả hai thức năm giác quan cũng thiên về Nibbāna theo sự hướng tâm của ý thức.
Buddhānañhi saṅkhārānaṃ suṭṭhu pariññātatāya paṇītānampi rūpādīnaṃ āpāthagamane pageva itaresaṃ paṭikūlatāva supākaṭā hutvā upaṭṭhāti, tasmā ghammābhitattassa viya sītajalaṭṭhānaninnatā nibbānaninnameva cittaṃ hoti, tassa ativiya santapaṇītabhāvato.
For Buddhas, because all conditioned phenomena are thoroughly understood, even refined rūpa and so forth, as soon as they come into range, their repulsive nature becomes very evident and is established; therefore, just as a person afflicted by heat is inclined towards a cool place, their mind is inclined towards Nibbāna, due to its exceedingly tranquil and refined nature.
Đối với các vị Phật, do các hành đã được thấu hiểu một cách hoàn hảo, ngay cả những sắc và những thứ cao cấp khác khi xuất hiện trong tầm mắt cũng lập tức hiện rõ sự đáng ghê tởm của chúng, do đó, tâm của Ngài giống như một người bị nóng bức mà thiên về nơi có nước mát, tâm Ngài luôn thiên về Nibbāna, vì Nibbāna vô cùng thanh tịnh và vi diệu.
188. Ajjhattamevāti idha jhānārammaṇaṃ adhippetanti āha ‘‘gocarajjhattamevā’’ti.
188. Ajjhattamevā (only internally) here refers to the object of jhāna; therefore, it is said: "only to the internal domain."
188. Ajjhattamevā ở đây có nghĩa là đối tượng của thiền định, nên nói: “gocarajjhattamevā” (chỉ là đối tượng nội tại).
Idha niyakajjhattaṃ suññataṃ.
Here, niyakajjhatta is emptiness.
Ở đây, niyakajjhattaṃ là sự không (suññatā).
Apaguṇapādakajjhānañhi ettha ‘‘niyakajjhatta’’nti adhippetaṃ vipassanāvisesassa adhippetattā, niyakajjhattaṃ nijjīvanissattataṃ, anattatanti attho.
For here, the base jhāna unhindered by defilements is intended by "niyakajjhatta" because a specific type of vipassanā is intended: niyakajjhatta means the state of being without living essence, without self; that is, non-self.
Thiền định không có nền tảng (apaguṇapādakajjhāna) ở đây được hiểu là “niyakajjhattaṃ” vì nó ám chỉ một loại thiền quán đặc biệt; niyakajjhattaṃ là sự không có sinh vật, không có chúng sinh, tức là vô ngã.
Asampajjanabhāvajānanenāti idāni me kammaṭṭhānaṃ vīthipaṭipannaṃ na hoti, uppathameva pavattatīti jānanena.
By knowing the state of not comprehending, knowing, "now my meditation object is not on the right path, it is proceeding astray."
Bằng sự hiểu biết về trạng thái không tỉnh giác – bằng sự hiểu biết rằng “bây giờ đề mục thiền của tôi không đi đúng hướng, mà đang đi lạc lối”.
Kasmā panettha bhagavatā vipassanāya eva pādake jhāne avatvā pādakajjhānaṃ gahitanti āha – ‘‘appaguṇapādakajjhānato’’tiādi.
Why, in this context, did the Blessed One refer to the base jhāna instead of speaking of jhāna as a basis for vipassanā? He replies: "from the base jhāna unhindered by defilements" and so forth.
Tại sao ở đây Đức Thế Tôn không nói về thiền định nền tảng của thiền quán mà lại nói về thiền định nền tảng nói chung? Ngài nói: “do thiền định nền tảng chưa được hoàn thiện” và những câu tiếp theo.
Na pakkhandati sammā na samāhitattā.
Does not plunge in, because it is not rightly concentrated.
Không thâm nhập vì không định tâm đúng đắn.
So pana ‘‘ajjhattadhammā mayhaṃ nijjaṭā nigumbā hutvā na upaṭṭhahanti, handāhaṃ bahiddhādhamme manasi kareyyaṃ ekaccesu saṅkhāresu upaṭṭhitesu itarepi upaṭṭhaheyyumevā’’ti parassa…pe… manasi karoti.
But that person, thinking, "My internal states are not presenting themselves as disentangled and clear; let me pay attention to external states; when some states present themselves, others will also present themselves," pays attention to others...pe....
Người đó nói: “Các pháp nội tại của tôi không hiện lên một cách rõ ràng, không có sự ràng buộc, vậy tôi hãy tác ý đến các pháp ngoại tại; khi một số hành hiện lên, những hành khác cũng sẽ hiện lên”, nên tác ý đến người khác… (v.v.)….
Pādakajjhānavasena viya sammasitajjhānavasenapi ubhatobhāgavimutto hotiyevāti āha – ‘‘arūpasamāpattiyaṃ nu kho kathanti āneñjaṃ manasi karotī’’ti.
Just as through the base jhāna, one becomes liberated in both ways (ubhatobhāgavimutta), so too through the jhāna of discernment, one becomes liberated in both ways; therefore, he says: "How, then, in the attainment of the formless? He pays attention to the imperturbable."
Giống như với thiền định nền tảng, với thiền định quán xét cũng có thể giải thoát cả hai mặt, nên nói: “trong các thiền vô sắc thì tác ý đến bất động như thế nào?”.
Na me cittaṃ pakkhandatīti mayhaṃ vipassanācittaṃ vīthipaṭipannaṃ hutvā na vahatīti.
"My mind does not plunge in" means my vipassanā-mind does not proceed on the right path.
Tâm tôi không thâm nhập nghĩa là tâm thiền quán của tôi không đi đúng hướng.
Pādakajjhānamevāti vipassanāya pādakabhūtameva jhānaṃ.
Only the base jhāna refers to the jhāna that serves as the foundation for vipassanā.
Chỉ là thiền định nền tảng – chỉ là thiền định làm nền tảng cho thiền quán.
Punappunaṃ manasi kātabbanti punappunaṃ samāpajjitabbaṃ vipassanāya tikkhavisadatāpādanāya.
To be paid attention to again and again means to be attained again and again, for the purpose of making vipassanā keen and clear.
Phải tác ý lặp đi lặp lại – phải nhập định lặp đi lặp lại để làm cho thiền quán trở nên sắc bén và thuần thục.
Avahante nipuṇābhāvena chedanakiriyāya appavattante.
When not proceeding refers to not continuing with the act of discernment due to a lack of sharpness.
Không vận hành – do thiếu sự tinh tế, không tiến hành việc cắt đứt.
Samāpajjitvā vipassanāya tikkhakammakaraṇaṃ samathavipassanāvihārenāti āha – ‘‘kammaṭṭhāne manasikāro vahatī’’ti.
Attaining and making vipassanā keen through the abiding of samatha-vipassanā; therefore, he says: "attention to the meditation object proceeds."
Việc nhập định và thực hành thiền quán một cách sắc bén là thông qua sự an trú trong thiền định và thiền quán, nên nói: “sự tác ý vào đề mục thiền vận hành”.
189. Sampajjati meti vīthipaṭipattiyā pubbenāparaṃ visesābhāvato sampajjati me kammaṭṭhānanti jānanena.
189. It is successful for me means knowing that "my meditation object is successful," due to there being no difference in the progress of the path from earlier to later stages.
189. Sampajjati me (đề mục thiền của tôi thành tựu) – bằng sự hiểu biết rằng đề mục thiền của tôi thành tựu, do không có sự khác biệt giữa trước và sau trong tiến trình tu tập.
Iriyāpathaṃ ahāpetvāti yathā parissamo nāgacchati, evaṃ attano balānurūpaṃ tassa kālaṃ netvā pamāṇameva pavattanena iriyāpathaṃ ahopetvā.
Without neglecting the postures (iriyāpathaṃ ahāpetvā): so that weariness does not come, thus by spending time in accordance with one's own strength and maintaining moderation, without neglecting the postures.
Không bỏ lỡ oai nghi là, như sự mệt mỏi không đến, sau khi dẫn dắt thời gian đó phù hợp với sức lực của mình, bằng cách duy trì ở mức độ vừa phải, không bỏ lỡ oai nghi.
Sabbavāresūti ṭhānanisajjāsayanavāresu.
In all turns (sabbavāresu): in the turns of standing, sitting, and lying down.
Trong tất cả các thời là, trong các thời đứng, ngồi, nằm.
Kathāvāresu pana visesaṃ tattha tattha vadanti.
But concerning turns of speaking, they speak of a special point here and there.
Còn trong các thời nói chuyện, họ nói điều đặc biệt ở từng nơi.
Idaṃ vuttanti idaṃ, ‘‘iminā vihārenā’’tiādivacanaṃ vuttaṃ.
This was said (idaṃ vuttaṃ): this, the saying beginning with "by this dwelling," was said.
Điều này được nói là, điều này, lời nói "bằng cách sống này" v.v. đã được nói.
190. Kāmavitakkādayo oḷārikakāmarāgabyāpādasabhāgāti āha – ‘‘vitakkapahānena dve magge kathetvā’’ti.
190. He said, regarding thoughts of sensual desire, etc., as being of the nature of gross sensual lust and ill-will: "by the abandonment of thoughts, two paths are taught."
190. Các dục tầm (kāmavitakka) v.v. là đồng phần với thô trược dục ái (oḷārikakāmarāga) và sân hận (byāpāda), nên nói: “sau khi nói hai con đường bằng cách đoạn trừ tầm”.
Kāmaguṇesūti niddhāraṇe bhummaṃ.
In sensual pleasures (kāmaguṇesu): this is the locative of definition.
Kāmaguṇesu (trong các dục cảnh): là cách nói định đoạt (niddhāraṇa) ở thể sở thuộc (bhummaṃ).
Kismiñcideva kilesuppattikāraṇeti tassa puggalassa kilesuppattikāraṇaṃ sandhāya vuttaṃ, aññathā sabbepi pañca kāmaguṇā kilesuppattikāraṇameva.
In any cause for the arising of defilements (kismiñcideva kilesuppattikāraṇe): this was said with reference to that person's cause for the arising of defilements, otherwise all five sensual pleasures are causes for the arising of defilements.
Kismiñcideva kilesuppattikāraṇe (trong bất cứ nguyên nhân nào của sự sinh khởi phiền não): được nói để chỉ nguyên nhân sinh khởi phiền não của cá nhân đó, nếu không thì tất cả năm dục cảnh đều là nguyên nhân sinh khởi phiền não.
Samudācaratīti samudācāroti āha ‘‘samudācaraṇato’’ti.
He said "from the arising (samudācaraṇato)" because it arises (samudācarati) as samudācāra.
Samudācarati (khởi lên) là samudācāra (sự khởi lên), nên nói “do sự khởi lên”.
So pana yasmā cittassa, na sattassa, tasmā vuttaṃ pāḷiyaṃ ‘‘cetaso’’ti.
But since it belongs to the mind, not to a being, it is said in the Pali canon, "of the mind (cetaso)."
Tuy nhiên, vì điều đó thuộc về tâm, không phải thuộc về hữu tình, nên trong Pāli đã nói “cetaso” (của tâm).
Ma-kāro padasandhikaro e-kārassa ca akāro katoti āha ‘‘evaṃ sante etanti.
The letter 'ma' is a connective for the word, and the 'e' vowel becomes an 'a' vowel, so he said "thus it is (etaṃ)".
Chữ ma là chữ nối từ, và chữ e đã trở thành chữ a, nên nói “nếu là như vậy, thì điều này”.
191. Anusayoti mānānusayo bhavarāgānusayo avijjānusayoti tividhopi anusayo pahīyati arahattamaggena.
191. Anusaya: the three kinds of latent tendencies—the latent tendency of conceit, the latent tendency of craving for existence, and the latent tendency of ignorance— are abandoned by the path of Arahantship.
191. Anusaya (tùy miên): Tùy miên kiêu mạn (mānānusaya), tùy miên hữu ái (bhavarāgānusaya), tùy miên vô minh (avijjānusaya) – cả ba loại tùy miên này đều được đoạn trừ bằng A-la-hán đạo.
Vuttanayenevāti, ‘‘tato maggānantaraṃ phalaṃ, phalato vuṭṭhāya paccavekkhamāno pahīnabhāvaṃ jānāti, tassa jānanena sampajāno hotī’’ti vuttanayena.
In the way it was stated (vuttanayeneva): in the way it was stated, "Immediately after the path is the fruition; rising from the fruition, contemplating, one knows the state of abandonment, and by that knowing, one becomes clearly comprehending (sampajāno)."
Theo cách đã nói là, theo cách đã nói: “Ngay sau đạo là quả, sau khi xuất khỏi quả và quán xét, vị ấy biết được trạng thái đã đoạn trừ, do sự biết đó mà vị ấy trở thành người có chánh niệm tỉnh giác (sampajāno)”.
Kusalato āyātīti āyato, so etesanti kusalāyatikā.
That which comes from the wholesome is "āyata," and these are of that nature, hence kusalāyatikā.
Đến từ thiện là āyata, điều đó thuộc về những người này nên là kusalāyatikā.
Tenāha ‘‘kusalato āgatā’’ti.
Therefore, he said "that which has come from the wholesome."
Vì vậy nói “đến từ thiện”.
Taṃ pana nesaṃ kusalāyatikattaṃ upanissayavasena hoti sahajātavasenapīti tadubhayaṃ dassetuṃ, ‘‘seyyathida’’ntiādi vuttaṃ.
And that these are "kusalāyatika" happens by way of supporting condition (upanissaya) and also by way of co-arising, and to show both of these, "just as (seyyathidaṃ)" etc., was said.
Tuy nhiên, việc chúng là kusalāyatikā là do duyên cận y (upanissaya) và cũng do đồng sanh (sahajāta), để chỉ cả hai điều đó, đã nói “seyyathida” (ví như) v.v.
Yasmā pana yathāvuttadhammesu keci lokiyā, keci lokuttarā; atha kasmā visesena ‘‘lokuttarā’’ti vuttanti āha – ‘‘loke uttarā visiṭṭhā’’ti.
Since, among the qualities mentioned, some are mundane and some are supramundane, why are they specifically called "supramundane"? He said: "superior, distinguished in the world (loke uttarā visiṭṭhā)."
Tuy nhiên, vì trong các pháp đã nói, có một số là thế gian (lokiya), một số là siêu thế (lokuttara); vậy tại sao lại đặc biệt nói “siêu thế”? Nên nói: “siêu việt, thù thắng trong thế gian”.
Tena lokiyadhammesu uttamabhāvena jhānādayo lokuttarā vuttā, na lokassa uttaraṇatoti dasseti.
Thereby he shows that jhāna, etc., are called supramundane because of their superiority among mundane qualities, not because they transcend the world.
Điều đó cho thấy rằng các thiền na (jhāna) v.v. được gọi là siêu thế vì chúng là tối thượng trong các pháp thế gian, chứ không phải vì chúng vượt thoát thế gian.
Yaṃ kiñci mahaggatacittaṃ mārassa avisayo akāmāvacarattā, pageva taṃ vipassanāya pādakabhūtaṃ suvikkhālitamalanti āha – ‘‘jānituṃ na sakkotī’’ti.
He said "cannot know (jānituṃ na sakkotī)" because any developed mind (mahaggatacitta) is outside Māra's sphere, being not of the sense-sphere, much less when it forms the basis for insight and is thoroughly cleansed of defilements.
Bất kỳ tâm đại hành (mahaggatacitta) nào cũng không nằm trong phạm vi của Ma vương vì nó không thuộc về Dục giới, huống chi tâm đó là nền tảng của tuệ quán (vipassanā) và đã được tẩy sạch mọi cấu uế, nên nói: “không thể biết được”.
Eko ānisaṃso atthi bhāvanānuyogassa sappāyadhammakathāpaṭilābho.
There is one benefit of diligent practice: the acquisition of talk conducive to development.
Có một lợi ích là sự thành tựu các pháp thích hợp cho việc chuyên tâm tu tập (bhāvanānuyoga).
192. Etadatthanti kevalassa sutassa atthāya.
192. For this purpose (etadatthaṃ): merely for the purpose of listening.
192. Etadattha (vì mục đích này) là, vì mục đích của sự học hỏi thuần túy.
Sappāyāsappāyavasenāti kasmā vuttaṃ?
By way of what is suitable and unsuitable (sappāyāsappāyavasena): why was this said?
Sappāyāsappāyavasena (theo cách thích hợp và không thích hợp) – tại sao lại nói như vậy?
Nanu sappāyavasena dasakathāvatthūni āgatānīti?
Surely, the ten topics of discourse were taught by way of what is suitable?
Há chẳng phải mười đề tài nói chuyện (dasakathāvatthūni) đã được đề cập theo cách thích hợp sao?
Saccametaṃ, asappāyakathāvajjanapubbikāya sappāya kathāya vasena āgatattā ‘‘sappāyāsappāyavasena āgatānī’’ti vuttaṃ.
That is true; because they were taught by way of suitable talk preceded by the avoidance of unsuitable talk, it was said "they were taught by way of what is suitable and unsuitable."
Điều đó là đúng, nhưng vì chúng được đề cập theo cách nói chuyện thích hợp có trước sự tránh né những câu chuyện không thích hợp, nên đã nói “được đề cập theo cách thích hợp và không thích hợp”.
Sutapariyattivasenāti sarūpena tattha anāgatānipi dasakathāvatthūni suttageyyādiantogadhattā, ‘‘sutapariyattivasena āgatānī’’ti vuttaṃ.
By way of the scripture (sutapariyattivasena): even though the ten topics of discourse are not explicitly mentioned there in their form, they are included within Sutta, Geyya, etc., hence it was said "they were taught by way of the scripture."
Sutapariyattivasena (theo cách học hỏi và nghiên cứu): Mặc dù mười đề tài nói chuyện không được đề cập trực tiếp ở đó, nhưng vì chúng nằm trong các bài kinh (sutta), kệ tụng (geyya) v.v., nên đã nói “được đề cập theo cách học hỏi và nghiên cứu”.
Paripūraṇavasena sarūpato āgatattā imasmiṃ ṭhāne ṭhatvā kathetabbāni.
Since they are explicitly mentioned for the purpose of completion, they should be discussed at this point.
Vì chúng được đề cập trực tiếp để hoàn chỉnh, nên trong chỗ này cần phải nói rõ.
Atthoti sāmaññattho.
Meaning (attho): the general meaning.
Attho (ý nghĩa) là ý nghĩa chung.
193. Anuāvattantīti anuanu abhimukhā hutvā vattanti, payirupāsanādivasena anukūlayanti.
193. Anuāvattanti: they turn towards, they adapt, by way of serving, etc.
193. Anuāvattantī (tuân theo) là, tuân theo từng chút một, thuận theo bằng cách phụng sự v.v.
Mucchanataṇhanti paccayesu mucchanākāraṃ.
The craving for infatuation (mucchanātaṇhaṃ): the manner of infatuation with requisites.
Mucchanataṇha (ái dục mê đắm) là, trạng thái mê đắm trong các duyên.
Taṇhāya patthanā nāma tenākārena pavattīti āha – ‘‘pattheti pavattetī’’ti.
He said "desires, causes to arise (pattheti pavatteti)" because craving is indeed a longing that proceeds in that manner.
Sự khao khát của ái dục chính là sự vận hành theo trạng thái đó, nên nói: “khao khát, vận hành”.
Kilesūpaddavenāti kilesasaṅkhātena upaddavena.
By the affliction of defilements (kilesūpaddavena): by the affliction in the form of defilements.
Kilesūpaddavena (bởi tai họa phiền não) là, bởi tai họa được gọi là phiền não.
Kilesā hi sattānaṃ mahānatthakaraṇato ‘‘upaddavo’’ti vuccanti.
Indeed, defilements are called "afflictions" because they cause great harm to beings.
Quả thật, các phiền não được gọi là “tai họa” vì chúng gây ra những tai ương lớn cho chúng sanh.
Attano abbhantare uppannena kilesūpaddavena antevāsino, upaddavo antevāsūpaddavo, brahmacariyassa upaddavo brahmacārupaddavoti imamatthaṃ ‘‘sesupaddavesupi eseva nayo’’ti iminā atidisati.
He extrapolates this meaning to "other afflictions" with the phrase "the same method applies to other afflictions": the affliction of the disciple is antevāsūpaddavo by the affliction of defilements that has arisen within oneself; the affliction of the holy life is brahmacārupaddavo.
Tai họa của đệ tử là antevāsūpaddavo (tai họa của đệ tử) do tai họa phiền não sinh khởi bên trong mình; tai họa của phạm hạnh là brahmacārupaddavo (tai họa của phạm hạnh), ý nghĩa này được chỉ định bằng câu “trong các tai họa khác cũng theo cách này”.
Guṇamaraṇaṃ kathitaṃ, na jīvitamaraṇaṃ.
The death of qualities is mentioned, not the death of life.
Sự chết của phẩm hạnh được nói đến, chứ không phải sự chết của sự sống.
Appalābhāti appamattakalābhī visesānaṃ.
Having little gain (appalābhā): one who gains little of the special qualities.
Appalābhā (ít lợi ích) là, người có được rất ít các phẩm chất đặc biệt.
Evaṃ vuttoti yathāvuttabrahmacārupaddavo dukkhavipākataro ceva kaṭukavipākataro cāti evaṃ vutto.
Thus spoken (evaṃ vutto): the affliction of the holy life described above is thus spoken of as being both of painful result and bitter result.
Được nói như vậy là, tai họa phạm hạnh đã nói ở trên là có quả khổ và quả cay đắng hơn, được nói như vậy.
Ācariyantevāsikūpaddavo hi bāhirakasamayavasena vutto, brahmacārupaddavo pana sāsanavasena.
For the affliction of the teacher and disciple is spoken of in terms of external doctrines, whereas the affliction of the holy life is in terms of the Dispensation.
Quả thật, tai họa của thầy và đệ tử được nói theo cách thế gian, còn tai họa của phạm hạnh thì theo cách giáo pháp.
Durakkhāte hi dhammavinaye duppaṭipatti na mahāsāvajjā micchābhinivesassa sithilavāyāmabhāvato; svākhyāte pana dhammavinaye duppaṭipatti mahāsāvajjā mahato atthassa bāhirabhāvakaraṇato.
For in a poorly expounded Dhamma-Vinaya, wrong practice is not greatly blameworthy because of the laxity of effort regarding wrong views; but in a well-expounded Dhamma-Vinaya, wrong practice is greatly blameworthy because it causes a great benefit to be externalized.
Thật vậy, trong giáo pháp và giới luật được giảng giải kém, sự thực hành sai không phải là tội lỗi lớn vì sự chấp thủ sai lầm có nỗ lực yếu kém; nhưng trong giáo pháp và giới luật được giảng giải tốt, sự thực hành sai là tội lỗi lớn vì nó gây ra sự mất mát lớn.
Tenāha ‘‘sāsane panā’’tiādi.
Therefore, he said "but in the Dispensation (sāsane panā)" and so on.
Vì vậy nói “nhưng trong giáo pháp” v.v.
196. Tasmāti idaṃ pubbaparāpekkhaṃ purimassa ca atthassa kāraṇabhāvena paccāmasananti āha ‘‘yasmā’’tiādi.
196. Therefore (tasmā): this refers to what precedes and follows, and indicates the reason for the former meaning, so he said "because (yasmā)" and so on.
196. Tasmā (do đó): Điều này liên quan đến trước và sau, và đề cập đến ý nghĩa của điều trước như là nguyên nhân, nên nói “yasmā” (vì) v.v.
Mittaṃ etassa atthīti mittavā, tassa bhāvo mittavatā, tāya.
One who has a friend is "mittavā"; the state of having a friend is mittavatā, by that.
Người có bạn là mittavā, trạng thái của người đó là mittavatā, bằng trạng thái đó.
Mittavasena paṭipajjananti āha ‘‘mittapaṭipattiyā’’ti.
He said "by friendliness (mittapaṭipattiyā)" because it is practicing by way of friendship.
Hành động theo cách của bạn bè, nên nói “bằng sự thực hành của bạn bè”.
Sapattavatāyāti etthāpi eseva nayo.
The same method applies to by enemy-ness (sapattavatāyā).
Trong sapattavatāyā (bằng sự thực hành của kẻ thù) cũng theo cách này.
Dukkaṭadubbhāsitamattampīti iminā pageva itaraṃ vītikkamantoti dasseti.
Even a mere offense or ill-spoken word (dukkaṭadubbhāsitamattampi): by this, he shows that one transgresses the other much more.
Dukkaṭadubbhāsitamattampī (ngay cả một lỗi dukkata hay dubbhāsita nhỏ nhất) – điều này cho thấy rằng họ còn vượt qua những điều khác.
Sāvakesu hitaparakkamanaṃ ovādānusāsanīhi paṭipajjananti āha – ‘‘tathā na paṭipajjissāmī’’ti.
He said "I will not practice thus (tathā na paṭipajjissāmī)" meaning striving for the welfare of disciples and practicing by means of admonition and instruction.
Sự nỗ lực vì lợi ích của các đệ tử, thực hành bằng lời khuyên và giáo huấn, nên nói: “Tôi sẽ không thực hành như vậy”.
Āmakamattanti kulālabhājanaṃ vuccati.
A mere raw pot (āmakamattaṃ) refers to an unfired potter's vessel.
Āmakamatta (đồ thô sơ) được gọi là đồ gốm.
Nāhaṃ tumhesu tathā paṭipajjissāmīti kumbhakāro viya āmakabhājanesu ahaṃ tumhesu kevalaṃ jānāpento na paṭipajjissāmi.
"I will not practice with you in that way (nāhaṃ tumhesu tathā paṭipajjissāmī)": "Like a potter with unfired pots, I will not practice with you merely by making you understand."
Nāhaṃ tumhesu tathā paṭipajjissāmī (Tôi sẽ không thực hành như vậy đối với các ông): Giống như người thợ gốm đối với đồ gốm thô, tôi sẽ không chỉ dạy cho các ông.
Niggaṇhitvāti nīharitvā.
Having removed (niggaṇhitvā): having drawn out.
Niggaṇhitvā (nhổ bỏ) là, loại bỏ.
Lokiyaguṇāpi idha sārotveva adhippetā lokuttaraguṇānaṃ adhiṭṭhānabhāvato.
Mundane qualities are also here intended as the essence (lokiyaguṇāpi idha sārotveva adhippetā) because they are the foundation for supramundane qualities.
Các phẩm chất thế gian cũng được xem là cốt lõi ở đây vì chúng là nền tảng cho các phẩm chất siêu thế.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
197. Vibhattipatirūpakā ca nipātā hontīti yathārahaṃ taṃtaṃvibhattiatthadīpakā, idha paccattavacano yatrasaddo, hisaddo hetuattho, nāmasaddo acchariyattho, padattayassa pana acchariyatthaniddiṭṭhatāya ‘‘acchariyatthe nipāto’’ti vuttaṃ.
197. Indemonstrables (nipātā) also take on the forms of case endings, thus they indicate the meaning of various cases as appropriate. Here, the word "yatra" is in the nominative singular case, the word "hi" has the meaning of a reason, the word "nāma" has the meaning of "amazing," and since the meaning of amazing is indicated by all three words, it was said "an indeclinable in the sense of amazing."
197. Các giới từ (nipāta) cũng có hình thức giống như biến cách (vibhatti), nên tùy theo đó, chúng là những từ chỉ ý nghĩa của biến cách tương ứng; ở đây, từ yatra là từ chỉ thể chủ cách (paccattavacana), từ hi có nghĩa là nguyên nhân, từ nāma có nghĩa là kỳ diệu. Tuy nhiên, vì cả ba từ đều chỉ ý nghĩa kỳ diệu, nên đã nói “là giới từ có ý nghĩa kỳ diệu”.
Ekaṃsato panetaṃ padattayaṃ.
But these three words are definite.
Tuy nhiên, cả ba từ này là một phần.
Tathā hi vakkhati, ‘‘yatrāti nipātavasena anāgatavacana’’nti.
For he will explain, "the word 'yatra' is an indeclinable indicating the future tense."
Thật vậy, sẽ nói, “yatra là từ chỉ thời vị lai theo cách giới từ”.
Papañcasaddo heṭṭhā vutto.
The word papañca was explained below.
Từ papañca đã được nói ở dưới.
Chinnavaṭumeti iminā sabbakilesavaṭṭassa akusalakammavaṭṭassa ca chinnattā vipākavaṭṭassa ca upari vakkhamānattā āha – ‘‘vaṭumanti kusalākusalakammavaṭṭaṃ vuccatī’’ti.
Chinnavaṭume (with roots cut): by this, since all defilement-cycles and unwholesome kamma-cycles are cut, and the vipāka-cycle will be mentioned above, he said "vaṭuma is called the wholesome and unwholesome kamma-cycle."
Chinnavaṭume (đã cắt đứt vòng): Điều này cho thấy rằng tất cả vòng phiền não (kilesavaṭṭa) và vòng nghiệp bất thiện (akusalakammavaṭṭa) đã bị cắt đứt, và vòng quả (vipākavaṭṭa) sẽ được nói ở trên, nên nói: “vaṭuma được gọi là vòng nghiệp thiện và bất thiện”.
Nipātavasena yatrasaddayogena.
As an indeclinable (nipātavasena): in conjunction with the word "yatra."
Nipātavasena (theo cách giới từ): do sự kết hợp với từ yatra.
Anāgatavacananti idaṃ anāgatavacanasadisattā vuttaṃ.
Future tense (anāgatavacanaṃ): this was said because it resembles a future tense word.
Anāgatavacana (từ chỉ thời vị lai): Điều này được nói vì nó giống như từ chỉ thời vị lai.
Anāgatatthavācī hi anāgatavacanaṃ, attho cettha atītoti.
For "anāgatavacana" means 'expressing a future meaning,' but here the meaning is past.
Thật vậy, từ chỉ ý nghĩa vị lai là từ chỉ thời vị lai, nhưng ý nghĩa ở đây là quá khứ.
Anussarīti idaṃ anussaritabhāvaṃ sandhāya vuttaṃ – ‘‘na anussarissatī’’ti saddapayogassa atītavisayattā.
Anussarī (remembered): this was said with reference to the state of having remembered, because the usage of the word "na anussarissati" (will not remember) pertains to the past.
Anussarī (đã nhớ): Điều này được nói để chỉ trạng thái đã nhớ – vì cách dùng từ na anussarissati (sẽ không nhớ) liên quan đến quá khứ.
Yadā pana tehi bhikkhūhi yā kathā pavattitā, tato pacchāpi bhagavato tesaṃ buddhānaṃ anussaraṇaṃ hotiyeva.
However, even after the talk that those bhikkhus had, the Bhagavā still had recollection of those Buddhas.
Tuy nhiên, khi các vị tỳ khưu đó đã nói chuyện, thì sau đó Đức Phật vẫn luôn nhớ đến các vị Phật đó.
Khattiyajaccātiādikālato paṭṭhāya asambhinnāya khattiyajātiyā uditoditāya.
Of the warrior caste means, from primordial times, of an unmixed warrior caste, continually distinguished.
Khattiyajaccā (dòng dõi Sát-đế-lợi) và các từ tương tự: từ thời sơ khai, bởi dòng dõi Sát-đế-lợi không bị pha tạp, liên tục xuất hiện.
Brahmajaccāti brāhmaṇajaccā.
Of the brahman caste means, of the brahman caste.
Brahmajaccā (dòng dõi Phạm thiên) có nghĩa là dòng dõi Bà-la-môn.
Evaṃgottepi eseva nayo.
The same method applies to of such a clan.
Đối với evaṃgotte (dòng dõi như vậy) cũng cùng một cách.
Lokiyalokuttarasīlenāti pāramitāsambhūtena buddhāveṇikattā anaññasādhāraṇena lokiyena lokuttarena ca sīlena.
By mundane and supramundane virtue means, by mundane and supramundane virtue born of the Pāramīs, which is exclusive to Buddhas and not common to others.
Lokiyalokuttarasīlenā (bằng giới thế gian và siêu thế) có nghĩa là bằng giới thế gian và siêu thế, được phát sinh từ các pāramī (ba-la-mật), độc đáo của chư Phật, không ai khác có được.
Evaṃsīlāti anavasesasīlānaṃ visuṃ paccavekkhaṇakaraṇena evaṃsīlāti anussarissati.
Of such virtue means, by reflecting separately on all virtues without remainder, one will recollect, "of such virtue."
Evaṃsīlā (giới hạnh như vậy): sẽ tưởng nhớ rằng giới hạnh của ngài là như vậy, bằng cách quán xét riêng từng giới hạnh còn lại.
Esa nayo sesesu.
This method applies to the rest.
Tương tự đối với các điều còn lại.
Yathā vijjābhāgiyā vijjāsampayuttadhammā, evaṃ samādhipakkhā samādhisampayuttadhammāpi sativīriyādayoti āha – ‘‘heṭṭhā samādhipakkhānaṃ dhammānaṃ gahitattā vihāro gahitovā’’ti.
Just as the constituents of knowledge are qualities associated with knowledge, so too the constituents of concentration, such as mindfulness and energy, are qualities associated with concentration, hence it is said: "Because the constituents of concentration were grasped below, the abiding (vihāra) was grasped."
Cũng như các pháp thuộc phần minh (vijjābhāgiyā) là các pháp tương ưng với minh, thì các pháp thuộc phần định (samādhipakkhā) cũng là các pháp tương ưng với định như niệm, tinh tấn, v.v… nên đã nói: “Vì các pháp thuộc phần định đã được thâu tóm ở dưới, nên sự an trú cũng đã được thâu tóm”.
Tasmā samādhipakkhadhammavinimutto eva idha vihāro adhippetoti vuttaṃ ‘‘idaṃ hī’’tiādi.
Therefore, the abiding (vihāra) here is intended to be distinct from the constituents of concentration, as stated: "This indeed..." and so on.
Vì vậy, ở đây, sự an trú không bị tách rời khỏi các pháp thuộc phần định là điều được đề cập, nên đã nói “đây là” v.v….
Yathā vā aṭṭhasamāpattivipassanāmaggaphalasaṅgahitā lokiyalokuttarā samādhipaññā ‘‘evaṃdhammā evaṃpaññā’’ti padehi heṭṭhā gahitāpi yathāsakaṃ paṭipakkhato muccanassa pavattivisesaṃ upādāya ‘‘evaṃvimuttā’’ti ettha puna gahitā, tathā ‘‘evaṃdhammā’’ti ettha gahitāpi samādhipakkhadhammā dibbabrahmaāneñjaariyavihārasaṅkhātaṃ attano pavattivisesaṃ upādāya, ‘‘evaṃvihārī’’ti ettha puna gahitāti vuccamāne na koci virodho.
Or, just as mundane and supramundane concentration-wisdom, comprising the eight attainments, insight, path, and fruit, though already grasped below by the phrases "of such Dhamma" and "of such wisdom," are again grasped in "of such liberation" due to the specific mode of their release from their respective opponents; similarly, the constituents of concentration, though grasped in "of such Dhamma," are again grasped in "of such abiding" due to their specific mode of occurrence, namely, the divine, Brahma, imperturbable, and noble abidings—when this is stated, there is no contradiction.
Cũng như định và tuệ thế gian và siêu thế, được thâu tóm trong tám thiền định, tuệ quán, đạo, quả, đã được thâu tóm ở dưới bằng các từ “evaṃdhammā” (pháp như vậy) và “evaṃpaññā” (tuệ như vậy), nhưng do sự đặc thù của sự đoạn trừ khỏi đối nghịch của chúng, nên lại được thâu tóm ở đây trong “evaṃvimuttā” (giải thoát như vậy); tương tự, các pháp thuộc phần định đã được thâu tóm trong “evaṃdhammā” (pháp như vậy) cũng lại được thâu tóm ở đây trong “evaṃvihārī” (an trú như vậy), do sự đặc thù của sự an trú của chúng, được gọi là sự an trú của chư thiên, Phạm thiên, an trú vô sở hữu và an trú bậc Thánh, thì không có gì mâu thuẫn.
Phaladhammānaṃ pavattikālepi kilesānaṃ paṭippassaddhi na taṃānubhāvajātā, atha kho ariyamaggena kilesānaṃ samucchinnattāti āha – ‘‘maggānubhāvena kilesānaṃ paṭipassaddhante uppannattā’’ti.
Even during the manifestation of fruition-states, the subsiding of defilements is not born of that power, but rather due to the defilements having been eradicated by the Noble Path, hence it is said: "having arisen due to the subsiding of defilements by the power of the path."
Ngay cả khi các pháp quả đang diễn ra, sự lắng dịu của các phiền não không phải do năng lực của quả đó, mà là do các phiền não đã bị đạo diệt tận, nên đã nói: “do sự phát sinh của sự lắng dịu các phiền não bằng năng lực của đạo”.
Yo yaṃ pajahati, so pahāyako pahātabbato vimuttoti vuccati visaṃsaṭṭhabhāvatoti pahānavibhāgena vuccamāne apahāyakassa nibbānassa kathaṃ vimuttatā?
Whoever abandons something is called the abandoner, liberated from what is to be abandoned, due to being unmixed with it. If liberation is explained by abandonment, how can Nibbāna be said to be liberated, since it is not an abandoner?
Vị nào đoạn trừ điều gì, vị ấy được gọi là người đoạn trừ, giải thoát khỏi điều cần đoạn trừ, do không bị pha trộn. Nếu nói theo sự phân chia của sự đoạn trừ, thì Nibbāna, không phải là người đoạn trừ, làm sao có sự giải thoát?
Visaṃsaṭṭhābhāvato eva.
Due to being unmixed with defilements.
Chính do trạng thái không bị pha trộn.
Tañhi pakatiyāva sabbaso kilesehi visaṃsaṭṭhaṃ vinissaṭaṃ suvidūravidūre ṭhitaṃ, tasmāssa tato nissaṭattā nissaraṇavimutti nissaraṇapahānanti vuccatīti āha ‘‘nibbāna’’ntiādi.
For it is by its very nature entirely unmixed with defilements, completely separated, situated at a great distance; therefore, due to its having emerged from them, it is called escape-liberation, escape-abandonment, hence it is said: "Nibbāna..." and so on.
Thật vậy, Nibbāna tự bản chất đã hoàn toàn không bị pha trộn, tách rời khỏi các phiền não, ở rất xa, nên sự thoát ly khỏi đó được gọi là Nissaraṇavimutti (giải thoát thoát ly) và Nissaraṇapahāna (sự đoạn trừ thoát ly), nên đã nói “Nibbāna” v.v….
199. Ime tathāgatassa acchariyaabbhutadhammā, na sāvakavisayā, mama pana desanā tayā sutā evāti te therasseva bhāraṃ karonto, ‘‘taṃ bhiyyosomattāya paṭibhantū’’ti āha.
199. These are the Tathāgata's wonderful and marvelous qualities, not within the scope of disciples. But "my teaching has been heard by you," so entrusting it to the elder, he said: "May they inspire you all the more."
199. Những pháp hy hữu và kỳ diệu của Đức Như Lai này không thuộc phạm vi của các vị đệ tử, nhưng lời giảng của tôi đã được ngài nghe rồi. Khi giao phó trách nhiệm cho chính vị Trưởng lão, ngài đã nói: “Nguyện cho chúng lại càng hiển lộ rõ hơn”.
Sato sampajānoti ettha kālabhedavasena labbhamānampi sampajānabhāvaṃ anāmasitvā gativibhāgena taṃ dassetuṃ, ‘‘dve sampajaññānī’’tiādi vuttaṃ – aṭṭha vare gaṇhantoti ettha kathaṃ varaṃ devatā deti, parassa dīyamānañca taṃ kathaṃ parassa samijjhatīti?
In mindful and clearly comprehending, not touching upon the aspect of clear comprehension obtainable through difference in time, but to show it through difference in mode of activity, it is said: "two kinds of clear comprehension," and so on. Here, in receiving eight boons, how does a deity grant a boon, and how does it succeed for another when given?
Ở đây, trong sato sampajāno (tỉnh giác có niệm), để chỉ ra trạng thái tỉnh giác theo sự phân chia của các hành vi, mà không đề cập đến trạng thái tỉnh giác có được theo sự phân chia của thời gian, đã nói “có hai loại tỉnh giác” v.v… Ở đây, trong aṭṭha vare gaṇhanto (nhận tám điều ước), làm sao chư thiên ban điều ước, và điều ước được ban cho người khác thì làm sao thành tựu cho người khác?
Kammabaleneva.
Through the power of Kamma alone.
Chính bằng năng lực của nghiệp.
Yadi hi taṃ kammaṃ katokāsaṃ yassa tadapadesena phalaṃ vipaccati, evaṃ devatāya tassa varaṃ dinnaṃ, itarena ca laddhanti vohāro hotīti.
For if that Kamma has made an opportunity, and its fruit ripens through the deity's agency, then it is customarily said that the deity has granted a boon to that person, and the other has received it.
Thật vậy, nếu nghiệp đó đã tạo cơ hội mà quả của nó chín muồi thông qua sự chỉ định của vị thần, thì danh từ “điều ước được vị thần ban cho người đó, và người kia đã nhận được” được sử dụng.
Apica parassa patthitavarāni nāma vipaccamānassa kammassa paccayabhūto payogavisesoti daṭṭhabbaṃ.
Moreover, boons desired by others should be understood as a specific effort that acts as a condition for ripening Kamma.
Hơn nữa, các điều ước mà người khác mong muốn phải được xem là một loại nỗ lực đặc biệt, là điều kiện cho nghiệp đang chín muồi.
Tāni vipaccane ekantikānipi appesakkhā devatā – ‘‘ayamassa patthanā samijjhissati, no’’ti na jānanti, sakko pana paññavā tāni ekaccaṃ jānātiyeva.
Even though these are certain to ripen, minor deities do not know whether "this person's wish will succeed or not." Sakka, however, being wise, knows some of them.
Ngay cả khi những điều đó chắc chắn sẽ chín muồi, các vị thần có oai lực nhỏ bé không biết “mong ước này của người đó sẽ thành tựu hay không”, nhưng Sakka (Đế Thích) là vị có trí tuệ thì biết một vài điều.
Tena vuttaṃ – ‘‘sakkena pasīditvā dinne aṭṭha vare gaṇhanto’’tiādi.
Therefore, it is said: "receiving eight boons granted by Sakka, who was pleased," and so on.
Vì vậy đã nói: “Khi Sakka hoan hỷ ban tám điều ước, ngài đã nhận” v.v….
Aññepi devātiādinā bodhisattassa tattha sampajaññeneva ṭhitabhāvaṃ byatirekamukhena vibhāveti.
By other deities and so on, it distinguishes, by way of contrast, the Bodhisatta's state of abiding there with clear comprehension.
Bằng aññepi devā (các vị thần khác) v.v… vị ấy làm rõ trạng thái Bồ-tát an trú trong sự tỉnh giác ở đó, theo cách đối lập.
Āhārūpacchedena kālaṅkarontīti idaṃ khiḍḍāpadosikavasena vuttaṃ.
Dying by ceasing food intake is stated in the context of those intoxicated by play.
Āhārūpacchedena kālaṅkarontī (chết do đoạn tuyệt thức ăn) điều này được nói theo nghĩa của sự đam mê vui đùa.
Itaresampi dibbabhogehi mucchitataṃ ajjhāpannānaṃ tiṭṭhantānaṃ sampajaññābhāvo hotiyeva.
Even for others who are immersed and abiding in infatuation with divine enjoyments, there is indeed a lack of clear comprehension.
Đối với những vị khác, những người bị say đắm bởi các dục lạc cõi trời, trạng thái thiếu tỉnh giác cũng xảy ra khi họ đang sống.
Kiṃ tathārūpaṃ ārammaṇaṃ natthīti yathārūpaṃ uḷāraṃ paṇītañca ārammaṇaṃ paṭicca te devā saṃmucchitā āhārūpacchedampi karonti, kiṃ tathārūpaṃ uḷāraṃ paṇītañca ārammaṇaṃ bodhisattassa natthīti bodhisattassa sampajaññānubhāvaṃ vibhāvetuṃ codanaṃ samuṭṭhāpeti?
Is there no such object? The question is raised to show the power of the Bodhisatta's clear comprehension, by asking: "Are there no such sublime and exquisite objects that cause those deities to become infatuated and even cease food intake? Is there no such sublime and exquisite object for the Bodhisatta?"
Kiṃ tathārūpaṃ ārammaṇaṃ natthī (có phải không có đối tượng như vậy không)? Để làm rõ năng lực tỉnh giác của Bồ-tát, câu hỏi được đặt ra: “Có phải không có đối tượng cao quý và vi diệu như vậy, mà các vị thần đó đã say đắm và đoạn tuyệt thức ăn, không có đối tượng cao quý và vi diệu như vậy đối với Bồ-tát sao?”
Bodhisatto hi yattha yattha nibbattati, tattha tattha aññe satte dasahi visesehi adhiggaṇhāti, pageva tattha devabhūto, tathāpi ‘‘sato sampajāno’’ti ayamettha acchariyadhammo vutto.
For wherever the Bodhisatta is reborn, he surpasses other beings in ten respects; how much more so when reborn as a deity there! Yet, "mindful and clearly comprehending" is stated here as a marvelous quality.
Thật vậy, Bồ-tát, ở bất cứ nơi nào ngài tái sanh, ngài đều vượt trội hơn các chúng sanh khác ở đó bằng mười đặc điểm, huống chi khi ngài là một vị thần ở đó. Tuy nhiên, “sato sampajāno” (tỉnh giác có niệm) được nói ở đây là một pháp kỳ diệu.
200. Sampattibhave dīghāyukatā nāma paññābalena hoti, bodhisatto ca mahāpañño, tasmā tattha tattha bhave tena dīghāyukena bhavitabbanti adhippāyena, ‘‘sesattabhāvesu kiṃ yāvatāyukaṃ na tiṭṭhatī’’ti codeti.
200. In a prosperous existence, longevity is attained by the power of wisdom, and the Bodhisatta possesses great wisdom. Therefore, with the intention that he should be long-lived in each existence, the question is raised: "Why does he not remain for the full lifespan in other existences?"
200. Trong kiếp sống sung túc, tuổi thọ dài là do năng lực của trí tuệ, và Bồ-tát là bậc đại trí tuệ, vì vậy, với ý định ngài phải có tuổi thọ dài trong mỗi kiếp sống đó, câu hỏi được đặt ra: “Trong các kiếp sống còn lại, tại sao ngài không sống hết tuổi thọ?”
Itaro ‘‘āma na tiṭṭhatī’’ti paṭijānitvā, ‘‘aññadā hī’’tiādinā tattha kāraṇamāha.
The other replies "Indeed, he does not," and then explains the reason with "For otherwise..." and so on.
Vị kia đã thừa nhận “Vâng, không sống hết tuổi thọ”, rồi đã nói lý do ở đó bằng “aññadā hi” (vì những lúc khác) v.v….
‘‘Idha na bhavissāmī’’ti adhimuccanavasena kālakiriyā adhimuttikālakiriyā.
The act of dying by determining "I shall not be here" is volitional dying (adhimuttikālakiriyā).
Sự chết do quyết định “Tôi sẽ không ở đây nữa” được gọi là adhimuttikālakiriyā (sự chết do quyết định).
Pāramidhammānañhi ukkaṃsappattiyā tasmiṃ tasmiṃ attabhāve abhiññāsamāpattīhi santānassa visesitattā attasinehassa tanubhāvena sattesu ca mahākaruṇāya uḷārabhāvena adhiṭṭhānassa tikkhavisadabhāvāpattiyā bodhisattānaṃ adhippāyā samijjhanti, citte viya kammesu ca tesaṃ vasibhāvo, tasmā yatthupapannānaṃ pāramiyo sammadeva paribrūhenti, vuttanayena kālaṃ katvā tattha upapajjanti.
Indeed, due to the culmination of Pāramī qualities, and the purification of the mind-continuum through higher knowledges and attainments in each existence, resulting in a weakening of attachment to self and the arising of immense compassion for beings, and the sharp and clear resolution of his determination, the Bodhisattas' intentions are fulfilled, and they have mastery over Kamma as if over their own thoughts. Therefore, they die in the manner stated and are reborn where their Pāramīs are completely perfected.
Thật vậy, do sự thăng hoa của các pháp pāramī (ba-la-mật), do sự đặc biệt của dòng tâm thức trong mỗi kiếp sống đó bằng các abhiññā (thắng trí) và samāpatti (thiền định), do sự mỏng manh của tình yêu bản thân, và do sự cao quý của lòng đại bi đối với chúng sanh, do sự sắc bén và rõ ràng của sự quyết định, nên những ước nguyện của các Bồ-tát được thành tựu, và họ có quyền năng đối với nghiệp cũng như đối với tâm. Vì vậy, họ chết theo cách đã nói và tái sanh ở nơi mà các pāramī của họ được viên mãn một cách hoàn hảo.
Tathā hi ayaṃ mahāsatto imasmiṃyeva kappe nānājātīsu aparihīnajjhāno kālaṃ katvā brahmaloke nibbatto appakameva kālaṃ tattha ṭhatvā tato cavitvā idha nibbatto.
Thus, this Great Being, in this very eon, reborn in various species, having died without loss of jhāna, was reborn in the Brahma world, remained there for only a short time, and then passed away from there to be reborn here.
Thật vậy, vị Đại Hữu Tình này, trong kiếp này, đã chết với thiền định không suy thoái trong nhiều loài khác nhau, tái sanh vào cõi Phạm thiên, ở đó một thời gian ngắn, rồi từ đó chuyển sanh và tái sanh ở đây.
Tenāha – ‘‘ayaṃ kālakiriyā aññesaṃ na hotī’’ti.
Therefore, it is said: "This kind of dying is not for others."
Vì vậy đã nói: “Sự chết này không xảy ra với những người khác”.
Sabbapāramīnaṃ pūritattāti iminā payojanābhāvato tattha ṭhatvā adhimuttikālakiriyā nāma na hotīti dasseti.
Because all Pāramīs were fulfilled implies that there is no volitional dying by remaining there due to the absence of a purpose.
Bằng sabbapāramīnaṃ pūritattā (vì tất cả các pāramī đã được viên mãn), điều này cho thấy rằng không có sự chết do quyết định ở đó vì không có mục đích.
Apica carimabhave catumahānidhisamuṭṭhānapubbikāya dibbasampattisadisāya mahāsampattiyā nibbatti viya buddhabhūtassa asadisadānādivasena anaññasādhāraṇalābhuppatti viya ca ito paraṃ mahāpurisassa dibbasampattianubhavanaṃ nāma natthīti yāvatāyukaṭṭhānaṃ ussāhajātassa puññasambhārassa vasenāti daṭṭhabbaṃ.
Moreover, just as in the final existence there is a rebirth with great prosperity, similar to divine prosperity, preceded by the arising of the four great treasures; and just as for the Buddha, there is the attainment of unparalleled benefits through unequaled generosity and so forth, so too, after this, there is no experience of divine prosperity for the Great Being. This should be understood as due to the accumulated merit that generates aspiration for the full lifespan.
Hơn nữa, trong kiếp cuối cùng, sự trải nghiệm các phước báu cõi trời của vị Đại Nhân không còn nữa, giống như sự tái sanh với đại phúc báu tương tự như sự phát sinh của bốn đại kho tàng, và giống như sự phát sinh của các lợi lộc không ai sánh bằng thông qua sự bố thí vô song v.v… của một vị Phật. Vì vậy, phải hiểu rằng sự an trú hết tuổi thọ là do năng lực của các phước báu đã được tích lũy với sự nỗ lực.
Ayañhettha dhammatā.
This is the natural law here.
Đây là một quy luật tự nhiên ở đây.
Manussagaṇanāvasena, na devagaṇanāvasena.
By human reckoning, not by divine reckoning.
Manussagaṇanāvasena (theo cách tính của loài người), không phải theo cách tính của chư thiên.
Pubbanimittānīti cutiyā pubbanimittāni.
Prior signs means, prior signs of passing away.
Pubbanimittānī (những điềm báo trước) có nghĩa là những điềm báo trước của sự chết.
Amilāyitvāti ettha amilātaggahaṇeneva tāsaṃ mālānaṃ vaṇṇasampadāpi gandhasampadāpi sobhāsampadāpi dassitāti daṭṭhabbaṃ.
Here, by the mention of "amilāta" (unwithered), it should be understood that the beauty of color, fragrance, and radiance of those garlands are also indicated.
Ở đây, chỉ với việc nắm giữ ý nghĩa của từ amilāta (không héo tàn) đã thể hiện sự hoàn hảo về màu sắc, sự hoàn hảo về hương thơm và sự hoàn hảo về vẻ đẹp của những vòng hoa đó, nên được hiểu như vậy.
Bāhirabbhantarānaṃ rajojallānaṃ lesassapi abhāvato devānaṃ sarīragatāni vatthāni sabbakālaṃ parisuddhapabhassarāneva hutvā tiṭṭhantīti āha ‘‘vatthesupi eseva nayo’’ti.
Because there is not even a trace of external or internal dirt and grime, the clothes worn by devas remain always pure and radiant; thus, it is said, "the same applies to clothes."
Vì không có một chút bụi bẩn bên ngoài hay bên trong nào, những y phục trên thân của chư thiên luôn trong sạch và rực rỡ mọi lúc, nên đã nói: “Đối với y phục cũng cùng một nguyên tắc như vậy”.
Neva sītaṃ na uṇhanti yassa sītassa patīkāravasena adhikaṃ seviyamānaṃ uṇhaṃ, sayameva vā kharataraṃ hutvā adhibhavantaṃ sarīre sedaṃ uppādeyya, tādisaṃ neva sītaṃ na uṇhaṃ hoti.
Neither cold nor hot means that which is not so cold that intense heat must be sought as a remedy, nor so hot that it would, by its own severity, overwhelm the body and produce sweat.
Không lạnh cũng không nóng nghĩa là không có cái lạnh mà khi được hưởng thụ quá mức sẽ trở thành cái nóng để đối kháng lại, hoặc cái nóng tự thân quá gay gắt đến mức áp đảo thân thể và làm đổ mồ hôi. Đó là trạng thái không lạnh cũng không nóng.
Tasmiṃ kāleti yathāvutte maraṇāsannakāle.
At that time means at the aforementioned time near death.
Vào thời điểm đó nghĩa là vào thời điểm cận kề cái chết như đã nói.
Bindubinduvasenāti muttaguḷikā viya bindu bindu hutvā sedā muccanti.
Drop by drop means sweat is released drop by drop, like beads of water.
Từng giọt từng giọt nghĩa là mồ hôi chảy ra từng giọt như những giọt nước tiểu.
Dantānaṃ khaṇḍitabhāvo khaṇḍiccaṃ.
The breaking of teeth is khaṇḍiccaṃ (broken teeth).
Răng bị sứt mẻ là khaṇḍiccaṃ (sứt mẻ răng).
Kesānaṃ palitabhāvo pāliccaṃ.
The graying of hair is pāliccaṃ (gray hair).
Tóc bạc là pāliccaṃ (tóc bạc).
Ādi-saddena valittacataṃ saṅgaṇhāti.
The word ādi (etc.) includes wrinkles on the skin.
Từ vân vân bao gồm da nhăn nheo.
Kilantarūpo attabhāvo hoti, na pana khaṇḍiccapāliccādīhīti adhippāyo.
The meaning is that the body appears weary, but not with broken teeth, gray hair, and so on.
Ý nghĩa là: thân thể trở nên mệt mỏi, chứ không phải do sứt mẻ răng, tóc bạc, vân vân.
Ukkaṇṭhitāti anabhirati, sā natthi uparūpari uḷāruḷārānameva bhogānaṃ visesato rucijanakānaṃ upatiṭṭhanato.
Ukkaṇṭhitā means displeasure; that does not exist because increasingly sublime and delightful enjoyments are continuously available.
Ukkaṇṭhitā (chán nản) nghĩa là không hoan hỷ. Điều đó không xảy ra vì họ liên tục được hưởng thụ những lạc thú cao thượng và đặc biệt làm hài lòng.
Na paññāyanti ciratarakālattā paramāyuno.
They are not evident because of the very long duration of their maximum lifespan.
Không được thấy rõ vì thời gian quá lâu, do tuổi thọ tối đa.
Aniyyānikanti na niyyānāvahaṃ sattānaṃ abhājanabhāvato.
Aniyyāṇikaṃ means not conducive to liberation, due to beings' unsuitability.
Aniyyānikaṃ (không đưa đến giải thoát) vì chúng sinh không đủ khả năng để đạt đến giải thoát.
Sattā na paramāyuno honti nāma pāpussannatāyāti āha – ‘‘tadā hi sattā ussannakilesā hontī’’ti.
It is said that beings do not have a maximum lifespan because of an abundance of defilements – "for then beings have abundant defilements."
Chúng sinh không có tuổi thọ tối đa là do tràn đầy phiền não, nên đã nói – “Vì lúc ấy chúng sinh tràn đầy phiền não”.
Etthāha – ‘‘kasmā sambuddhā manussaloke eva uppajjanti, na devabrahmalokesū’’ti.
Here it is asked: "Why do Sambuddhas arise only in the human realm, not in the deva or Brahma realms?"
Ở đây, có người hỏi: “Tại sao chư Phật toàn giác chỉ xuất hiện ở cõi người, không phải ở cõi trời hay cõi Phạm thiên?”
Devaloke tāva nuppajjanti brahmacariyavāsassa anokāsabhāvato tathā anacchariyabhāvato.
They do not arise in the deva realm, for instance, due to the unsuitability of observing the holy life and the lack of extraordinary nature.
Ở cõi trời thì không xuất hiện vì không có cơ hội cho đời sống Phạm hạnh và vì không có sự phi thường.
Acchariyadhammā hi buddhā bhagavanto, tesaṃ sā acchariyadhammatā devattabhāve ṭhitānaṃ na pākaṭā hoti yathā manussabhūtānaṃ.
For the Buddhas, the Bhagavā, possess extraordinary qualities, but these extraordinary qualities are not manifest to those existing in the deva realm as they are to those in the human realm.
Chư Phật, các Thế Tôn là những pháp phi thường, nhưng sự phi thường đó của các Ngài không hiển lộ rõ ràng khi ở thân chư thiên như khi ở thân người.
Devabhūte hi sammāsambuddhe dissamānaṃ buddhānubhāvaṃ devānubhāvatova loko dahati, na buddhānubhāvato, tathā sati sammāsambuddhe nādhimuccati na sampasīdati issarakuttaggāhaṃ na vissajjeti, devattabhāvassa ca cirakālapavattanato ekaccasassatavādato na parimuccati.
When a Sammāsambuddha is a deva, the world perceives the Buddha's power as the power of a deva, not as the power of a Buddha; in such a case, one does not place full confidence in the Sammāsambuddha, nor does one gain serene faith, nor does one abandon the misconception of an eternal Lord, nor is one liberated from certain eternalist views due to the long duration of the deva existence.
Vì khi chư Phật toàn giác ở thân chư thiên, thế gian cho rằng thần thông của Phật là thần thông của chư thiên, chứ không phải thần thông của Phật. Như vậy, họ không có niềm tin kiên cố vào chư Phật toàn giác, không thanh tịnh tâm, không từ bỏ chấp thủ về đấng tạo hóa, và vì đời sống chư thiên kéo dài nên họ không thoát khỏi một số tà kiến chấp thường.
‘‘Brahmaloke nuppajjantī’’ti etthāpi eseva nayo.
"They do not arise in the Brahma realm"—the same reason applies here too.
“Không xuất hiện ở cõi Phạm thiên” cũng cùng một nguyên tắc như vậy.
Sattānaṃ tādisagāhavimocanatthañhi buddhā bhagavanto manussasugatiyaṃyeva uppajjanti; na devasugatiyaṃ, manussasugatiyaṃ uppajjantāpi opapātikā na honti, sati ca opapātikūpapattiyaṃ vuttadosānativattanato.
It is precisely to liberate beings from such misconceptions that the Buddhas, the Bhagavā, arise only in the human realm, not in the deva realm; and even when arising in the human realm, they are not spontaneously reborn, for if they were spontaneously reborn, the aforementioned faults would not be overcome.
Chư Phật, các Thế Tôn chỉ xuất hiện ở thiện thú loài người để giải thoát chúng sinh khỏi những chấp thủ như vậy; không phải ở thiện thú cõi trời, và ngay cả khi xuất hiện ở thiện thú loài người, các Ngài cũng không phải là hóa sinh, vì nếu là hóa sinh thì những lỗi đã nêu sẽ không được vượt qua.
Dhammaveneyyānaṃ atthāya dhammatantiyā ṭhapanassa viya dhātuveneyyānaṃ atthāya dhātūnaṃ ṭhapanassa icchitabbattā ca.
And because it is desirable to establish relics for the benefit of those to be disciplined by relics, just as it is for the benefit of those to be disciplined by the Dhamma to establish the teaching of the Dhamma.
Và cũng vì mong muốn thiết lập các Xá-lợi để lợi ích cho những ai có duyên với Xá-lợi, giống như việc thiết lập Pháp để lợi ích cho những ai có duyên với Pháp.
Na hi opapātikānaṃ parinibbānato uddhaṃ sarīradhātuyo tiṭṭhanti, tasmā na opapātikā honti, carimabhave ca mahābodhisattā, manussabhāvassa pākaṭakaraṇāya dārapariggahampi karontā yāva puttamukhadassanā agāramajjhe tiṭṭhanti.
For the corporeal relics do not remain after the parinibbāna of those spontaneously reborn; therefore, they are not spontaneously reborn. And in their last existence, the great Bodhisattas, in order to make their human existence manifest, even take a wife and remain in the household until they see the face of a son.
Quả thật, sau khi các bậc hóa sinh nhập Niết-bàn, Xá-lợi thân của các Ngài không còn tồn tại. Vì vậy, các Ngài không phải là hóa sinh, và trong kiếp cuối cùng, các vị Đại Bồ-tát, để làm cho thân người hiển lộ rõ ràng, cũng kết hôn và ở trong gia đình cho đến khi thấy mặt con.
Paripākagatasīlanekkhammapaññādipāramikāpi na abhinikkhamanti, kiṃ vā etāya kāraṇacintāya?
Even those whose pāramīs of morality, renunciation, wisdom, and so on, have reached maturity, do not go forth. But what is the use of this reasoning about the cause?
Ngay cả những ai đã viên mãn các Ba-la-mật như Giới, Ly dục, Trí tuệ, vân vân, cũng không xuất gia ngay lập tức. Cần gì phải suy xét về lý do này?
Sabbabuddhehi āciṇṇasamāciṇṇā, yadidaṃ manussabhūtānaṃyeva abhisambujjhanā, na devabhūtānanti ayamettha dhammatā.
This is the rule (dhammatā) here: it is the tradition observed by all Buddhas that they attain full awakening only as humans, not as devas.
Đây là quy luật mà tất cả chư Phật đã thực hành và tuân thủ, đó là chỉ giác ngộ khi ở thân người, không phải khi ở thân chư thiên.
Tathā hi tadattho mahābhinīhāropi manussabhūtānaṃyeva ijjhati, na itaresaṃ.
Thus, the great aspiration (mahābhinīhāra) for that purpose is fulfilled only for humans, not for others.
Quả thật, lời nguyện vĩ đại cho mục đích đó cũng chỉ thành tựu khi ở thân người, không phải ở các thân khác.
Kasmā pana sammāsambuddhā jambudīpeyeva uppajjanti, na sesadīpesūti?
But why do Sammāsambuddhas arise only in Jambudīpa, and not in the other continents?
Vậy tại sao chư Phật toàn giác chỉ xuất hiện ở Jambudīpa (Nam Thiệm Bộ Châu), không phải ở các châu lục khác?
Keci tāva āhu – ‘‘yasmā pathaviyā nābhibhūtā buddhānubhāvasahitā acalaṭṭhānabhūtā bodhimaṇḍabhūmi jambudīpeyeva uppajjati, tasmā jambudīpeyeva uppajjantī’’ti; ‘‘tathā itaresampi avijahitaṭṭhānānaṃ tattheva labbhamānato’’ti.
Some indeed say: "Because the Bodhimaṇḍa ground, which is unshakable and imbued with the Buddha's power, arises only in Jambudīpa, therefore they arise only in Jambudīpa"; and "because other unabandoned places are also found there."
Một số người nói: “Vì nền đất Bồ-đề (Bodhimaṇḍa) không bị lay chuyển, mang thần thông của Phật và là nơi bất động, chỉ xuất hiện ở Jambudīpa, nên chư Phật chỉ xuất hiện ở Jambudīpa”; “Cũng vì những nơi khác không bị bỏ rơi cũng chỉ tìm thấy ở đó”.
Ayaṃ panettha amhākaṃ khanti – yasmā purimabuddhānaṃ mahābodhisattānaṃ paccekabuddhānañca nibbattiyā sāvakabodhisattānaṃ sāvakabodhiyā abhinīhāro sāvakapāramīnaṃ sambharaṇaṃ paripācanañca buddhakhettabhūte imasmiṃ cakkavāḷe jambudīpeyeva ijjhati, na aññattha.
Our conviction on this matter is that the aspiration for the birth of previous Buddhas, Great Bodhisattas, and Paccekabuddhas, and for the awakening of Sāvakabodhisattas and the accumulation and maturing of the Sāvaka pāramīs, is fulfilled only in Jambudīpa within this Buddha-field universe, and nowhere else.
Đây là sự chấp nhận của chúng tôi về vấn đề này: Vì sự xuất hiện của chư Phật quá khứ, các vị Đại Bồ-tát, các vị Độc giác Phật, và sự phát nguyện Bồ-đề của các vị Thanh văn Bồ-tát, sự tích lũy và viên mãn các Ba-la-mật của Thanh văn chỉ thành tựu ở Jambudīpa trong vũ trụ này (buddhakkhetta), không phải ở nơi nào khác.
Veneyyānaṃ vinayanattho ca buddhuppādoti aggasāvakādiveneyyavisesāpekkhāya ekasmiṃ jambudīpeyeva buddhā nibbattanti, na sesadīpesu.
And since the arising of a Buddha is for the sake of disciplining those who are amenable to instruction, due to the need for special disciples like the Chief Disciples and so on, Buddhas arise only in one Jambudīpa, not in the other continents.
Và sự xuất hiện của chư Phật là để giáo hóa những người có duyên, nên chư Phật chỉ xuất hiện ở một Jambudīpa duy nhất, với sự mong đợi những người có duyên đặc biệt như các vị Thượng thủ Thanh văn, không phải ở các châu lục khác.
Ayañca nayo sabbabuddhānaṃ āciṇṇasamāciṇṇoti tesaṃ uttamapurisānaṃ tattheva uppatti sampatticakkānaṃ viya aññamaññupanissayato aparāparaṃ vattatīti daṭṭhabbaṃ.
And this method is the tradition observed by all Buddhas, so the arising of these supreme beings there occurs continuously, as if the circles of their attainment were mutually supporting each other.
Và nguyên tắc này đã được tất cả chư Phật thực hành và tuân thủ, nên sự xuất hiện của những bậc tối thượng đó ở đó diễn ra liên tiếp, do sự nương tựa lẫn nhau như các bánh xe thành tựu, nên cần được hiểu như vậy.
Tenāha – ‘‘tīsu dīpesu buddhā na nibbattanti, jambudīpeyeva nibbattantīti dīpaṃ passatī’’ti.
Therefore, it is said: "Buddhas do not arise in the three continents; they arise only in Jambudīpa, thus he saw the continent."
Vì vậy, đã nói: “Chư Phật không xuất hiện ở ba châu lục, mà chỉ xuất hiện ở Jambudīpa, nên Ngài thấy châu lục đó”.
Iminā nayena desaniyamepi kāraṇaṃ vattabbaṃ.
By this method, a reason should also be given for the restriction of place.
Theo nguyên tắc này, lý do cho sự quy định về địa điểm cũng nên được nói đến.
Idāni ca khattiyakulaṃ lokasammataṃ brāhmaṇānampi pūjanīyabhāvato.
And now the Khattiya family is esteemed by the world, being revered even by brahmins.
Hiện tại, dòng dõi Sát-đế-lợi được thế gian tôn kính vì ngay cả các Bà-la-môn cũng tôn thờ.
Rājā me pitā bhavissatīti kulaṃ passi pituvasena kulassa niddisitabbato.
He saw the family, saying, "A king will be my father," because the family is indicated by the father.
“Vị vua sẽ là cha của ta” – Ngài đã thấy dòng dõi đó vì dòng dõi được chỉ định theo người cha.
Dasannaṃ māsānaṃ upari satta divasānīti passi tena attano antarāyābhāvaṃ aññāsi, tassā ca tusitabhave dibbasampattipaccanubhavanaṃ.
He saw "seven days after ten months," and thereby knew that there would be no danger to himself, and that she would experience divine enjoyments in the Tusita realm.
Ngài đã thấy bảy ngày sau mười tháng; qua đó, Ngài biết rằng mình không có chướng ngại, và biết rằng mẹ Ngài sẽ hưởng thụ tài sản thần thánh ở cõi Đâu-suất.
Tā devatāti dasasahassicakkavāḷadevatā.
Those devatās are the devatās of the ten-thousandfold world-system.
Những vị thiên nhân đó là chư thiên của mười ngàn thế giới.
Kathaṃ pana tā bodhisattassa pūritapāramibhāvaṃ bhāvinañca sambuddhabhāvaṃ jānantīti?
But how do those devatās know the Bodhisatta's fulfillment of pāramīs and his future state of full awakening?
Vậy làm sao những vị đó lại biết được Bồ-tát đã viên mãn Ba-la-mật và sẽ thành Phật trong tương lai?
Mahesakkhānaṃ devatānaṃ vasena, yebhuyyena ca tā devatā abhisamayabhāgino.
By means of the powerful devatās, and mostly, those devatās are partakers of realization.
Là do những vị thiên nhân có đại uy lực, và hầu hết những vị thiên nhân đó đều là những người có duyên chứng ngộ.
Tathā hi bhagavato ca dhammadānasaṃvibhāge anekavāraṃ dasasahassacakkavāḷavāsidevatāsannipāto ahosi.
Indeed, on many occasions, there was an assembly of devatās from the ten-thousandfold world-system for the Bhagavā's distribution of the Dhamma gift.
Quả thật, đã có nhiều lần chư thiên của mười ngàn thế giới tập hợp để chia sẻ Pháp thí của Đức Thế Tôn.
Cavāmīti pajānāti cutiāsannajavanehi ñāṇasahitehi cutiyā upaṭṭhitabhāvassa paṭisaṃviditattā.
He knows, "I am passing away," because the imminence of passing away is perceived through thoughts approaching the moment of death, accompanied by knowledge.
Ngài biết “Ta đang diệt” vì sự kiện diệt độ đã hiện hữu với những tâm tốc hành cận tử có trí tuệ, và đã được nhận thức.
Cuticittaṃ na jānāti cuticittakkhaṇassa ittarabhāvato.
He does not know the moment of passing away due to the momentary nature of the passing-away consciousness.
Ngài không biết tâm diệt vì khoảnh khắc của tâm diệt quá ngắn ngủi.
Tathā hi taṃ cutūpapātañāṇassapi avisayo eva.
Indeed, it is beyond the scope even of the knowledge of passing away and arising.
Quả thật, khoảnh khắc đó nằm ngoài phạm vi của ngay cả Tuệ biết sinh tử.
Paṭisandhicittepi eseva nayo.
The same applies to the re-linking consciousness.
Đối với tâm tái sinh cũng cùng một nguyên tắc như vậy.
Āvajjanapariyāyoti āvajjanakkamo.
Āvajjanapariyāya means the sequence of advertence.
Āvajjanapariyāyo (cách thức hướng tâm) nghĩa là trình tự hướng tâm.
Yasmā ekavāraṃ āvajjitamattena ārammaṇaṃ nicchinituṃ na sakkā, tasmā tamevārammaṇaṃ dutiyaṃ tatiyañca āvajjitvā nicchīyati, āvajjanasīsena cettha javanavāro gahito.
Since an object cannot be determined by a single act of advertence, the same object is adverted to a second and a third time and then determined. Here, the javana process is included under the heading of advertence.
Vì không thể xác định đối tượng chỉ bằng một lần hướng tâm, nên đối tượng đó được xác định sau khi hướng tâm lần thứ hai và thứ ba; ở đây, chuỗi tâm tốc hành được bao gồm dưới tiêu đề hướng tâm.
Tenāha – ‘‘dutiyatatiyacittavāreyeva jānissatī’’ti.
Therefore, it is said: "He will know only in the second and third thought-moments."
Vì vậy, đã nói: “Ngài sẽ biết chỉ trong chuỗi tâm thứ hai và thứ ba”.
Cutiyā puretaraṃ katipayacittavārato paṭṭhāya maraṇaṃ me āsannanti jānanato, ‘‘cutikkhaṇepi cavāmīti pajānātī’’ti vuttaṃ.
Since one knows "my death is imminent" starting from a few thought-moments before passing away, it is stated: "Even at the moment of passing away, he knows, 'I am passing away'."
Vì Ngài biết “cái chết của ta đã cận kề” từ một vài chuỗi tâm trước khi diệt độ, nên đã nói: “Ngài biết ‘Ta đang diệt’ ngay cả trong khoảnh khắc diệt độ”.
Paṭisandhiyā pana apubbabhāvato paṭisandhicittaṃ na jānāti.
However, due to the unprecedented nature of the rebirth, one does not know the rebirth-linking consciousness.
Nhưng vì tâm tái tục sinh chưa từng có trước đây, nên nó không biết tâm tái tục sinh.
Nikantiyā uppattito parato asukasmiṃ ṭhāne mayā paṭisandhi gahitāti pajānāti, dutiyajavanato paṭṭhāya jānātīti vuttovāyamattho.
After the arising of craving, one knows, ‘In such and such a place, I took rebirth-linking’; it is said that this means one knows from the second javana onward.
Sau khi ái dục khởi lên, nó biết rõ rằng “sự tái tục sinh đã được thọ nhận bởi ta ở nơi nào đó”; ý nghĩa này được nói là biết bắt đầu từ sát-na tốc hành thứ hai.
Tasmiṃ kāleti paṭisandhiggahaṇakāle.
‘At that time’ means at the time of taking rebirth-linking.
“Vào lúc đó” tức là vào lúc thọ nhận tái tục sinh.
Dasasahassī kampatīti ettha kampanakāraṇaṃ heṭṭhā vuttameva.
Regarding ‘the ten-thousandfold world system trembles’, the cause of trembling has been stated below.
Về việc “mười ngàn thế giới rung chuyển” ở đây, nguyên nhân của sự rung chuyển đã được nói ở dưới.
Mahākāruṇikā buddhā bhagavanto sattānaṃ hitasukhavidhānatapparatāya bahulaṃ somanassikāva hontīti tesaṃ paṭhamamahāvipākacittena paṭisandhiggahaṇaṃ aṭṭhakathāyaṃ (dī. ni. aṭṭha. 2.17; dha. sa. 498; ma. ni. aṭṭha. 3.199) vuttaṃ.
It is stated in the commentaries that the Buddhas, the Bhagavants, being greatly compassionate and intent on arranging for the welfare and happiness of beings, are mostly filled with joy, and therefore their rebirth-linking is with the first great vipāka-citta.
Các vị Phật, Thế Tôn, bậc Đại Bi, vì chuyên tâm vào việc mang lại lợi ích và hạnh phúc cho chúng sinh, nên thường là những vị đầy hỷ lạc; do đó, việc tái tục sinh của các Ngài với tâm đại quả thứ nhất đã được nói trong Chú giải.
Mahāsīvatthero pana yadipi mahākāruṇikā buddhā bhagavanto sattānaṃ hitasukhavidhānatapparā, vivekajjhāsayā pana visaṅkhāraninnā sabbasaṅkhāresu ajjhupekkhaṇabahulāti pañcamena mahāvipākacittena paṭisandhiggahaṇamāha.
However, Mahāsīva Thera says that although the Buddhas, the Bhagavants, are greatly compassionate and intent on arranging for the welfare and happiness of beings, they have a disposition towards seclusion, are inclined to disenchantment, and are mostly indifferent to all formations, and therefore their rebirth-linking is with the fifth great vipāka-citta.
Tuy nhiên, Trưởng lão Mahāsīva lại nói rằng, mặc dù các vị Phật, Thế Tôn, bậc Đại Bi, chuyên tâm vào việc mang lại lợi ích và hạnh phúc cho chúng sinh, nhưng các Ngài có khuynh hướng viễn ly, thiên về sự ly cấu, và thường trú trong sự xả đối với tất cả các pháp hữu vi; do đó, việc tái tục sinh của các Ngài là với tâm đại quả thứ năm.
Pure puṇṇamāya sattamadivasato paṭṭhāyāti puṇṇamāya pure sattamadivasato paṭṭhāya, sukkapakkhe navamito paṭṭhāyāti attho.
‘From the seventh day before the full moon’ means from the seventh day before the full moon, that is, from the ninth day of the bright fortnight.
“Từ ngày thứ bảy trước ngày trăng tròn” có nghĩa là từ ngày thứ bảy trước ngày trăng tròn, tức là từ ngày mùng chín của tuần trăng sáng.
Sattame divaseti āsāḷhīpuṇṇamāya.
‘On the seventh day’ means on the Āsāḷhī full moon day.
“Vào ngày thứ bảy” tức là ngày trăng tròn tháng Āsāḷha.
Idaṃ supinanti idāni vuccamānākāraṃ supinaṃ.
‘This dream’ means a dream of the kind now being described.
“Giấc mộng này” tức là giấc mộng có hình thức sắp được nói.
Nesaṃ deviyoti mahārājūnaṃ deviyo.
‘Their devis’ means the devis of the Mahārājas.
“Các vị hoàng hậu của những vị đó” tức là các vị hoàng hậu của các Đại Thiên Vương.
201. Vattamānasamīpe vattamāne viya voharīyatīti okkamatīti vuttanti āha – ‘‘okkanto hotīti attho’’ti.
201. He says that because it is used as if in the present when it is near the present, it is stated as ‘descends’ — ‘meaning, he has descended’.
201. “Okkamati” được nói vì trong thời hiện tại, người ta dùng như thể là ở gần thời hiện tại – “có nghĩa là đã đi vào”.
Evaṃ hotīti evaṃ vuttappakārenassa sampajānanā hoti.
‘It happens thus’ means his comprehension occurs in the manner described.
“Như vậy” có nghĩa là sự nhận biết của người ấy diễn ra theo cách đã nói.
Na okkamamāne paṭisandhikkhaṇassa duviññeyyattā.
Not ‘while descending’, due to the difficulty of discerning the moment of rebirth-linking.
“Không phải khi đang đi vào” vì sát-na tái tục sinh khó nhận biết.
Tathā ca vuttaṃ – ‘‘paṭisandhicittaṃ na jānātī’’ti.
And thus it is said, ‘one does not know the rebirth-linking consciousness’.
Và như đã nói: “không biết tâm tái tục sinh”.
Dasasahassacakkavāḷapattharaṇena vā appamāṇo.
Or ‘immeasurable’ due to pervading the ten-thousandfold world system.
Hoặc là “vô lượng” vì trải rộng mười ngàn cõi giới.
Ativiya samujjalabhāvena uḷāro.
‘Splendid’ due to being exceedingly resplendent.
“Cao quý” vì cực kỳ rực rỡ.
Devānubhāvanti devānaṃ pabhānubhāvaṃ.
‘The glory of the devas’ means the radiant glory of the devas.
“Uy lực của chư thiên” tức là uy lực của ánh sáng của chư thiên.
Devānañhi pabhaṃso obhāso adhibhavati, na tesaṃ ādhipaccaṃ.
Indeed, their radiance and effulgence overcome the devas, not their dominion.
Thật vậy, ánh sáng của chư thiên bị ánh sáng của Đức Phật lấn át, chứ không phải quyền năng của họ.
Tenāha ‘‘devāna’’ntiādi.
Therefore, it is said ‘of the devas’ and so on.
Vì thế, đã nói “của chư thiên” v.v.
Rukkhagacchādinā kenaci na haññatīti aghā, abādhā.
‘Aghā’ means unobstructed, not harmed by any trees, bushes, etc.
“Không chướng ngại” có nghĩa là không bị bất cứ cây cối, bụi rậm nào cản trở, không có sự cản trở.
Tenāha ‘‘niccavivaṭā’’ti.
Therefore, it is said ‘ever open’.
Vì thế, đã nói “luôn luôn rộng mở”.
Asaṃvutāti heṭṭhā upari ca kena ci na pihitā.
‘Unclosed’ means not covered by anything below or above.
“Không bị che chắn” có nghĩa là không bị bất cứ thứ gì che đậy ở dưới và ở trên.
Tenāha ‘‘heṭṭhāpi appatiṭṭhā’’ti.
Therefore, it is said ‘unsupported even below’.
Vì thế, đã nói “ngay cả ở dưới cũng không có chỗ tựa”.
Tattha pi-saddena yathā heṭṭhā udakassa pidhāyikā pathavī natthīti asaṃvutā lokantarikā, evaṃ uparipi cakkavāḷesu viya devavimānānaṃ abhāvato asaṃvutā appatiṭṭhāti dasseti.
There, by the word ‘pi’, it shows that just as the Lokantarika hell is uncovered because there is no earth to cover the water below, so too it is uncovered and unsupported above due to the absence of deva palaces as in other Cakkavāḷas.
Ở đây, với từ “pi” (cũng), nó chỉ ra rằng giống như ở dưới không có đất che nước nên Lokantarika là không che chắn, thì ở trên cũng không có các cung điện chư thiên như trong các cõi giới nên nó cũng không che chắn, không có chỗ tựa.
Andhakāro ettha atthīti andhakārā.
‘Andhakārā’ means there is darkness here.
“Tối tăm” vì có bóng tối ở đó.
Cakkhuviññāṇaṃ na jāyati ālokassābhāvato, na cakkhuno.
‘Eye-consciousness does not arise’ due to the absence of light, not due to the eye.
“Nhãn thức không sinh khởi” vì không có ánh sáng, chứ không phải vì con mắt.
Tathā hi ‘‘tena obhāsena aññamaññaṃ sañjānantī’’ti vuttaṃ.
Indeed, it is said, ‘They recognize one another by that radiance’.
Thật vậy, đã nói: “nhờ ánh sáng đó mà họ nhận biết lẫn nhau”.
Jambudīpe ṭhitamajjhanhikavelāyaṃ pubbavidehavāsīnaṃ atthaṅgamanavasena upaḍḍhaṃ sūriyamaṇḍalaṃ paññāyati, aparagoyānavāsīnaṃ uggamanavasena, evaṃ sesadīpesupīti āha – ‘‘ekappahāreneva tīsu dīpesu paññāyantī’’ti.
He says, ‘appearing simultaneously in three continents’, because at midday in Jambudīpa, half of the sun's orb is visible by its setting for the inhabitants of Pubbavideha, and by its rising for the inhabitants of Aparagoyāna, and likewise in the other continents.
Vào giữa trưa ở Jambudīpa, mặt trời xuất hiện một nửa theo cách lặn đối với cư dân Pubbavideha, và theo cách mọc đối với cư dân Aparagoyāna, và tương tự ở các châu lục khác; vì thế, đã nói: “chỉ trong một khoảnh khắc, mặt trời xuất hiện ở ba châu lục”.
Ito aññathā pana dvīsu eva dīpesu ekappahāreneva paññāyatīti.
Otherwise, it appears simultaneously in only two continents.
Còn nếu khác với cách này, thì chỉ trong một khoảnh khắc, mặt trời xuất hiện ở hai châu lục.
Ekekāya disāya nava nava yojanasatasahassāni andhakāravidhamanampi iminā nayena daṭṭhabbaṃ.
‘And the dispelling of darkness for nine hundred thousand yojanas in each direction’ should also be understood in this manner.
“Việc xua tan bóng tối chín trăm ngàn do-tu-na ở mỗi hướng” cũng nên được hiểu theo cách này.
Pabhāya nappahontīti attano pabhāya obhāsituṃ na abhisambhuṇanti.
‘Are not able with their light’ means they cannot illuminate with their own light.
“Không đủ ánh sáng” có nghĩa là không thể chiếu sáng bằng ánh sáng của chính mình.
Yugandharapabbatamatthakappamāṇe ākāse vicaraṇato, ‘‘cakkavāḷapabbatassa vemajjhena carantī’’ti vuttaṃ.
It is said, ‘moving through the middle of the Cakkavāḷa mountain’, due to their movement in the sky at the height of Yugandhara mountain.
Vì di chuyển trên không gian có kích thước bằng đỉnh núi Yugandhara, nên đã nói: “di chuyển ở giữa núi Cakkavāḷa”.
Vāvaṭāti khādanatthaṃ gaṇhituṃ upakkamantā.
‘Vāvaṭā’ means attempting to grasp for eating.
“Vāvaṭā” tức là cố gắng nắm bắt để ăn.
Viparivattitvāti vivaṭṭitvā.
‘Viparivattitvā’ means having turned around.
“Viparivattitvā” tức là xoay tròn.
Chijjitvāti mucchāpattiyā ṭhitaṭṭhānato muccitvā, aṅgapaccaṅgacchedanavasena vā chijjitvā.
‘Chijjitvā’ means released from the place where they were due to fainting, or ‘cut off’ by the cutting of limbs and minor parts.
“Chijjitvā” tức là thoát khỏi trạng thái bất tỉnh, hoặc “chijjitvā” theo cách cắt đứt các chi thể.
Accantakhāreti ātapasantāpābhāvena atisītabhāvaṃ sandhāya accantakhāratā vuttā siyā.
‘Exceedingly saline’ — the extreme salinity might be stated with reference to the extreme cold due to the absence of heat and warmth.
“Cực kỳ mặn” có thể được nói về độ mặn cực độ do không có sự nóng bức của mặt trời, mà là cực kỳ lạnh.
Na hi taṃ kappasaṇṭhānaudakaṃ sampattikaramahāmeghavuṭṭhaṃ pathavīsandhārakaṃ kappavināsakaudakaṃ viya khāraṃ bhavitumarahati.
Indeed, that water of the world's formation, rained by the great clouds bringing prosperity, which supports the earth, cannot be saline like the water that destroys a world-system.
Thật vậy, nước đó, là nước mưa từ những đám mây lớn mang lại sự thịnh vượng, duy trì trái đất, không thể mặn như nước hủy diệt thế giới.
Tathā hi sati pathavīpi vilīyeyya.
If it were so, the earth itself would dissolve.
Nếu vậy, ngay cả trái đất cũng sẽ tan chảy.
Tesaṃ vā pāpakammabalena petānaṃ pakatiudakassa pubbakheḷabhāvāpatti viya tassa udakassa tadā khārabhāvāpatti hotīti vuttaṃ ‘‘accantakhāre udake’’ti.
Or, it is said, ‘in exceedingly saline water’, because at that time that water becomes saline due to the power of their evil kamma, just as ordinary water becomes like pus and spittle for petas.
Hoặc là, do sức mạnh của ác nghiệp của họ, giống như nước bình thường của ngạ quỷ trở thành nước bọt, nước đó vào lúc đó trở nên mặn; vì thế, đã nói “trong nước cực kỳ mặn”.
Samantatoti sabbabhāgato chappakārampi.
‘From all sides’ means all six kinds of suffering from every direction.
“Từ mọi phía” tức là cả sáu loại từ mọi phía.
Manussesūti idaṃ pakaticārittavasena vuttaṃ – ‘‘manussitthiyā nāma manussapurisesu purisādhippāyacittaṃ uppajjeyyā’’ti, bodhisattamātu pana devesūpi tādisaṃ cittaṃ nuppajjateva.
‘Among human beings’ is stated according to common custom—‘for a human woman, a thought of desire for men would arise in relation to human men’. However, for the Bodhisatta’s mother, such a thought does not arise even in relation to devas.
“Trong loài người” điều này được nói theo tập quán thông thường – “tâm dục vọng đối với nam giới của một người phụ nữ loài người sẽ sinh khởi trong nam giới loài người”, nhưng đối với mẹ của Bồ-tát, ngay cả đối với chư thiên, tâm như vậy cũng không sinh khởi.
Yathā bodhisattassa ānubhāvena bodhisattassa mātu purisādhippāyacittaṃ nuppajjati, evaṃ tassa ānubhāveneva sā kenaci purisena anatikkamanīyāti āha – ‘‘pādā na vahanti, dibbasaṅkhalikā viya bajjhantī’’ti.
Just as a thought of desire for men does not arise in the Bodhisatta’s mother due to the Bodhisatta’s power, so too due to his power, she cannot be transgressed by any man; thus, it is said, ‘her feet do not move; they are bound as if by divine chains’.
Giống như do uy lực của Bồ-tát mà tâm dục vọng đối với nam giới không sinh khởi trong mẹ của Bồ-tát, thì cũng do uy lực đó mà bà không thể bị bất kỳ người đàn ông nào vượt qua; vì thế, đã nói: “chân không thể bước đi, như thể bị trói bằng xiềng xích thần thánh”.
Pubbe ‘‘kāmaguṇūpasaṃhitaṃ cittaṃ nuppajjatī’’ti vuttaṃ, puna ‘‘pañcahi kāmaguṇehi samappitā samaṅgībhūtā paricāretī’’ti vuttaṃ, kathamidaṃ aññamaññaṃ na virujjhatīti āha ‘‘pubbe’’tiādi.
Previously, it was said, ‘a thought accompanied by sensual pleasures does not arise’, and then it was said, ‘she is attended, endowed and complete with the five strands of sensual pleasure’. He states ‘previously’ and so on to explain how these do not contradict each other.
Trước đây đã nói “tâm liên quan đến dục lạc không sinh khởi”, sau đó lại nói “được phục vụ với đầy đủ năm dục lạc”; làm thế nào điều này không mâu thuẫn lẫn nhau? Vì thế, đã nói “trước đây” v.v.
Vatthupaṭikkhepoti abrahmacariyavatthupaṭisedho.
‘Rejection of the object’ means the prohibition of the object of unchastity.
“Vatthupaṭikkhepo” tức là sự cấm đoán về hành vi phi phạm hạnh.
Tenāha ‘‘purisādhippāyavasenā’’ti.
Therefore, it is said ‘by way of desiring men’.
Vì thế, đã nói “theo ý muốn của nam giới”.
Ārammaṇapaṭilābhoti rūpādipañcakāmaguṇārammaṇasseva paṭilābho.
‘Acquisition of the object’ means the acquisition of the object of the five strands of sensual pleasure, such as rūpa and so on.
“Ārammaṇapaṭilābho” tức là sự thọ nhận các đối tượng dục lạc năm loại như sắc v.v.
204. Kilamathoti khedo.
204. ‘Kilamatho’ means fatigue.
204. “Kilamatho” tức là sự mệt mỏi.
Kāyassa hi garubhāvakaṭhinabhāvādayopi tassā tadā na honti eva.
Indeed, heaviness and stiffness of body, etc., do not occur for her at that time.
Thật vậy, vào lúc đó, sự nặng nề, cứng nhắc v.v. của thân thể cũng không có ở bà.
‘‘Tirokucchigataṃ passatī’’ti vuttaṃ, kadā paṭṭhāya passatīti āha – ‘‘kalalādikālaṃ atikkamitvā’’tiādi.
It is said, ‘she sees what is within the womb’. When does she begin to see? He says, ‘after passing the stage of the kalala and so on’.
Đã nói “nhìn thấy thai nhi trong bụng”, từ khi nào thì nhìn thấy? Vì thế, đã nói “sau khi vượt qua giai đoạn kalala v.v.”.
Dassane payojanaṃ sayameva vadati, tassa abhāvato kalalādikāle na passati.
He himself states the purpose of seeing; due to its absence, she does not see during the kalala stage and so on.
Chính bà nói về mục đích của việc nhìn thấy, vì không có mục đích đó nên không nhìn thấy trong giai đoạn kalala v.v.
Puttenāti daharena mandena uttānaseyyakena.
‘By the son’ means by the young, weak infant lying on its back.
“Với con trai” tức là với đứa bé còn nhỏ, yếu ớt, nằm ngửa.
Yaṃ taṃ mātūtiādi pakaticārittavasena vuttaṃ.
‘That which is for the mother’ and so on is stated according to common custom.
“Điều đó của người mẹ” v.v. được nói theo tập quán thông thường.
Cakkavattigabbhatopi hi savisesaṃ bodhisattagabbho parihāraṃ labhati puññasambhārassa sātisayattā, tasmā bodhisattamātā ativiya sappāyāhārācārā ca hutvā sakkaccaṃ pariharati.
Indeed, the Bodhisatta's womb receives special care, even more than a Cakkavatti's womb, due to the exceeding abundance of accumulated merit. Therefore, the Bodhisatta's mother, having very wholesome food and conduct, carefully attends to it.
Quả thật, thai của Bồ-tát được chăm sóc đặc biệt hơn cả thai của một vị Chuyển Luân Vương, vì công đức tích lũy vượt trội. Do đó, mẹ của Bồ-tát, với thức ăn và hành vi rất thích hợp, đã cẩn thận chăm sóc thai.
Puratthābhimukhoti mātu puratthābhimukho.
Facing east means facing the mother's east.
Hướng về phía đông nghĩa là hướng về phía đông của người mẹ.
Idāni tirokucchigatassa dissamānatāya abbhantaraṃ bāhirañca kāraṇaṃ dassetuṃ, ‘‘pubbe katakamma’’ntiādi vuttaṃ.
Now, to show the internal and external reasons for him being seen while inside the womb, the phrase " deeds done previously" and so on was stated.
Giờ đây, để trình bày lý do bên trong và bên ngoài về việc vị ấy ở trong bụng có thể được nhìn thấy, câu “nghiệp đã làm từ trước” v.v. đã được nói.
Assāti deviyā.
To her means to the queen.
Của bà nghĩa là của vị hoàng hậu.
Vatthunti kucchiṃ.
Object means the womb.
Vật nghĩa là bụng.
Phalikaabbhapaṭalādino viya bodhisattamātukucchitacassa paṭalabhāvena ālokassa vibandhābhāvato yathā bodhisattamātā kucchigataṃ bodhisattaṃ passati, kimevaṃ bodhisattopi mātaraṃ aññañca purato rūpagataṃ passati, noti āha, ‘‘bodhisatto panā’’tiādi.
Just as the Bodhisatta's mother sees the Bodhisatta inside her womb because there is no obstruction of light due to the membrane of her womb, like a crystal cloud, the question is whether the Bodhisatta also sees his mother and other forms in front of him, or not. It is said: " But the Bodhisatta..." and so on.
Giống như mẹ của Bồ-tát nhìn thấy Bồ-tát trong bụng, vì không có sự cản trở của ánh sáng do màng bụng của mẹ Bồ-tát có tính chất như màng pha lê trong suốt, vậy Bồ-tát có nhìn thấy mẹ mình và những hình sắc khác ở phía trước không? Ngài nói, “Tuy nhiên, Bồ-tát…” v.v. (ngụ ý là không).
Kasmā pana sati cakkhumhi āloke ca na passatīti āha – ‘‘na hi antokucchiyaṃ cakkhuviññāṇaṃ uppajjatī’’ti.
Why, then, does he not see, despite having eyes and light? It is said: " For eye-consciousness does not arise inside the womb."
Vì sao khi có mắt và ánh sáng mà lại không thấy? Ngài nói – “Vì nhãn thức không khởi lên trong bụng”.
Assāsapassāsā viya hi tattha cakkhuviññāṇampi na uppajjati tajjāsamannāhārassābhāvato.
Indeed, just as breathing in and out, eye-consciousness also does not arise there, due to the absence of the requisite conditions.
Giống như hơi thở vào và ra, nhãn thức cũng không khởi lên ở đó vì không có sự tập hợp các yếu tố cần thiết.
205. Yathā aññā itthiyo vijātapaccayā tādisena rogena abhibhūtāpi hutvā maranti, bodhisattamātu pana bodhisatte kucchigate na koci rogo uppajjati; kevalaṃ āyuparikkhayeneva kālaṃ karoti, svāyamattho heṭṭhā vuttoyeva.
205. Just as other women, due to giving birth, are afflicted by such diseases and even die, no disease arises in the Bodhisatta's mother when the Bodhisatta is in her womb; she only passes away due to the exhaustion of her lifespan. This matter has already been stated below.
205. Giống như những phụ nữ khác, sau khi sinh, bị bệnh nặng và qua đời, nhưng mẹ của Bồ-tát, khi Bồ-tát còn trong bụng, không hề phát sinh bệnh tật; bà chỉ qua đời khi tuổi thọ đã hết, điều này đã được nói ở dưới.
Bodhisattena vasitaṭṭhānaṃ hītiādinā tattha kāraṇamāha.
He states the reason there with " For the place inhabited by the Bodhisatta" and so on.
Ngài nói lý do ở đó bằng câu “Vì nơi Bồ-tát đã cư ngụ” v.v.
Apanetvāti aggamahesiṭṭhānato nīharitvā.
Having removed means having expelled from the position of chief queen.
Loại bỏ nghĩa là loại bỏ khỏi vị trí hoàng hậu.
Anurakkhituṃ na sakkotīti sammā gabbhaparihāraṃ nānuyuñjati, tena gabbho bahvābādho hoti.
Cannot protect means does not properly attend to the care of the womb, so the womb becomes afflicted with many diseases.
Không thể bảo vệ nghĩa là không thể chăm sóc thai nhi đúng cách, do đó thai nhi bị nhiều bệnh tật.
Vatthuvisadaṃ hotīti gabbhāsayo parisuddho hoti.
The object is pure means the womb is purified.
Tử cung trong sạch nghĩa là tử cung thanh tịnh.
Mātu majjhimavayassa tatiyakoṭṭhāse bodhisattassa gabbhokkamanampi tassā āyuparimāṇavilokaneneva saṅgahitaṃ vayovasena uppajjanakavikārassa parivajjanato, itthisabhāvena uppajjanakavikāro pana bodhisattassa ānubhāveneva vūpasammati.
The Bodhisatta's conception in the third quarter of the mother's middle age is also included by observing her lifespan, thereby avoiding distortions arising due to age. However, distortions arising due to a woman's nature subside by the power of the Bodhisatta.
Việc Bồ-tát nhập thai vào phần ba giữa tuổi trung niên của người mẹ cũng được bao gồm trong việc xem xét giới hạn tuổi thọ của bà, để tránh những biến đổi phát sinh theo tuổi tác; còn những biến đổi phát sinh do bản chất phụ nữ thì tự lắng dịu nhờ uy lực của Bồ-tát.
Sattamāsajātoti paṭisandhiggahaṇato sattame māse jāto.
Born in the seventh month means born in the seventh month from the moment of conception.
Sinh vào tháng thứ bảy nghĩa là sinh vào tháng thứ bảy kể từ khi thọ thai.
So sītuṇhakkhamo na hoti ativiya sukhumālatāya.
Such a child cannot endure cold and heat due to extreme delicacy.
Vị ấy không chịu được nóng lạnh vì quá mềm yếu.
Aṭṭhamāsajāto kāmaṃ sattamāsajātato buddhiavayavo, ekacce pana cammapadesā buddhiṃ pāpuṇantā ghaṭṭanaṃ na sahanti, tena so na jīvati.
A child born in the eighth month is indeed more developed than one born in the seventh month, but certain skin areas, though developed, cannot withstand friction, therefore that child does not live.
Mặc dù người sinh vào tháng thứ tám có các bộ phận phát triển hơn người sinh vào tháng thứ bảy, nhưng một số vùng da khi phát triển đến mức nhất định lại không chịu được va chạm, do đó người ấy không sống được.
Sattamāsajātassa pana na tāva te jātāti vadanti.
But they say that these parts are not yet developed in a child born in the seventh month.
Còn đối với người sinh vào tháng thứ bảy, người ta nói rằng những vùng đó chưa phát triển đến mức ấy.
Ṭhitāva hutvāti niddukkhatāya ṭhitā eva hutvā.
Standing means standing without suffering, due to the absence of pain.
Đứng thẳng nghĩa là đứng thẳng mà không đau đớn.
Dukkhassa hi balavabhāvato taṃ dukkhaṃ asahamānā aññā itthiyo nisinnā vā nipannā vā vijāyanti.
Due to the intensity of pain, other women, unable to bear that pain, give birth while seated or lying down.
Vì sự đau đớn quá mạnh, những phụ nữ khác không chịu nổi cơn đau mà ngồi hoặc nằm để sinh con.
Upavijaññāti upagatavijāyanakālā.
Approaching childbirth means the time of childbirth has arrived.
Gần đến lúc sinh nghĩa là thời điểm sinh nở đã đến gần.
Sakalanagaravāsinoti kapilavatthuṃ parivāretvā ṭhitesu devadahādīsu chasu nagaresu vasantā.
All city dwellers means those residing in the six cities like Devadaha and others surrounding Kapilavatthu.
Tất cả cư dân thành phố nghĩa là những người sống ở sáu thành phố như Devadaha v.v. bao quanh Kapilavatthu.
Devā naṃ paṭhamaṃ paṭiggaṇhantīti lokanāthaṃ mahāpurisaṃ mayameva paṭhamaṃ paṭiggaṇhāmāti sañjātagāravabahumānā attano pītiṃ pavedentā khīṇāsavā suddhāvāsabrahmāno ādito paṭiggaṇhanti.
The devas receive him first: The Arahants, the Pure Abode Brahmās, being filled with reverence and respect, expressing their joy, receive the Lord of the World, the Great Being, first, thinking, "We ourselves shall receive him first."
Chư thiên đón đỡ Ngài trước tiên nghĩa là các vị Phạm thiên Suddhāvāsa đã diệt tận các lậu hoặc, với lòng tôn kính và quý trọng phát sinh, bày tỏ niềm hoan hỷ của mình rằng “chính chúng ta sẽ đón đỡ vị Đại Nhân, bậc Hộ Thế, trước tiên”.
Sūtivesanti sūtijagganadhātivesaṃ.
Lying-in attire means the attire for attending to childbirth.
Trang phục hộ sản nghĩa là trang phục của nữ hộ sinh.
Eketi uttaravihāravāsino.
Some means the residents of Uttaravihāra.
Một số nghĩa là cư dân của Uttaravihāra.
Macchakkhisadisaṃ chavivasena.
Fish-eye-like in terms of skin.
Giống mắt cá về màu da.
Bhaggavibhaggāti sambādhaṭṭhānato nikkhamanena vibhāvitattā bhaggā vibhaggā viya ca hutvā.
Broken and fragmented means appearing broken and fragmented as if revealed by emerging from a confined space.
Bị phá vỡ và phân tán nghĩa là như bị phá vỡ và phân tán do thoát ra khỏi nơi chật hẹp.
Tena nesaṃ avisadabhāvameva dasseti.
Thereby, it shows their lack of clarity.
Điều này chỉ ra rằng chúng không rõ ràng.
Alaggo hutvāti gabbhāsaye yonipadese ca katthaci alaggo asatto hutvā.
Not clinging means not clinging or adhering anywhere in the womb or the vaginal region.
Không dính mắc nghĩa là không dính mắc, không bám víu vào tử cung hay vùng âm đạo.
Udakenāti gabbhāsayagatena udakena amakkhito nikkhamati sammakkhitassa tādisassa udakasemhādikasseva tattha abhāvato.
Not smeared with water means not smeared with the water in the womb, as such water, phlegm, etc., are absent there.
Bởi nước nghĩa là bởi nước trong tử cung, thoát ra không bị vấy bẩn, vì ở đó không có nước, đờm dãi v.v. như vậy để vấy bẩn.
Bodhisattassa hi puññānubhāvena paṭisandhiggahaṇato paṭṭhāya taṃ ṭhānaṃ visuddhaṃ paramasugandhagandhakuṭi viya candanagandhaṃ vāyantaṃ tiṭṭhati.
Indeed, by the power of the Bodhisatta's merit, from the moment of conception, that place remains pure, like a perfectly fragrant perfume chamber, emitting the fragrance of sandalwood.
Thật vậy, nhờ uy lực công đức của Bồ-tát, từ khi thọ thai, nơi đó luôn thanh tịnh, giống như một hương thất thơm ngát hương chiên đàn.
Udakavaṭṭiyoti udakakkhandhā.
Streams of water means masses of water.
Các luồng nước nghĩa là các khối nước.
Na kho panevaṃ daṭṭhabbanti sattapadavītihārato pageva disāvilokanassa katattā.
It should not be seen thus because looking in the directions was done even before taking seven steps.
Không nên thấy như vậy vì việc nhìn các phương hướng đã được thực hiện trước khi đi bảy bước.
Tenāha ‘‘mahāsatto hī’’tiādi.
Therefore, he says: " For the Great Being..." and so on.
Do đó, Ngài nói “Vì Đại sĩ” v.v.
Ekaṅgaṇānīti vivaṭabhāvena vihāraṅgaṇapariveṇaṅgaṇāni viya ekaṅgaṇasadisāni ahesuṃ.
One-courted means they became like one courtyard, like the courtyards of vihāras and monastic compounds, in their openness.
Trở thành một sân nghĩa là trở thành giống như một sân duy nhất, như sân tu viện và sân khu vực tu viện, do tính chất rộng mở.
Sadisopi natthīti tumhākaṃ idaṃ vilokanaṃ visiṭṭhe passituṃ idha tumhehi sadisopi natthi, kuto uttaritaroti āhaṃsu.
There is no equal means, "To see something superior to this, there is no one here equal to you; how much less a superior one?" they said.
Không có ai tương đương nghĩa là “không có ai tương đương với các người ở đây để nhìn thấy điều đặc biệt này, huống hồ là cao hơn”, họ nói vậy.
Sabbapaṭhamoti sabbappadhāno.
Foremost means the most excellent of all.
Đầu tiên nghĩa là tối thượng.
Padhānapariyāyo hi idha paṭhamasaddo.
Indeed, the word 'first' here is synonymous with 'foremost'.
Thật vậy, từ “đầu tiên” ở đây là đồng nghĩa với “tối thượng”.
Tenāha ‘‘itarānī’’tiādi.
Therefore, he says: " The others..." and so on.
Do đó, Ngài nói “Những người khác” v.v.
Ettha ca mahesakkhā tāva devā tathā vadanti, itare pana kathanti?
And here, the powerful devas speak thus, but how do the others speak?
Ở đây, chư thiên có đại uy lực đã nói như vậy, còn những người khác thì sao?
Mahāsattassa ānubhāvadassaneneva.
Simply by witnessing the Great Being's power.
Chỉ bằng cách chứng kiến uy lực của Đại sĩ.
Mahesakkhānañhi devānaṃ mahāsattassa ānubhāvo viya tena sadisānampi ānubhāvo paccakkho ahosi.
Indeed, for the powerful devas, the Great Being's power, and the power of those similar to him, was directly perceived.
Thật vậy, đối với chư thiên có đại uy lực, uy lực của Đại sĩ cũng như uy lực của những vị tương đương với Ngài đều là điều hiển nhiên.
Itare pana tesaṃ vacanaṃ sutvā saddahantā anuminantā tathā āhaṃsu.
The others, however, hearing their words, believed and inferred, and spoke thus.
Còn những người khác, sau khi nghe lời của họ, đã tin và suy luận rồi nói như vậy.
Jātamattasseva bodhisattassa ṭhānādīni yesaṃ visesādhigamānaṃ pubbanimittabhūtānīti te niddhāretvā dassento, ‘‘ettha cā’’tiādimāha.
Explaining and showing which special attainments the Bodhisatta's posture and so on, immediately upon birth, were the forewarnings of, he says: " And here..." and so on.
Để xác định và chỉ ra những điểm đặc biệt của Bồ-tát ngay khi vừa sinh ra, là những điềm báo trước cho những thành tựu đặc biệt, Ngài nói “Ở đây” v.v.
Tattha patiṭṭhānaṃ catuiddhipādapaṭilābhassa pubbanimittaṃ iddhipādavasena lokuttaradhammesu suppatiṭṭhitabhāvasamijjhanato.
Therein, the standing is a forewarning of the attainment of the four bases of psychic power, due to the accomplishment of being well-established in supramundane qualities through the bases of psychic power.
Trong đó, sự đứng vững là điềm báo trước cho việc thành tựu bốn thần túc, vì sự thành tựu vững chắc trong các pháp siêu thế nhờ thần túc.
Uttarābhimukhabhāvo lokassa uttaraṇavasena gamanassa pubbanimittaṃ.
The facing north is a forewarning of proceeding by surpassing the world.
Hướng về phía bắc là điềm báo trước cho sự siêu việt thế gian.
Sattapadagamanaṃ sattabojjhaṅgādigamanassa pubbanimittaṃ, visuddhachattadhāraṇaṃ suvisuddhavimuttichattadhāraṇassa pubbanimittaṃ, pañcarājakakudhabhaṇḍāni pañcavidhavimuttiguṇaparivāratāya pubbanimittaṃ, anāvaṭadisānuvilokanaṃ anāvaṭañāṇatāya pubbanimittaṃ, ‘‘aggohamasmī’’tiādivacanaṃ appaṭivattiyadhammacakkapavattanassa pubbanimittaṃ; ayamantimā jātī ti āyatiṃ jātiyā abhāvakittanā anupādi…pe… pubbanimittanti veditabbaṃ; tassa tassa anāgate laddhabbavisesassa taṃ taṃ nimittaṃ abyabhicārīnimittanti daṭṭhabbaṃ.
Walking seven steps is a forewarning of proceeding through the seven factors of awakening and so on; wearing the purified umbrella is a forewarning of wearing the utterly purified umbrella of liberation; the five royal emblems are a forewarning of being surrounded by the five kinds of qualities of liberation; looking in uncovered directions is a forewarning of unobstructed knowledge; the statement "I am the foremost" and so on is a forewarning of setting in motion the irreversible Dhamma-wheel; the statement "This is the final birth" proclaiming the absence of future birth should be understood as a forewarning of non-clinging... and so on; that specific sign should be regarded as an unerring sign of that specific distinction to be attained in the future.
Đi bảy bước là điềm báo trước cho sự siêu việt các chi phần giác ngộ v.v., sự che chở bằng lọng thanh tịnh là điềm báo trước cho sự che chở bằng lọng giải thoát hoàn toàn thanh tịnh, năm vật báu của vua là điềm báo trước cho sự bao quanh bởi năm loại đức giải thoát, việc nhìn các phương hướng không bị che khuất là điềm báo trước cho trí tuệ không bị che khuất, lời nói “Ta là tối thượng” v.v. là điềm báo trước cho việc chuyển pháp luân bất thối chuyển; lời tuyên bố “Đây là kiếp cuối cùng” nghĩa là không còn tái sinh trong tương lai, là điềm báo trước cho sự vô dư… v.v. cần được hiểu là điềm báo trước; cần phải hiểu rằng mỗi điềm báo đó là điềm báo không sai lầm cho những thành tựu đặc biệt sẽ đạt được trong tương lai.
Na āgatoti imasmiṃ sutte aññattha ca vakkhamānāya anupubbiyā anāgatataṃ sandhāya vuttaṃ.
Not arrived is stated with reference to the non-arrival of the gradual exposition to be spoken of in this Sutta and elsewhere.
Không đến được nói để chỉ sự chưa đến của thứ tự tuần tự sẽ được nói trong kinh này và những nơi khác.
Āharitvāti tasmiṃ tasmiṃ sutte aṭṭhakathāsu ca āgatanayena āharitvā dīpetabbo.
“Āharitvā” means it should be brought forth and explained according to the method found in various suttas and commentaries.
Āharitvā có nghĩa là cần phải được trình bày bằng cách dẫn ra theo cách đã được đề cập trong các kinh và các chú giải ấy.
Dasasahassilokadhātu kampīti pana idaṃ satipi idha pāḷiyaṃ āgatatte vakkhamānānamacchariyānaṃ mūlabhūtaṃ dassetuṃ vuttaṃ, evaṃ aññampīdisaṃ daṭṭhabbaṃ.
However, the statement “the ten-thousand world-system shook” was made to show this as the foundation of the marvels to be spoken of, even though it is found here in the Pali text. Similarly, other such instances should be understood.
Mười ngàn thế giới chấn động điều này được nói ra để chỉ rõ căn nguyên của những điều kỳ diệu sắp được đề cập, mặc dù nó đã được đề cập trong kinh điển ở đây. Tương tự, những điều khác như vậy cũng cần được hiểu.
Tanti baddhā vīṇā, cammabaddhā bheriyoti pañcaṅgikatūriyassa nidassanamattaṃ, ca-saddena vā itaresampi saṅgaho daṭṭhabbo.
“String-bound lutes, hide-bound drums” are merely examples of the five-fold musical instrument, or by the word “and” the inclusion of others should be understood.
Đàn vīṇā căng dây, trống bherī bọc da chỉ là ví dụ về nhạc cụ năm bộ phận, hoặc với từ “và” (ca-saddena) thì cần hiểu rằng các loại khác cũng được bao gồm.
Bhijjiṃsūti pādesu baddhaṭṭhānesuyeva bhijjiṃsu.
“Bhijjiṃsu” means they broke at the places where they were bound by the feet.
Bhijjiṃsū có nghĩa là chúng chỉ vỡ tan tại những chỗ bị buộc bằng chân.
Vigacchiṃsūti vūpasamiṃsu.
“Vigacchiṃsu” means they ceased.
Vigacchiṃsū có nghĩa là chúng đã lắng xuống.
Sakatejobhāsitānīti ativiya samujjalāya attano pabhāya obhāsitāni ahesuṃ.
“Sakatejobhāsitāni” means they were illuminated by their own exceedingly brilliant radiance.
Sakatejobhāsitānī có nghĩa là chúng đã được chiếu sáng bởi ánh sáng rực rỡ của chính mình.
Na pavattīti na sandī.
“Na pavattī” means it did not flow.
Na pavattī có nghĩa là không chảy.
Vāto na vāyīti kharo vāto na vāyi, mudusukho pana sattānaṃ sukhāvaho vāyi.
“Vāto na vāyī” means a harsh wind did not blow; rather, a gentle, pleasant wind, conducive to the well-being of beings, blew.
Gió không thổi có nghĩa là gió mạnh không thổi, nhưng gió nhẹ nhàng và dễ chịu thì thổi, mang lại sự thoải mái cho chúng sinh.
Pathavīgatā ahesuṃ uccaṭṭhāne ṭhātuṃ avisahantā.
“Pathavīgatā ahesuṃ” means unable to remain in a high place, they went to the earth.
Pathavīgatā ahesuṃ (chúng đã đi xuống đất) có nghĩa là chúng không thể đứng vững ở những nơi cao.
Utusampannoti anuṇhāsītatāsaṅkhātena utunā sampanno.
“Utusampanno” means endowed with the season, characterized by neither excessive heat nor cold.
Utusampanno có nghĩa là đầy đủ theo mùa, tức là không quá nóng cũng không quá lạnh.
Vāmahatthaṃ ure ṭhapetvā dakkhiṇena puthupāṇinā hatthatāḷanena saddakaraṇaṃ apphoṭanaṃ.
“Apphoṭanaṃ” is the act of making a sound by striking the hands, placing the left hand on the chest and clapping with the wide right hand.
Apphoṭanaṃ là việc tạo ra âm thanh bằng cách vỗ tay với bàn tay rộng, đặt tay trái lên ngực và dùng tay phải.
Mukhena usseḷanaṃ saddamuñcanaṃ seḷanaṃ.
“Seḷanaṃ” is the act of emitting a sound, hooting, with the mouth.
Seḷanaṃ là việc phát ra âm thanh từ miệng, là tiếng reo hò.
Ekaddhajamālā ahosī ti ettha iti-saddo ādiattho.
In “ekaraddhajamālā ahosī” the word “iti” has the meaning of “etcetera”.
Trong câu Ekaddhajamālā ahosī (một chuỗi cờ hiệu đã xuất hiện), từ iti có nghĩa là “vân vân” (ādiattho).
Tena vicittapupphasugandhapupphavassadevā vassiṃsu, sūriye dibbamāne eva tārakā obhāsiṃsu, acchaṃ vippasannaṃ udakaṃ pathavito ubbhijji, bilāsayā darisayā tiracchānā āsayato nikkhamiṃsu; rāgadosamohāpi tanu bhaviṃsu, pathaviyaṃ rajo vūpasami, aniṭṭhagandho vigacchi, dibbagandho vāyi, rūpino devā sarūpeneva manussānaṃ āpāthamagamaṃsu, sattānaṃ cutupapātā nāhesunti imesaṃ saṅgaho daṭṭhabbo.
By this, it should be understood that variegated flowers and fragrant flowers rained down, and devas rained flowers; stars shone even when the sun was shining divinely; clear, serene water burst forth from the earth; creatures dwelling in holes and caves came out of their abodes; even greed, hatred, and delusion became attenuated; dust on the earth settled; unpleasant odors vanished; divine fragrance blew; devas with forms appeared in their own forms to humans; and there was no passing away or reappearance of beings.
Do đó, cần hiểu rằng nó bao gồm những điều này: Chư thiên đã rải hoa đủ màu sắc và hoa thơm, các vì sao đã chiếu sáng ngay cả khi mặt trời rực rỡ, nước trong vắt đã trào lên từ đất, các loài động vật sống trong hang và hang động đã ra khỏi nơi trú ẩn của chúng; tham, sân, si cũng trở nên mỏng manh, bụi trên mặt đất lắng xuống, mùi khó chịu biến mất, mùi hương thần thánh lan tỏa, các vị thiên hữu sắc đã hiện hình trước mắt loài người, và sự chết và tái sinh của chúng sinh đã không xảy ra.
Yāni mahābhinīhārasamaye uppannāni dvattiṃsa pubbanimittāni, tāni anavasesāni tadā ahesunti.
All thirty-two premonitory signs that arose at the time of the Great Renunciation were present then without exception.
Và tất cả ba mươi hai điềm báo trước đã xuất hiện vào thời điểm Đại Biến Cố đều đã xảy ra vào lúc đó.
Tatrāpīti tesupi pathavikampādīsu evaṃ pubbanimittabhāvo veditabbo, na kevalaṃ sampatijātassa ṭhānādīsu evāti adhippāyo.
“Tatrāpi” means that in those earth tremors and other phenomena, such premonitory signs should be understood, and not merely in the context of the newly born Buddha at the places mentioned, is the intention.
Tatrāpī có nghĩa là ngay cả trong những sự kiện như động đất, v.v., cần phải hiểu rằng chúng là điềm báo trước như vậy, chứ không chỉ ở những nơi liên quan đến sự kiện mới sinh này mà thôi.
Sabbaññutaññāṇapaṭilābhassa pubbanimittaṃ sabbassa ñeyyassa titthakaramatassa ca cālanato.
A premonitory sign of the attainment of Omniscience, due to the shaking of all knowable things and all heterodox views.
Điềm báo trước của sự chứng đắc Toàn Tri Tuệ là do sự lay động của tất cả những gì cần được biết và các quan điểm của ngoại đạo.
Kenaci anussāhitānaṃyeva imasmiṃyeva ekacakkavāḷe sannipāto, kenaci anussāhitānaṃyeva ekappahāreneva sannipatitvā dhammapaṭiggaṇhanassa pubbanimittaṃ, paṭhamaṃ devatānaṃ paṭiggahaṇaṃ dibbavihārapaṭilābhassa, pacchā manussānaṃ paṭiggahaṇaṃ tattheva ṭhānassa niccalasabhāvato āneñjavihārapaṭilābhassa pubbanimittaṃ.
The gathering in this very single cosmos of those who were not urged by anyone is a premonitory sign of the spontaneous reception of the Dhamma by gathering all at once without anyone urging them. The initial reception by devas is a premonitory sign of the attainment of divine abodes, and the subsequent reception by humans is a premonitory sign of the attainment of the imperturbable abiding due to the steadfast nature of that very place.
Sự tụ họp trong cùng một thế giới này mà không ai khuyến khích, và sự tiếp nhận Pháp ngay lập tức mà không ai khuyến khích, là điềm báo trước của sự tiếp nhận Pháp. Sự tiếp nhận đầu tiên của chư thiên là điềm báo trước của sự chứng đắc thiền định cõi trời (dibbavihāra). Sự tiếp nhận sau đó của loài người là điềm báo trước của sự chứng đắc thiền định bất động (āneñjavihāra), do tính chất kiên cố của vị trí đó.
Vīṇānaṃ sayaṃ vajjanaṃ parūpadesena vinā sayameva anupubbavihārapaṭilābhassa pubbanimittaṃ.
The spontaneous playing of lutes without instruction by others is a premonitory sign of the attainment of the gradual abodes by himself.
Việc đàn vīṇā tự động vang lên mà không cần sự hướng dẫn của người khác là điềm báo trước của sự chứng đắc các tầng thiền định tuần tự (anupubbavihāra) một cách tự nhiên.
Bherīnaṃ vajjanaṃ cakkavāḷapariyantāya parisāya pavedanasamatthassa dhammabheriyā anusāvanassa amatadundubhighosanassa pubbanimittaṃ.
The playing of drums is a premonitory sign of the proclamation of the Dhamma-drum, capable of making known to the assembly throughout the cosmos, the declaration of the Deathless Drum.
Việc trống bherī vang lên là điềm báo trước của sự tuyên bố Pháp Cổ (dhammabherī), có khả năng loan báo cho toàn thể hội chúng đến tận cùng các thế giới, và sự công bố trống bất tử (amatadundubhi).
Andubandhanādīnaṃ chedo mānavinibandhachedanassa pubbanimittaṃ; supaṭṭanasampāpuṇanaṃ atthādi anurūpaṃ atthādīsu ñāṇassa bhedādhigamassa pubbanimittaṃ.
The breaking of fetters and bonds is a premonitory sign of the breaking of Mara’s bonds; the attainment of a firm footing is a premonitory sign of the penetration and acquisition of knowledge in the meanings and other aspects, corresponding to the meaning and other aspects.
Sự đứt gãy của các dây trói, v.v. là điềm báo trước của sự cắt đứt các trói buộc của Māra; sự đạt đến chỗ đứng vững chắc là điềm báo trước của sự thâm nhập các chi phần của trí tuệ về các ý nghĩa, v.v., phù hợp với các ý nghĩa, v.v.
Nibbānarasenāti kilesānaṃ nibbāyanarasena.
“Nibbānarasenā” means by the essence of the extinction of defilements.
Nibbānarasenā có nghĩa là với vị giải thoát (nibbāna) khỏi các phiền não.
Ekarasabhāvassāti sāsanassa sabbattha ekarasabhāvassa.
“Ekarasabhāvassā” means of the singular essence of the Dispensation everywhere.
Ekarasabhāvassā có nghĩa là tính chất nhất vị của Giáo Pháp ở khắp mọi nơi.
Vātassa avāyanaṃ kissa pubbanimittanti āha ‘‘dvāsaṭṭhidiṭṭhigatabhindanassā’’ti.
What is the premonitory sign of the wind not blowing? He states: “of the breaking of the sixty-two wrong views.”
Việc gió không thổi là điềm báo trước của điều gì? Ngài nói: “Của sự phá vỡ sáu mươi hai tà kiến”.
Ākāsādiappatiṭṭhavisamacañcalaṭṭhānaṃ pahāya sakuṇānaṃ pathavīgamanaṃ tādisaṃ micchāgāhaṃ pahāya sattānaṃ pāṇehi ratanattayasaraṇagamanassa pubbanimittaṃ.
The descent of birds to the earth, abandoning the unstable, uneven, and shaky abodes of space and so forth, is a premonitory sign of beings going for refuge to the Triple Gem with their lives, abandoning such wrong views.
Việc chim chóc bay xuống đất, bỏ lại những nơi không có chỗ đứng, không ổn định và chênh vênh như hư không, là điềm báo trước của việc chúng sinh quy y Tam Bảo bằng cả mạng sống của mình, bỏ lại những chấp thủ sai lầm tương tự.
Devatānaṃ apphoṭanādīhi kīḷanaṃ pamodanuppattiudānassa bhavavantagamanena dhammasabhāvabodhanena ca pamodavibhāvanassa pubbanimittaṃ.
The devas’ rejoicing with clapping and so forth, and the arising of joy from the Udāna, and the manifestation of joy through the understanding of the nature of Dhamma by reaching the end of existence, is a premonitory sign.
Việc chư thiên vui đùa bằng cách vỗ tay, v.v., là điềm báo trước của sự xuất hiện niềm hoan hỷ và sự thể hiện niềm hoan hỷ thông qua việc đạt đến đỉnh cao của hữu và sự giác ngộ bản chất của Pháp.
Dhammavegavassanassā ti desanāñāṇavegena dhammāmatassa vassanassa pubbanimittaṃ.
“Dhammavegavassanassā” means a premonitory sign of the showering of the Dhamma nectar with the swiftness of the teaching-knowledge.
Dhammavegavassanassā có nghĩa là điềm báo trước của việc mưa Pháp bất tử với tốc độ của trí tuệ thuyết pháp.
Kāyagatāsativasena laddhajjhānaṃ pādakaṃ katvā uppāditamaggaphalasukhānubhavo kāyagatāsatiamatapaṭilābho, tassa pana kāyassapi atappakasukhāvahattā khudāpipāsāpīḷanābhāvo pubbanimittaṃ vutto.
The experience of the bliss of the path and its fruit, attained by making mindfulness of the body the foundation for the jhānas, is the attainment of the Deathless through mindfulness of the body. The absence of suffering from hunger and thirst is stated as its premonitory sign, as even the body itself brings such immense comfort.
Sự chứng đắc bất tử của niệm thân (kāyagatāsatiamatapaṭilābho) là kinh nghiệm về hạnh phúc của đạo quả được tạo ra bằng cách lấy thiền định đã đạt được nhờ niệm thân làm nền tảng. Và việc không bị đói khát hành hạ được nói là điềm báo trước của điều đó, vì ngay cả thân này cũng mang lại hạnh phúc không làm thỏa mãn.
Ariyaddhajamālāmālitāyāti sadevakassa lokassa ariyamaggabojjhaṅgadhajamālāhi mālitabhāvassa pubbanimittaṃ.
“Ariyaddhajamālāmālitāyā” means a premonitory sign of the adorned state of the world with its devas by the garlands of the Noble Path and Factors of Awakening.
Ariyaddhajamālāmālitāyā có nghĩa là điềm báo trước của việc thế gian cùng với chư thiên được trang hoàng bằng các chuỗi cờ hiệu của Thánh đạo và các chi phần giác ngộ (bojjhaṅga).
Yaṃ panettha anuddhaṭaṃ, taṃ suviññeyyameva.
Whatever is not elaborated here is indeed easily comprehensible.
Những gì không được đề cập ở đây thì đã quá rõ ràng.
Etthāti ‘‘sampatijāto’’tiādinā āgate imasmiṃ ṭhāne.
“Etthā” means in this passage, that is, in the passage beginning “sampatijāto” (newly born).
Etthā có nghĩa là ở chỗ này, được đề cập trong câu “sampatijāto” (vị mới sinh), v.v.
Vissajjitova, tasmā amhehi idha apubbaṃ vattabbaṃ natthīti adhippāyo.
It has been explained, therefore, there is nothing new for us to say here, is the intention.
Đã được giải thích, do đó, không có gì mới để chúng tôi nói ở đây, đó là ý nghĩa.
Tadā pathaviyaṃ gacchantopi mahāsatto ākāsena gacchanto viya mahājanassa upaṭṭhāsīti ayamettha niyati dhammaniyāmo bodhisattānaṃ dhammatāti idaṃ niyativādavasena kathanaṃ.
The Great Being, though walking on the earth at that time, appeared to the great multitude as if walking through the air—this is a statement in terms of determinism, implying that it is a fixed rule, a dhammaniyāma, for Bodhisattas.
Vào lúc đó, Bồ Tát, dù đi trên đất, nhưng lại hiện ra trước đại chúng như đang đi trên không. Điều này, tức là quy luật tự nhiên (dhammaniyāmo) là bản chất của các vị Bồ Tát, là lời nói theo thuyết định mệnh (niyativādavasena).
‘‘Pubbe purimajātīsu tādisassa puññasambhārakammassa katattā upacitattā mahājanassa tathā upaṭṭhāsī’’ti idaṃ pubbekatakammavādavasena kathanaṃ.
“Because such meritorious actions and accumulated good kamma were performed in previous births, he appeared thus to the great multitude”—this is a statement in terms of the doctrine of past kamma.
“Do đã tạo và tích lũy những hành động phước thiện như vậy trong các kiếp trước, Ngài đã hiện ra như vậy trước đại chúng” – đây là lời nói theo thuyết nghiệp đã tạo từ trước (pubbekatakammavādavasena).
Imesaṃ sattānaṃ upari īsanasīlatāya yathāsakaṃ kammameva issaro nāma, tassa nimmānaṃ attano phalassa nibbattanaṃ, mahāpurisopi sadevakaṃ lokaṃ abhibhavituṃ samatthena uḷārena puññakammunā nibbattito tena issarena nimmito nāma, tassa cāyaṃ nimmānaviseso, yadidaṃ mahānubhāvatā.
For these beings, their respective kamma itself is the lord, due to its nature of ruling over them; its creation is the production of its own fruit; the Great Man, too, was brought forth by sublime meritorious kamma capable of overpowering the world with its devas, and thus he is said to be created by that lord; and this is a special creation of his, namely, great power.
Đối với những chúng sinh này, nghiệp của chính họ là Đấng Tối Cao (Issara), do có khuynh hướng cai quản họ. Sự tạo tác của Đấng Tối Cao đó là sự sinh ra quả của chính nó. Vị Đại Nhân cũng được tạo ra bởi Đấng Tối Cao đó, tức là được sinh ra bởi nghiệp phước thiện cao cả có khả năng vượt qua thế gian cùng với chư thiên. Và đây là sự đặc biệt của sự tạo tác đó, tức là sự vĩ đại của Ngài.
Yāya mahājanassa tathā upaṭṭhāsīti idaṃ issaranimmānavādavasena kathanaṃ.
“Because of which he appeared thus to the great multitude”—this is a statement in terms of the doctrine of divine creation.
Mà nhờ đó Ngài đã hiện ra như vậy trước đại chúng – đây là lời nói theo thuyết tạo tác của Đấng Tối Cao (issaranimmānavādavasena).
Evaṃ taṃ taṃ bahuṃ vatvā kiṃ imāya pariyāyakathāyāti avasāne ujukameva evaṃ byākāsi.
Having spoken much in various ways, he said, “What is the use of this indirect speech?” In the end, he explained directly thus.
Sau khi nói nhiều điều như vậy, Ngài nói: “Cần gì những lời giải thích gián tiếp này?” và cuối cùng đã tuyên bố một cách thẳng thắn như sau.
Sampatijāto pathaviyaṃ kathaṃ padasā gacchati, evaṃmahānubhāvo ākāsena maññe gacchatīti parikappanassa vasena ākāsena gacchanto viya ahosi.
To the supposition of how the newly born, so great in power, walked on the earth with his feet, he appeared to the great multitude as if walking through the air.
Vị mới sinh đi trên đất bằng cách nào? Với sự giả định rằng vị Đại Nhân có uy lực như vậy chắc hẳn phải đi trên không, nên Ngài đã hiện ra như đang đi trên không.
Sīghataraṃ pana sattapadavītihārena gatattā dissamānarūpopi mahājanassa adissamāno viya ahosi.
However, having gone with seven steps very swiftly, even his visible form appeared as if invisible to the great multitude.
Tuy nhiên, vì Ngài đã đi rất nhanh, vượt qua bảy bước, nên dù thân hình có thể nhìn thấy, Ngài đã hiện ra như không thể nhìn thấy đối với đại chúng.
Acelakabhāvo khuddakasarīratā ca tādisassa iriyāpathassa ananucchavikāti kammānubhāvasañjanitapāṭihāriyavasena alaṅkārapaṭiyatto viya; soḷasavassuddesiko viya ca mahājanassa upaṭṭhāsīti veditabbaṃ; buddhabhāvānucchavikassa bodhisattānubhāvassa yāthāvato paveditattā buddhena viya…pe… attamanā ahosi.
Nudity and smallness of body are not appropriate for such a posture. Therefore, it should be understood that by the miracle generated by the power of kamma, he appeared as if adorned with ornaments; and as if sixteen years old to the great multitude. Because the true nature of the Bodhisatta’s power, suitable for Buddhahood, was made known, the multitude was delighted as if by the Buddha… etc.
Việc không mặc y phục và thân hình nhỏ bé không phù hợp với tư thế đi đứng như vậy, nên cần hiểu rằng Ngài đã hiện ra trước đại chúng như được trang hoàng lộng lẫy; và như một người mười sáu tuổi do phép lạ được tạo ra bởi sức mạnh của nghiệp; và vì uy lực thực sự của Bồ Tát, phù hợp với Phật quả, đã được tuyên bố, nên như Đức Phật… v.v… đã hoan hỷ.
Pākaṭā hutvāti vibhūtā hutvā.
“Pākaṭā hutvā” means having become clear.
Pākaṭā hutvā có nghĩa là đã trở nên rõ ràng.
Buddhānaṃ ye ye saṅkhāre vavatthapetukāmā, te te uppādakkhaṇepi sabbaso suppaṭividitā supākaṭā hatthatale āmalakaṃ viya suṭṭhu vibhūtā eva hutvā upaṭṭhahanti.
Whatever aggregates the Buddhas wish to determine, those aggregates, even at the moment of their arising, appear to them completely known, perfectly clear, as if an āmalaka fruit on the palm of the hand, having become perfectly distinct.
Đối với chư Phật, bất cứ hành động nào mà các Ngài muốn sắp đặt, chúng đều hiện ra trước các Ngài ngay cả vào khoảnh khắc phát sinh, hoàn toàn rõ ràng, hiển nhiên, như quả āmala trên lòng bàn tay.
Tenāha ‘‘yathā hī’’tiādi.
Therefore, he said, “Yathā hi…” (Just as…) etcetera.
Vì vậy, Ngài nói: “Yathā hī” (như vậy), v.v.
Anokāsagateti pariggahassa anokāsakāle pavatte.
“Anokāsagate” means occurring at a time when there is no opportunity for comprehension.
Anokāsagate có nghĩa là xảy ra vào thời điểm không có cơ hội để chiếm hữu.
Nippadeseti niravasese.
Nippadese means without remainder.
Nippadese nghĩa là không còn sót lại.
Okāsappatteti ṭhānagamanādikāle uppanne, te hi sammasanassa yogyakāle uppattiyā okāsappattāti adhippāyo.
Okāsappatte means arising at the time of going to a place, etc. The intention is that they are okāsappatta (having attained opportunity) by arising at a suitable time for contemplation.
Okāsappatte nghĩa là phát sinh vào thời điểm thích hợp như lúc đi đứng, v.v. Ý nghĩa là chúng phát sinh vào thời điểm thích hợp cho sự quán xét, do đó đạt được cơ hội.
Sattadivasabbhantareti idaṃ buddhānaṃ pākatikasammasanavasena vuttaṃ, ākaṅkhantā pana te yadā kadāci uppannasaṅkhāre sammasantiyeva.
Within seven days: this is stated in terms of the usual contemplation of the Buddhas. However, if they wish, they contemplate the arisen conditioned phenomena whenever it may be.
Sattadivasabbhantare điều này được nói theo cách quán xét thông thường của chư Phật. Nhưng khi mong muốn, các Ngài quán xét các hành đã phát sinh bất cứ lúc nào.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
209. Yathā ‘‘dvattiṃsā’’ti vattabbe dvi-saddassa bā-ādesaṃ katvā bāttiṃsāti vuccati, evaṃ ettha bā-kārādesaṃ katvā bākuloti samaññā ahosi, sāyaṃ tassa anvatthasaññāti dassetuṃ, ‘‘tassa hī’’tiādi vuttaṃ.
209. Just as when "dvattiṃsā" is to be said, by substituting bā for the word dvi, it becomes bāttiṃsā, so here, by substituting bā for the letter, the designation Bākula came to be. To show that this was his appropriate designation, it is said: "For him" and so on.
209. Cũng như khi nói ‘‘dvattiṃsā’’ (ba mươi hai), chữ dvi được thay thế bằng bā, trở thành bāttiṃsā, thì ở đây cũng vậy, chữ bā được thay thế, và tên gọi Bākula đã được đặt. Để chỉ ra rằng đây là một tên gọi có ý nghĩa, ‘‘tassa hī’’ và các từ tiếp theo đã được nói.
Sīsaṃ nhāpetvāti maṅgalatthaṃ mahāgaṅgāya sīsaṃ nhāpetvā.
Having bathed his head means having bathed his head in the great Ganges for an auspicious purpose.
Sīsaṃ nhāpetvā nghĩa là gội đầu ở sông Hằng lớn để cầu may mắn.
Nimujjanavasenāti jaṇṇupamāṇe udake thokaṃyeva nimujjanavasena.
By way of immersion means by way of immersing himself only slightly in water up to the knees.
Nimujjanavasena nghĩa là chỉ lặn một chút trong nước sâu đến đầu gối.
Chaḍḍetvā palātā maraṇabhayatajjitā.
Having discarded and fled means terrified by the fear of death.
Chaḍḍetvā palātā nghĩa là bỏ chạy vì sợ hãi cái chết.
Pahariyamānā maranti, na jālena bandhitamattena.
They die when struck, not merely by being caught in a net.
Pahariyamānā maranti, chúng chết khi bị đánh, không phải chỉ bị mắc lưới.
Dārakassa tejenāti dārakassa puññatejena.
By the power of the child means by the meritorious power of the child.
Dārakassa tejenā nghĩa là nhờ năng lực phước báu của đứa bé.
Nīhaṭamattova mato, tassa maraṇatthaṃ upakkamo na kato, yena upakkamena dārakassa bādho siyā.
As soon as it was pulled out, it died; no attempt was made for its death that would harm the child.
Nīhaṭamattova mato, nó chết ngay khi bị lấy ra, không có hành động nào được thực hiện để giết nó, hành động đó có thể gây hại cho đứa bé.
Tanti macchaṃ.
That means the fish.
Taṃ nghĩa là con cá.
Sakalamevāti paripuṇṇāvayavameva.
Sakalameva means having all its parts complete.
Sakalamevā nghĩa là toàn bộ, nguyên vẹn.
Na kelāyatīti na mamāyati kismiñci na maññati.
Na kelāyati means does not make anything mine, does not conceive anything.
Na kelāyatī nghĩa là không bám víu, không chấp thủ vào bất cứ điều gì.
Dārakassa puññatejena piṭṭhito phālentī.
By the power of the child's merit, splitting from the back.
Nhờ năng lực phước báu của đứa bé, con cá piṭṭhito phālentī (tự nứt ra ở lưng).
Dārakaṃ labhatīti ugghosanavasena bheriṃ carāpetvā.
Obtains a child means having caused a drum to be beaten by way of proclamation.
Dārakaṃ labhatī nghĩa là sau khi cho người đi đánh trống loan báo.
Pavattiṃ ācikkhi, attano puttabhāvaṃ kathesi.
Declared the news means told of his sonship.
Pavattiṃ ācikkhi, đã kể về việc mình là con trai.
Kucchiyā dhāritattā amātā kātuṃ na sakkā jananībhāvato.
Because she carried him in her womb, it is not possible to make her not a mother means because of her motherhood.
Kucchiyā dhāritattā amātā kātuṃ na sakkā vì là mẹ ruột, không thể không coi là mẹ.
Macchaṃ gaṇhantāpīti macchaṃ kiṇitvā gaṇhantāpi.
Even taking the fish means even taking the fish by buying it.
Macchaṃ gaṇhantāpī nghĩa là ngay cả khi mua cá.
Tathā gaṇhantā ca tappariyāpannaṃ sabbaṃ gaṇhāti nāmāti āha – ‘‘vakkayakanādīni bahi katvā gaṇhantā nāma natthī’’ti.
And taking it thus implies taking everything included therein, so he said: “There is no such thing as taking it by leaving out the entrails and so forth.”
Và khi nhận như vậy, người ta nhận tất cả những gì thuộc về nó, vì vậy ngài nói – ‘‘vakkayakanādīni bahi katvā gaṇhantā nāma natthī’’ (không có chuyện nhận cá mà bỏ ruột gan, v.v. ra ngoài).
Ayampi amātā kātuṃ na sakkā sāmikabhāvato.
It is not possible to make this one not a mother means because of his state as husband.
Ayampi amātā kātuṃ na sakkā vì là chủ, không thể không coi là mẹ.
Dārako ubhinnampi kulānaṃ dāyādo hotu dvinnaṃ puttabhāvato.
Let the child be an heir to both families means because of his sonship to both.
Dārako ubhinnampi kulānaṃ dāyādo hotu vì là con của cả hai gia đình.
Asītimeti jātiyā asītime vasse.
In the eightieth means in the eightieth year of his birth.
Asītime nghĩa là vào năm thứ tám mươi của cuộc đời.
Pabbajjāmattena kilesānaṃ asamucchijjanato vītikkamituṃ kāmasaññā uppannapubbāti pucchā pana pucchitabbā.
The question, however, should be asked: "Since defilements are not eradicated merely by ordination, has a sensual perception arisen previously, transgressing the precepts?"
Câu hỏi cần được hỏi là: Vì các phiền não chưa được nhổ tận gốc chỉ bằng việc xuất gia, liệu đã từng có sự phát sinh dục tưởng để vi phạm giới luật chưa?
Tenāha – ‘‘evañca kho maṃ, āvuso kassapa, pucchitabba’’nti.
Therefore, he said: "Thus, friend Kassapa, should I be questioned."
Do đó ngài nói: ‘‘Này hiền giả Kassapa, ta nên được hỏi như vậy’’.
210. Niyametvāti taṃ taṃvāre sesavārena niyametvā.
210. Having restricted means having restricted that particular turn with the remaining turns.
210. Niyametvā nghĩa là giới hạn từng lần bằng cách loại trừ các lần khác.
Kammapathabhedakoti kammapathavisesakaro.
Breaking the path of action means creating a distinction in the path of action.
Kammapathabhedako nghĩa là tác nhân gây ra sự khác biệt trong nghiệp đạo.
Tattha kāmavitakko yathā kāyavacīdvāresu copanappatto kammapathappatto nāma hoti; manodvāre parabhaṇḍassa attano pariṇāmanavasena pavattaabhijjhāsahagato; evaṃ kāmasaññāti, tathā byāpādavihiṃsāvitakkasaññāti thero, ‘‘ubhayampetaṃ kammapathabhedakamevā’’ti āha.
Here, just as a thought of sensual desire, when it reaches the doors of body and speech, is said to have reached the path of action; and in the mind-door, when it arises accompanied by covetousness, by way of appropriating another's property as one's own; so too with sensual perception, and similarly with thoughts and perceptions of ill-will and harmfulness—the Elder said, "Both of these are indeed breakers of the path of action."
Ở đây, dục tầm, cũng như khi nó được đưa vào cửa thân và khẩu, trở thành nghiệp đạo; khi nó đi kèm với tham lam phát sinh trong ý môn bằng cách biến tài sản của người khác thành của mình; tương tự như vậy là dục tưởng, và cũng vậy là sân tầm và hại tầm, nên vị Trưởng lão nói: ‘‘Cả hai điều này đều là tác nhân gây ra sự khác biệt trong nghiệp đạo’’.
Kammapathaṃ appattaṃ saññaṃ sandhāya, ‘‘saññā uppannamattāvā’’ti vuccamāne vitakkitampi samānaṃ kammapathaṃ appattameva, ubhayassa pana vasena suttapadaṃ pavattanti therassa adhippāyo.
Referring to a perception that has not reached the path of action, when it is said, "or merely a perception has arisen," it means that even if it is thought, it has not reached the path of action. However, the Elder's intention is that the Sutta passage proceeds by way of both.
Liên quan đến tưởng chưa đạt đến nghiệp đạo, khi nói ‘‘chỉ cần tưởng phát sinh’’, thì ngay cả khi đã tư duy, nó vẫn chưa đạt đến nghiệp đạo. Tuy nhiên, ý của vị Trưởng lão là lời kinh được nói dựa trên cả hai khía cạnh.
211. Āyūhanakammanti attanā āyūhitabbakammaṃ.
211. Accumulating action means action to be accumulated by oneself.
211. Āyūhanakamma nghĩa là nghiệp cần được tự mình nỗ lực.
Lomakiliṭṭhānīti kiliṭṭhalomāni, kiliṭṭhaṃsūnīti attho.
Dirty hair means dirty hair, meaning dirty shoulders.
Lomakiliṭṭhānī nghĩa là lông bẩn, tức là những bộ phận bẩn thỉu.
Kimevaṃ bhogesu paranimmitabhave vasavattidevānaṃ viya sabbaso āyūhanakammena vinā aññassapi pabbajitassa paccayalābho diṭṭhapubbo sutapubboti āha ‘‘anacchariyañceta’’nti.
Has it ever been seen or heard that a recluse, other than those like the devas who control others' creations in enjoyments, obtains requisites entirely without accumulating action? He said: "This is not surprising."
Liệu đã từng thấy hay nghe nói về việc một người xuất gia khác nhận được vật dụng mà không cần bất kỳ nỗ lực nào trong việc hưởng thụ tài sản, giống như các vị devā có quyền năng đối với những gì người khác tạo ra? Do đó ngài nói ‘‘anacchariyañceta’’ (điều này không có gì lạ).
Kulūpakatherānametaṃ kammaṃ, thero pana kadācipi kulūpako nāhosi.
This action belongs to the Kulūpaka Elders, but the Elder himself was never a Kulūpaka.
Đây là nghiệp của các vị Trưởng lão Kulūpaka, nhưng vị Trưởng lão (Bākula) chưa bao giờ là Kulūpaka.
Nikkhamatīti nikkhamo, avaggāhakāmato nikkhamanaṃ nikkhamo eva nekkhammo, paṭhamajjhānādi.
It goes forth, thus going forth; the going forth from grasping sensual desires is indeed renunciation, which is the first jhāna and so forth.
Nikkhamati (thoát ra) là nikkhamo (sự thoát ra), sự thoát ra khỏi dục vọng chấp thủ là nikkhamo, tức là nekkhammo (sự xuất ly), là sơ thiền, v.v.
Sati kilesakāme attano upahāraṃ upacāretvā assādetvā paribhuñjati nāmāti āha – ‘‘duvidhepi kāme paribhuñjamāno’’ti.
When sensual desires, which are defilements, exist, one makes an offering of oneself to them, enjoys them, and consumes them. So he said: "enjoying both kinds of sensual desires."
Khi có phiền não dục, người ta sẽ tự dâng hiến, hưởng thụ và tiêu dùng, do đó ngài nói – ‘‘duvidhepi kāme paribhuñjamāno’’ (khi hưởng thụ cả hai loại dục).
Duvidhepīti hīnapaṇītādivasena duvidhe.
Both kinds means two kinds based on their inferiority and superiority, etc.
Duvidhepī nghĩa là hai loại, theo cách thấp kém và cao thượng, v.v.
217. Gahetuṃ samatthoti gaṇikārahatthinīhi upalāpetvā araññahatthiṃ vacanavasena gahetuṃ samattho.
217. "Gahetuṃ samattho" means capable of taking a wild elephant by means of words, having enticed it with female elephants used for taming.
217. Gahetuṃ samattho nghĩa là có khả năng bắt được voi rừng bằng lời nói, sau khi dụ dỗ chúng bằng voi cái đã được thuần hóa.
Atipassitvā atiṭṭhānavasena passitvā.
Atipassitvā means having seen by way of not remaining.
Atipassitvā nghĩa là nhìn thấy một cách không thích hợp.
Etthagedhāti etasmiṃ araññe nāgavane pavattagedhā.
Etthagedhā means the craving that arises in that forest, the elephant forest.
Etthagedhā nghĩa là sự tham luyến phát sinh trong khu rừng voi này.
Sukhāyatīti sukhaṃ ayati pavatteti, ‘‘sukhaṃ haratī’’ti vā pāṭho.
Sukhāyatī means it brings forth happiness, or the reading is "it carries happiness."
Sukhāyatī nghĩa là mang lại hạnh phúc, hoặc một cách đọc khác là ‘‘mang đến hạnh phúc’’.
Ḍiṇḍimo ānako.
Ḍiṇḍimo means a drum.
Ḍiṇḍimo là cái trống.
Nihitasabbavaṅkadosoti apagatasabbasāṭheyyadoso.
Nihitasabbavaṅkadoso means having removed all faults of deceit.
Nihitasabbavaṅkadoso nghĩa là đã loại bỏ tất cả các lỗi lầm lừa dối.
Apanītakasāvoti apetasārambhakasāvo.
Apanītakasāvo means having removed the defilement of agitation.
Apanītakasāvo nghĩa là đã loại bỏ sự thô tháo, bẩn thỉu.
223. Āsañcepi karitvāti, ‘‘imināhaṃ brahmacariyena devo vā bhaveyyaṃ devaññataro vā, dukkhato vā mucceyya’’nti patthanaṃ katvā cepi caranti, abhabbā phalassa adhigamāya taṇhāya brahmacariyassa vidūsitattāti adhippāyo.
223. By even having formed a wish, for instance, "By this holy life, may I become a deva or one of the devas, or may I be freed from suffering"—even if they practice having made such a wish— they are incapable of attaining the fruit. The meaning is that the holy life is corrupted by craving.
223. Ngay cả khi đã tạo ra hy vọng, tức là, ngay cả khi họ thực hành phạm hạnh với ước nguyện rằng: “Nhờ phạm hạnh này, ta sẽ trở thành một vị trời hoặc một vị nào đó trong số chư thiên, hoặc ta sẽ thoát khỏi khổ đau”, thì họ không thể đạt được quả. Ý nghĩa là phạm hạnh đã bị ô nhiễm bởi tham ái.
Anāsañcepi karitvāti vuttanayena patthanaṃ akatvā.
Even having formed no wish means not having made a wish, in the manner stated.
Ngay cả khi không tạo ra hy vọng, tức là không tạo ra ước nguyện theo cách đã nói.
Abhabbā phalassa adhigamāya aniyamitabhāvato.
They are incapable of attaining the fruit due to its unregulated nature.
Không thể đạt được quả vì không được quy định.
Paṇidhānavasena hi puññaphalaṃ niyataṃ nāma hoti, tadabhāvato kataṃ puññaṃ na labhatīti adhippāyo.
Indeed, by way of aspiration, the fruit of merit becomes fixed. The meaning is that without it, the merit performed does not yield its fruit.
Quả phước thiện trở nên nhất định nhờ sự phát nguyện; ý nghĩa là, do không có điều đó, phước thiện đã làm sẽ không được thọ hưởng.
Tatiyapakkhe ubhayaṭṭhānehi vuttaṃ, catutthapakkho sammāvatāro iti catukoṭiko pañho jālavasena āhaṭo, tattha āsā nāma patthanā, micchāgāhasmiṃ sati na vipaccati, sammāgāhasmiṃ sati vipaccati, ubhayathāpi ubhayāpekkhānāma, yo micchattadhamme purakkhatvā brahmacariyaṃ carati, tassa yathādhippāyaphalaṃ samijjhatīti na vattabbaṃ ayoniso brahmacariyassa ciṇṇattā; yo pana sammattaṃ purakkhatvā brahmacariyaṃ carati, tassa yathādhippāyaṃ brahmacariyaphalaṃ na samijjhatīti na vattabbaṃ yoniso brahmacariyassa ciṇṇattā.
In the third case, it is stated from both standpoints. The fourth case is the correct entry. Thus, the tetralemma is presented as a net. Here, 'āsā' means 'wish'. When there is wrong apprehension, it does not ripen. When there is right apprehension, it ripens. In both ways, both are interdependent. It should not be said that for one who practices the holy life, giving prominence to wrong views, the fruit according to their intention is accomplished, because the holy life is practiced improperly. It should not be said that for one who practices the holy life, giving prominence to right views, the fruit of the holy life according to their intention is not accomplished, because the holy life is practiced properly.
Trong trường hợp thứ ba, điều đó được nói từ cả hai khía cạnh; trường hợp thứ tư là sự thâm nhập đúng đắn. Như vậy, vấn đề bốn khía cạnh được đưa ra theo cách của một cái lưới. Trong đó, āsā có nghĩa là ước nguyện. Khi có sự chấp thủ sai lầm, nó không thành thục; khi có sự chấp thủ đúng đắn, nó thành thục. Trong cả hai trường hợp, nó đều phụ thuộc vào cả hai. Không thể nói rằng người thực hành phạm hạnh với sự ưu tiên các pháp tà kiến sẽ đạt được quả theo ý muốn, vì phạm hạnh đã được thực hành một cách không đúng đắn; nhưng không thể nói rằng người thực hành phạm hạnh với sự ưu tiên chánh kiến sẽ không đạt được quả phạm hạnh theo ý muốn, vì phạm hạnh đã được thực hành một cách đúng đắn.
Tena vuttaṃ – ‘‘āsañcepi karitvā ayoniso brahmacariyaṃ carantī’’tiādi.
Therefore, it is said: "Even having formed a wish, they practice the holy life improperly," and so on.
Vì thế, đã nói: “ngay cả khi tạo ra hy vọng, thực hành phạm hạnh một cách không đúng đắn” v.v.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
230. Upasaṅkamitvā evamāhaṃsūti vuttaṃ upasaṅkamanakāraṇaṃ dassento, ‘‘tassa upāsakassa aphāsukakālo ahosī’’ti āha.
230. To show the reason for the approach mentioned in "Having approached, they spoke thus," it is said, "That lay follower was unwell."
230. Để chỉ ra lý do của việc “đến và nói như vậy” đã được đề cập, Ngài nói: “vị cư sĩ ấy đang trong thời kỳ bệnh tật”.
Avirādhitanti avirajjhanakaṃ.
Unaltered means unwavering.
Không sai lạc: không bị sai lạc.
Yadi vā te dhammā nānatthā, yadi vā ekatthā, yaṃ tattha avirajjhanakaṃ, taṃ taṃyeva paṭibhātūti yojanā.
Or, whether those Dhammas have different meanings or the same meaning, whatever among them is unwavering, may that very thing occur to them—thus is the connection made.
Hoặc nếu những pháp đó có nghĩa khác nhau, hoặc nếu chúng có cùng nghĩa, thì điều gì không sai lạc ở đó, hãy để điều đó hiện rõ. Đó là cách kết nối.
Jhānamevāti appamāṇajjhānameva, ‘‘cetovimuttī’’ti pana vuttattā cittekaggatāyeva evaṃ vuccatīti upāsakassa adhippāyo.
Only jhāna means only immeasurable jhāna. However, since it is stated as "release of mind," the lay follower's intention is that concentration of mind is spoken of in this way.
Chỉ là thiền định có nghĩa là chỉ là thiền định vô lượng. Nhưng vì đã nói là “tâm giải thoát”, nên vị cư sĩ có ý rằng chỉ là sự nhất tâm được gọi như vậy.
231. Yāvatā majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā ‘‘rukkhamūla’’nti vuccatīti evaṃ vuttaṃ ekarukkhamūlappamāṇaṭṭhānaṃ.
231. The place the size of one tree root is said to be as far as the shadow reaches at midday, and leaves fall in a windless spot.
231. Một nơi có kích thước bằng gốc cây được nói như vậy, tức là nơi mà bóng cây che phủ vào buổi trưa, nơi lá rơi không có gió.
Kasiṇanimittena ottharitvā ti kasiṇārammaṇaṃ jhānaṃ samāpajjanto tasmiṃ kasiṇa…pe… viharatīti vutto.
Having pervaded with a kasiṇa sign means practicing jhāna with a kasiṇa as the object, he is said to dwell in that kasiṇa...
Che phủ bằng tướng kasiṇa, tức là người nhập thiền với đối tượng kasiṇa, được nói là ở trong kasiṇa đó... v.v....
Ābhogo natthi jhānakkhaṇe.
There is no advertence at the moment of jhāna.
Không có sự chú ý vào khoảnh khắc thiền định.
Kāmaṃ samāpattikkhaṇe ābhogo natthi tato pana pubbe vā siyā so ābhogo, tampi sandhāya mahaggatanti keci.
Even though there is no advertence at the moment of attainment, such advertence might exist before that. Some say that this also refers to the exalted state.
Mặc dù không có sự chú ý vào khoảnh khắc nhập định, nhưng có thể có sự chú ý đó trước đó; một số người cũng đề cập đến điều đó khi nói về sự rộng lớn.
Idāni tāsaṃ cetovimuttīnaṃ satipi kenaci visesena abhede visayādito labbhamānabhedaṃ dassetuṃ, ‘‘etthā’’tiādi vuttaṃ.
Now, to show the difference obtained from the object and so on, even if these releases of mind are not different in any specific way, "here," and so on, is stated.
Bây giờ, để chỉ ra sự khác biệt có được từ đối tượng v.v. mặc dù không có sự khác biệt nào đó giữa các tâm giải thoát đó, đã nói: “ở đây” v.v.
Nimittaṃ na vaḍḍhati vaḍḍhetabbassa nimittasseva abhāvato.
The sign does not grow because there is no sign to be grown.
Tướng không tăng trưởng vì không có tướng cần tăng trưởng.
Pathavīkasiṇādīnaṃ viya ākāsabhāvanāya ugghāṭanaṃ na jāyati.
Unlike earth kasiṇa and the like, the opening does not arise in the development of space.
Sự khai mở không phát sinh đối với sự tu tập không gian như đối với địa kasiṇa v.v.
Tāni jhānānīti brahmavihārajjhānāni.
Those jhānas are the Brahmavihāra jhānas.
Những thiền định đó là các thiền vô lượng tâm.
Cuddasavidhena paridamanābhāvato abhiññānaṃ pādakāni na honti.
Because there is no mastery in fourteen ways, they are not a basis for supernormal powers.
Do không có sự thuần thục theo mười bốn cách, chúng không phải là nền tảng cho các thắng trí.
Nimittugghāṭasseva abhāvato arūpajjhānānaṃ anadhiṭṭhānatāya nirodhassa pādakāni na hontīti.
Because there is no opening of the sign, and because the formless jhānas are not established, they are not a basis for cessation.
Do không có sự khai mở tướng, và do các thiền vô sắc không được an trú, chúng không phải là nền tảng cho sự diệt tận.
Kammavaṭṭabhāvena kilesavaṭṭavipākavaṭṭānaṃ tiṇṇaṃ vaṭṭānaṃ paccayabhāvo vaṭṭapādakatā.
Being a basis for the rounds is the condition for the three rounds: the round of kamma, the round of defilements, and the round of results, by way of the round of kamma.
Vaṭṭapādakatā là trạng thái là nhân duyên cho ba luân hồi: luân hồi nghiệp, luân hồi phiền não và luân hồi quả, theo khía cạnh luân hồi nghiệp.
Upapajjanavaseneva taṃ taṃ bhavaṃ okkamati etehīti bhavokkamanāni.
They enter into various existences solely through rebirth, hence they are entrances into existence.
Bhavokkamanāni là những thứ mà nhờ đó người ta đi vào các cõi tái sinh khác nhau theo cách tái sinh.
Dutiyanayassa vuttavipariyāyena attho veditabbo.
The meaning of the second method should be understood in the opposite way of what has been stated.
Nghĩa của phương pháp thứ hai nên được hiểu theo cách ngược lại với điều đã nói.
Ugghāṭanassa labbhanato arūpajjhānopari samatikkamo hotīti ayameva viseso.
Since the opening is obtainable, there is transcendence over the formless jhānas. This is the only distinction.
Do có được sự khai mở, nên có sự vượt qua các thiền vô sắc. Đây chính là sự khác biệt.
Evanti yathāvuttena nimittāvaḍḍhananimittavaḍḍhanādippakārena.
Thus means in the manner stated, such as not growing the sign and growing the sign.
Như vậy: theo cách đã nói về việc không tăng trưởng tướng, tăng trưởng tướng v.v.
Nānatthāti nānāsabhāvā.
Having different meanings means having different natures.
Nhiều nghĩa: nhiều tự tánh.
Evanti appamāṇamahaggatasaddavacanīyatāya nānābyañjanā.
Thus, due to being expressible by the words "immeasurable" and "exalted," they have different expressions.
Như vậy: do được gọi là vô lượng và rộng lớn, nên nhiều từ ngữ khác nhau.
Kāmañcettha appamāṇasamāpattitopi nīharitvā vakkhamānabhavūpapattikāraṇaṃ dassetuṃ sakkā, aṭṭhakathāyaṃ pana kasiṇajhānatova nīharitvā yojanā katāti tathā vuttaṃ.
Although it is possible to extract and show the cause of rebirth that will be spoken of here, even from the immeasurable attainments, the commentary explains it by extracting it only from the kasiṇa jhāna, and thus it is stated in that way.
Mặc dù ở đây có thể rút ra nguyên nhân tái sinh vào các cõi sẽ được nói đến từ sự nhập định vô lượng, nhưng trong chú giải, sự kết nối được thực hiện bằng cách rút ra từ thiền kasiṇa, nên đã nói như vậy.
Atha vā mahaggatagahaṇenettha appamāṇāti vuttabrahmavihārānampi saṅgaho veditabbo tassā samaññāya ubhayesampi sādhāraṇabhāvato.
Alternatively, by the inclusion of "exalted," the Brahmavihāras referred to as "immeasurable" should also be understood as included here, as that designation is common to both.
Hoặc, bằng cách chấp nhận sự rộng lớn ở đây, nên hiểu rằng các thiền vô lượng tâm đã được đề cập cũng được bao gồm, vì tên gọi đó là chung cho cả hai.
232. Evaṃ vuttoti asatipi tathārūpe ābhoge ‘‘parittābhāti pharitvā adhimuccitvā viharatī’’ti vutto.
232. Thus spoken means, even without such advertence, it is said, "Having pervaded and resolved upon a small scope, he dwells."
232. Được nói như vậy: được nói là “trú trong sự bao trùm và an trú với sự chú ý nhỏ bé” mặc dù không có sự chú ý như vậy.
Appamāṇaṃ katvā kasiṇaṃ vaḍḍhentassa kasiṇavaḍḍhanavasena bahulīkārasambhavato siyā jhānassa balavataratā, tadabhāve ca dubbalatā, āciṇṇavasitāya pana paccanīkadhammānaṃ sammā aparisodhane vattabbameva natthīti pañcahākārehi jhānassa appaguṇataṃ dassento, ‘‘suppamatte vā’’tiādimāha.
For one who develops the kasiṇa to be immeasurable, the jhāna might become stronger due to the possibility of frequent practice through the expansion of the kasiṇa. In the absence of that, it might be weaker. But regarding the non-purification of opposing factors through habitual mastery, there is nothing to be said. Thus, to show the jhāna's lack of quality in five ways, he says, "when completely drowsy," and so on.
Khi một người tăng trưởng kasiṇa bằng cách làm cho nó vô lượng, có thể có sự mạnh mẽ hơn của thiền định do sự tăng trưởng kasiṇa, và khi không có điều đó, thiền định sẽ yếu hơn. Nhưng khi chưa thanh lọc hoàn toàn các pháp đối nghịch thông qua sự thuần thục đã được thực hành, thì không cần phải nói gì nữa. Để chỉ ra sự kém chất lượng của thiền định theo năm cách, Ngài nói: “hoặc trong sự ngủ say” v.v.
Jhānassa appānubhāvatāya eva tannimittā pabhāpi appatarā aparisuddhāva hotīti āha – ‘‘vaṇṇo…pe… saṃkiliṭṭho cā’’ti.
He says, "its color... impure" and so on, because due to the jhāna's weak power, its light, which is its sign, is also weaker and impure.
Do thiền định có ít năng lực, nên ánh sáng phát ra từ nó cũng yếu hơn và không trong sạch. Ngài nói: “màu sắc... v.v... cũng bị ô nhiễm”.
Dutiyanayo vuttavipariyāyena veditabbo.
The second method should be understood as the opposite of what has been stated.
Phương pháp thứ hai nên được hiểu theo cách ngược lại với điều đã nói.
Tatthāpi kasiṇassa parittabhāvena vaṇṇassa parittatā, parittārammaṇāya anurūpatāya vā nimittaṃ pabhāmaṇḍalakampi parittameva siyāti adhippāyo.
Even there, the meaning is that the color is small due to the kasiṇa's smallness, or the light-mandala, which is the sign, might be small, corresponding to the small object.
Ở đó, màu sắc yếu ớt do kasiṇa nhỏ bé, hoặc do phù hợp với đối tượng nhỏ bé, vòng ánh sáng cũng có thể nhỏ bé. Đó là ý nghĩa.
Vipulaparikammanti vipulabhāvena parikammaṃ.
Extensive preparation means preparation by way of extensiveness.
Sự chuẩn bị rộng lớn: sự chuẩn bị theo cách rộng lớn.
Sesaṃ tatiyacatutthanayesu vattabbaṃ paṭhamadutiyanayesu vuttasadisameva.
The rest that is to be stated in the third and fourth methods is similar to what is stated in the first and second methods.
Phần còn lại cần được nói trong phương pháp thứ ba và thứ tư cũng giống như điều đã nói trong phương pháp thứ nhất và thứ hai.
Vaṇṇanānattanti yadi pītaṃ yadi lohitaṃ yadi vā odātanti sarīravaṇṇanānattaṃ.
Difference in complexion means difference in bodily complexion, whether yellow, red, or white.
Sự khác biệt về màu sắc: sự khác biệt về màu sắc cơ thể, dù là vàng, đỏ hay trắng.
Ābhānānattanti parittavipulatāvasena pabhāya nānattaṃ.
Difference in radiance means difference in light according to smallness or extensiveness.
Sự khác biệt về ánh sáng: sự khác biệt về ánh sáng theo cách nhỏ bé và rộng lớn.
Accinānattanti tejodhātussa dīghādivasena vemattatā.
Difference in flame means variation in the fire element by way of length and so on.
Sự khác biệt về tia sáng: sự khác biệt của yếu tố lửa theo cách dài v.v.
Abhinivisantīti abhirativasena nivisanti nisīdanti tiṭṭhanti.
They abide means they settle, sit, or stand by way of attachment.
An trú: an trú, ngồi, đứng với sự hoan hỷ.
Tenāha ‘‘vasantī’’ti.
Therefore, it is said "they dwell."
Vì thế, Ngài nói “sống”.
234. Ābhanti dibbantīti ābhāti āha ‘‘ābhāsampannā’’ti.
234. They shine, they gleam, hence radiance. Thus, it is said "endowed with radiance."
234. Chúng chiếu sáng, chúng rực rỡ, nên ánh sáng. Ngài nói “đầy đủ ánh sáng”.
Tadaṅgenāti vā tassā parittatāya appamāṇatāya ca ābhākāraṇaṃ, taṃ pana atthato bhavūpapattikāraṇamevāti āha – ‘‘tassā bhavūpapattiyā aṅgenā’’ti.
By that factor or by its smallness and immeasurability, it is a cause of radiance. That, however, is essentially a cause of rebirth. Thus, it is said "by a factor of that rebirth."
Với yếu tố đó, hoặc nguyên nhân của ánh sáng là sự nhỏ bé và vô lượng của nó, nhưng điều đó thực chất là nguyên nhân của sự tái sinh vào cõi hữu. Ngài nói: “với yếu tố của sự tái sinh đó”.
Kāyālasiyabhāvo tandīādīnaṃ hetubhūtā kāyassa vitthāyitatā.
Physical sluggishness is the body's weariness, which is the cause of sloth and so on.
Trạng thái lười biếng của thân: sự uể oải của thân là nguyên nhân của sự uể oải v.v.
235. Pāramiyoti mahāsāvakasaṃvattanikā sāvakapāramiyo pūrento.
235. Perfections means fulfilling the perfections of a disciple, which lead to becoming a great disciple.
235. Các ba-la-mật: hoàn thành các ba-la-mật của đệ tử lớn, dẫn đến sự thành tựu của một đệ tử lớn.
Brahmaloketi brahmattabhāve, brahmaloke vā uppattiṃ paṭilabhi, vuttampi cetaṃ theragāthāsu.
In the Brahma-world means in the state of a Brahmā, or he attained birth in the Brahma-world. This is also stated in the Theragāthā.
Trong cõi Phạm thiên: trong trạng thái Phạm thiên, hoặc đạt được sự tái sinh trong cõi Phạm thiên. Điều này cũng đã được nói trong các bài kệ của các Trưởng lão.
Avokiṇṇanti aññehi asammissanti attho.
Unmixed means not mixed with others.
Không bị pha trộn: có nghĩa là không bị pha trộn với những cái khác.
Pubbe sañcaritanti atītabhavesu jātivasena sañcaraṇaṃ mama, sañcaritanti taṃ mamassāti attho.
Traversed before means my traversing in previous existences by way of birth. The meaning is that that traversing was mine.
Đã từng đi qua trước đây: sự đi lại của tôi dưới dạng sinh trong các kiếp quá khứ; nghĩa là, đó là sự đi lại của tôi.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
Yenapi janena na diṭṭhoti yena ubhayajanena aññavihitatāya kuḍḍakavāṭādiantarikatāya vā na diṭṭho.
"By whichever person it was not seen" means it was not seen by either group of people due to their preoccupation or because it was obstructed by walls, doors, etc.
Yenapi janena na diṭṭho (do người nào không thấy) là do cả hai loại người, vì bận tâm đến việc khác hoặc vì bị tường, cửa sổ, v.v. che khuất nên không thấy.
Damanatthanti tehi upāsakehi nimmadabhāvaṃ āpāditānaṃ tesaṃ bhikkhūnaṃ damanatthaṃ.
"For their taming" means for the taming of those bhikkhus who had been brought to a state of humility by those lay followers.
Damanatthaṃ (để chế ngự) là để chế ngự những vị tỳ khưu đó, những người đã được các cư sĩ đó đưa đến trạng thái không còn kiêu mạn.
Ṭhapayiṃsūti yo imesaṃ bhikkhūnaṃ deti, tassa sataṃ daṇḍoti, sahassanti ca vadanti.
"They imposed" means "Whoever gives to these bhikkhus, a hundred (coins) is his fine," or "a thousand," they say.
Ṭhapayiṃsu (họ đã đặt ra) là họ nói rằng: "Ai cúng dường cho những vị tỳ khưu này, người đó sẽ bị phạt một trăm (đồng), hoặc một ngàn (đồng)."
237. Vaggabhāveneva (sārattha. ṭī. mahāvaggo 3.464) nānāsaddo assāti puthusaddo.
Because of the group, there was a diverse sound, hence "a diverse sound."
237. Vì là một phe phái (Sārattha. ṭī. Mahāvaggo 3.464) nên có nhiều tiếng nói, đó là puthusaddo (tiếng ồn ào).
Samajanoti bhaṇḍane samajjhāsayo jano.
"A partisan" means a person whose intention is to quarrel.
Samajano (người đồng hội) là người có cùng ý định trong cuộc tranh cãi.
Bālalakkhaṇe ṭhitopi ‘‘ahaṃ bālo’’ti na maññati.
Even though he is characterized by foolishness, he does not think, "I am a fool."
Dù ở trong đặc tính của kẻ ngu, người ấy cũng không nghĩ: "Tôi là kẻ ngu."
Bhiyyo cāti attano bālabhāvassa ajānanatopi bhiyyo ca bhaṇḍanassa upari phoṭo viya saṅghabhedassa attano kāraṇabhāvampi uppajjamānaṃ na maññi naññāsi.
Moreover, not knowing his own foolishness, and as if it were a burst on top of the quarrel, he did not understand that he himself was the cause of the schism in the Saṅgha, even as it arose.
Và hơn thế nữa, vì không biết sự ngu dốt của mình, và hơn thế nữa, như một vết sưng trên cuộc tranh cãi, người ấy cũng không nghĩ, không biết rằng mình là nguyên nhân của sự chia rẽ Tăng đoàn đang phát sinh.
Kalahavasena pavattavācāyeva gocaro etesanti vācāgocarā hutvā.
"Being objects of speech" refers to words uttered through quarreling.
Là vācāgocarā (thuộc phạm vi lời nói), tức là lời nói phát sinh do tranh cãi là đối tượng của họ.
Mukhāyāmanti vivādavasena mukhaṃ āyametvā bhāṇino.
"With mouths extended" means speaking with mouths extended due to dispute.
Mukhāyāmaṃ (miệng kéo dài) là những người nói năng bằng cách kéo dài miệng do tranh cãi.
Na taṃ jānantīti taṃ kalahaṃ na jānanti.
"They do not know it" means they do not know that quarrel.
Na taṃ jānantī (họ không biết điều đó) là họ không biết cuộc tranh cãi đó.
Kalahaṃ karonto ca taṃ na jānanto nāma natthi.
There is no one who quarrels and does not know it.
Không có ai gây tranh cãi mà lại không biết điều đó.
Yathā pana na jānanti, taṃ dassetuṃ āha – ‘‘evaṃ sādīnavo aya’’nti.
To show how they do not know, it is said: "such is the disadvantage of this."
Để chỉ ra rằng họ không biết như thế nào, Ngài nói: "Evaṃ sādīnavo ayaṃ" (điều này có nhiều tai hại như vậy).
Ayaṃ kalaho nāma attano paresañca atthajāpanato anatthuppādanato diṭṭheva dhamme samparāye ca sādīnavo, sadosoti attho.
This quarrel, by destroying the welfare of oneself and others and producing harm in both this very life and the next, is "disadvantageous," meaning it is faulty.
Cuộc tranh cãi này, vì làm hại lợi ích của mình và của người khác, vì tạo ra điều bất lợi, nên trong hiện tại và đời sau, nó sādīnavo (có nhiều tai hại), tức là có nhiều lỗi lầm.
Mātaṅgo araññe mātaṅgaraññeti saralopena sandhi.
"In the elephant's forest," refers to mātaṅgaraññe, a sandhi by elision of a vowel.
Mātaṅgo trong rừng là mātaṅgaraññe, đây là sự hợp âm bằng cách lược bỏ một âm tiết.
Mātaṅgasaddeneva hatthibhāvassa vuttattā nāgavacanaṃ tassa mahattavibhāvanatthanti āha – ‘‘nāgoti mahantādhivacanameta’’nti.
Since the state of being an elephant is already expressed by the word mātaṅga, the word nāga is used to indicate its greatness, thus it is said: "nāga is a term for greatness."
Vì từ Mātaṅga đã nói lên ý nghĩa voi, nên từ Nāga là để chỉ sự vĩ đại của nó, nên Ngài nói: "Nāgoti mahantādhivacanametaṃ" (Nāga là một từ chỉ sự vĩ đại này).
Mahantapariyāyopi hi nāga-saddo hoti ‘‘evaṃ nāgassa nāgena, īsādantassa hatthino’’tiādīsu (udā. 25; mahāva. 467).
Indeed, the word nāga is also a synonym for great, as in "Thus, an elephant to an elephant, to an elephant with tusks like a plough-pole" and so on.
Thật vậy, từ nāga cũng là một từ đồng nghĩa với vĩ đại trong các câu như "evaṃ nāgassa nāgena, īsādantassa hatthino" (Udā. 25; Mahāva. 467).
238. Kirasaddo anussavasūcanattho nipāto.
"Kira" is an indeclinable particle indicating hearsay.
238. Từ kira là một tiểu từ chỉ sự nghe truyền lại.
Tena ayamettha sutiparamparāti dasseti.
Thereby it shows that this is a tradition based on hearing.
Với điều đó, Ngài chỉ ra rằng đây là một truyền thống được nghe ở đây.
Bhagavatā hi so ādīnavo pageva pariññāto, na tena satthā nibbiṇṇo hoti; tasmiṃ pana antovasse keci buddhaveneyyā nāhesuṃ; tena aññattha gamanaṃ tesaṃ bhikkhūnaṃ damanupāyoti pālileyyakaṃ uddissa gacchanto ekavihāriṃ āyasmantaṃ bhaguṃ, samaggavāsaṃ vasante ca anuruddhattherādike sampahaṃsetuṃ anuruddhattherassa ca.
Indeed, that disadvantage was already fully known by the Fortunate One, nor was the Teacher disillusioned by it; but during that rainy season, some were not amenable to the Buddha's discipline; therefore, going elsewhere was a means of disciplining those bhikkhus; and so, going to Pālileyya, he intended to gladden the solitary Venerable Bhagu, and the Venerable Anuruddha and others who were living in harmony, and the Venerable Anuruddha.
Thật vậy, Đức Thế Tôn đã nhận biết tai hại đó từ trước, Ngài không chán nản vì điều đó; nhưng trong mùa an cư đó, một số người không phải là những người có thể được Phật giáo hóa; do đó, việc đi đến nơi khác là một phương tiện để chế ngự những vị tỳ khưu đó, và để khích lệ Tôn giả Bhagu, người sống độc cư khi Ngài đi đến Pārileyyaka, và các Trưởng lão Anuruddha, v.v. đang sống hòa hợp, và cũng để khích lệ Trưởng lão Anuruddha.
Imaṃ upakkilesovādaṃ dātuṃ tattha gato, tasmā kalahakārake kirassāti etthāpi kirasaddaggahaṇe eseva nayo.
He went there to give this instruction on defilements, therefore the same principle applies to the use of the word "kira" in "in the quarrel-makers, it is said."
Ngài đã đến đó để ban lời khuyên về sự ô nhiễm này, do đó, trong câu kalahakārake kirassā (đối với những kẻ gây tranh cãi, nghe nói), cũng có ý nghĩa tương tự khi dùng từ kira.
Vuttanayameva gosiṅgasālasutte (ma. ni. 1.325 ādayo).
"As already explained" in the Gosiṅgasāla Sutta.
Vuttanayameva (cùng một cách đã nói) trong kinh Gosiṅgasālasutta (M.N. 1.325, v.v.).
241. ‘‘Yathā kathaṃ panā’’ti vuttapucchānaṃ pacchimabhāvato ‘‘atthi pana voti pacchimapucchāyā’’ti vuttaṃ, na puna ‘‘atthi pana vo’’ti pavattanassa pucchanassa atthibhāvato.
Since "how then" refers to a preceding question, it is said "is this a concluding question?" not again because of the existence of the question, "is this for you?"
241. Vì câu hỏi "Yathā kathaṃ panā" (làm sao vậy?) là câu hỏi cuối cùng, nên đã nói "atthi pana voti pacchimapucchāyā" (có phải là câu hỏi cuối cùng "atthi pana vo" không?), chứ không phải vì có câu hỏi "atthi pana vo" (các vị có không?).
So pana lokuttaradhammo.
That is the supramundane Dhamma.
So pana (cái đó thì) là pháp siêu thế.
Therānanti anuruddhattherādīnaṃ natthi.
For the Elders, like Venerable Anuruddha and others, it does not exist.
Therānaṃ (của các Trưởng lão) là các Trưởng lão Anuruddha, v.v. không có.
Parikammobhāsaṃ pucchatīti dibbacakkhuñāṇe katādhikārattā tassa uppādanatthaṃ parikammobhāsaṃ pucchati.
"He asks about the preliminary aura" means, having developed the divine eye knowledge, he asks about the preliminary aura for its production.
Parikammobhāsaṃ pucchati (hỏi về ánh sáng chuẩn bị) là vì đã có sự thành tựu trong thiên nhãn thông, Ngài hỏi về ánh sáng chuẩn bị để phát sinh nó.
Parikammobhāsanti parikammasamādhinibbattaṃ obhāsaṃ, upacārajjhānasañjanitaṃ obhāsanti attho.
"Preliminary aura" means the aura produced by preliminary concentration, that is, the aura generated by access jhāna.
Parikammobhāsaṃ (ánh sáng chuẩn bị) là ánh sáng do định chuẩn bị sinh ra, tức là ánh sáng do cận định sinh ra.
Catutthajjhānalābhī hi dibbacakkhuparikammatthaṃ obhāsakasiṇaṃ bhāvetvā upacāre ṭhapito samādhi parikammasamādhi, tattha obhāso parikammobhāsoti vutto.
Indeed, one who has attained the fourth jhāna, having developed the aura-kasiṇa for the preliminary work of the divine eye, the concentration placed in access is preliminary concentration, and the aura there is called preliminary aura.
Thật vậy, người đắc Tứ thiền, để chuẩn bị cho thiên nhãn thông, tu tập biến xứ ánh sáng, và định được thiết lập trong cận định là định chuẩn bị, ở đó ánh sáng được gọi là ánh sáng chuẩn bị.
Taṃ sandhāyāha – ‘‘obhāsañceva sañjānāmāti parikammobhāsaṃ sañjānāmā’’ti.
Referring to that, it is said: "we perceive an aura, that is, we perceive the preliminary aura."
Nhắm vào điều đó, Ngài nói: "Obhāsañceva sañjānāmāti parikammobhāsaṃ sañjānāmā" (chúng tôi nhận biết ánh sáng, tức là chúng tôi nhận biết ánh sáng chuẩn bị).
Yattake hi ṭhāne dibbacakkhunā rūpagataṃ daṭṭhukāmo, tattakaṃ ṭhānaṃ obhāsakasiṇaṃ pharitvā ṭhito.
Indeed, as far as one wishes to see visual objects with the divine eye, so far does one extend the aura-kasiṇa.
Thật vậy, ở bất kỳ nơi nào muốn nhìn thấy sắc pháp bằng thiên nhãn, người ấy đã trải biến xứ ánh sáng khắp nơi đó.
Taṃ obhāsaṃ tattha ca rūpagataṃ dibbacakkhuñāṇena passati, therā ca tathā paṭipajjiṃsu.
One sees that aura and the visual objects there with the knowledge of the divine eye, and the Elders practiced accordingly.
Người ấy nhìn thấy ánh sáng đó và sắc pháp ở đó bằng thiên nhãn thông, và các Trưởng lão đã thực hành như vậy.
Tena vuttaṃ – ‘‘obhāsañceva sañjānāma dassanañca rūpāna’’nti.
Therefore it is said: "we perceive an aura and the seeing of forms."
Do đó, đã nói: "Obhāsañceva sañjānāma dassanañca rūpānaṃ" (chúng tôi nhận biết ánh sáng và sự nhìn thấy các sắc pháp).
Yasmā pana tesaṃ rūpagataṃ passantānaṃ parikammavāro atikkami, tato obhāso antaradhāyi, tasmiṃ antarahite rūpagatampi na paññāyati.
But since the preliminary stage of their seeing visual objects passed, the aura disappeared, and with its disappearance, the visual objects also became imperceptible.
Tuy nhiên, vì giai đoạn chuẩn bị của họ đã qua khi nhìn thấy sắc pháp, nên ánh sáng đã biến mất, khi ánh sáng biến mất thì sắc pháp cũng không còn hiện rõ.
Parikammanti hi yathāvuttakasiṇārammaṇaṃ upacārajjhānaṃ, rūpagataṃ passantānaṃ kasiṇobhāsavasena rūpagatadassanaṃ, kasiṇobhāso ca parikammavasenāti tadubhayampi parikammassa appavattiyā nāhosi, tayidaṃ kāraṇaṃ ādikammikabhāvato therā na maññiṃsu, tasmā vuttaṃ ‘‘nappaṭivijjhāmā’’ti.
Preliminary work (parikamma) is indeed the access jhāna with the kasiṇa-object as described, and the seeing of visual objects by means of the kasiṇa-aura for those who see visual objects; and the kasiṇa-aura is by means of the preliminary work, so both these did not exist due to the non-continuation of the preliminary work; and this reason, being new practitioners, the Elders did not understand, therefore it is said "we do not penetrate it."
Parikamma (chuẩn bị) là cận định có đối tượng là biến xứ đã nói, sự nhìn thấy sắc pháp bằng thiên nhãn là sự nhìn thấy sắc pháp thông qua biến xứ ánh sáng, và biến xứ ánh sáng là do sự chuẩn bị, nên cả hai điều đó đều không còn do sự không tiếp diễn của sự chuẩn bị. Các Trưởng lão không biết nguyên nhân này vì họ là những người mới bắt đầu, do đó đã nói "nappaṭivijjhāmā" (chúng tôi không thể thấu hiểu).
Nimittaṃ paṭivijjhitabbanti kāraṇaṃ paccakkhato dassetvā suvisuddhadibbacakkhuñāṇe theraṃ patiṭṭhāpetukāmo satthā vadati.
"The sign should be penetrated"—the Teacher says this, desiring to show the cause directly and establish the Elders in perfectly pure divine eye knowledge.
Nimittaṃ paṭivijjhitabbaṃ (cần phải thấu hiểu tướng) là Bậc Đạo Sư nói vì muốn thiết lập các Trưởng lão vào thiên nhãn thông thanh tịnh hoàn toàn bằng cách chỉ ra nguyên nhân một cách trực tiếp.
Kiṃ na āḷulessantīti kiṃ na byāmohessanti, byāmohessanti evāti attho.
"What, will they not disturb?" means, will they not confuse? They will confuse indeed, is the meaning.
Kiṃ na āḷulessantī (có phải chúng sẽ không làm khuấy động không?) có nghĩa là chúng sẽ làm khuấy động.
Vicikicchā udapādīti dibbacakkhuno yathāupaṭṭhitesu rūpagatesu apubbatāya, ‘‘idaṃ nu kho rūpagataṃ kiṃ, idaṃ nu kho ki’’nti maggena asamucchinnattā vicikicchā saṃsayo uppajji.
"Doubt arose" means, due to the novelty of visual objects appearing to the divine eye, doubt and perplexity arose, "what is this visual object? what is this?" because it was not uprooted by the path.
Vicikicchā udapādī (nghi ngờ đã phát sinh) là do sự bất thường của các sắc pháp hiện tiền đối với thiên nhãn, nghi ngờ, hoài nghi đã phát sinh vì chưa đoạn trừ bằng cách tự hỏi: "Sắc pháp này là gì? Sắc pháp này là gì?"
Samādhi cavīti vicikicchāya uppannattā parikammasamādhi vigacchi.
"Concentration wavered" means, due to the arising of doubt, the preliminary concentration vanished.
Samādhi cavī (định đã thoái hóa) là vì nghi ngờ đã phát sinh, định chuẩn bị đã mất đi.
Tato eva hi parikammobhāsopi antaradhāyi, dibbacakkhunāpi rūpaṃ na passi.
Because of that, the preliminary aura also disappeared, and he did not see forms with the divine eye either.
Chính vì thế mà ánh sáng chuẩn bị cũng biến mất, và không nhìn thấy sắc pháp bằng thiên nhãn nữa.
Na manasi karissāmīti manasikāravasena me rūpāni upaṭṭhahiṃsu, rūpāni passato vicikicchā uppajjati, tasmā idāni kiñci na manasi karissāmīti tuṇhī ahosi taṃ pana tuṇhībhāvappattiṃ sandhāyāha ‘‘amanasikāro udapādī’’ti.
"I will not pay attention" means, forms appeared to me through attention, and when seeing forms, doubt arises, therefore now I will pay attention to nothing, and he became silent; referring to that state of being silent, it is said "non-attention arose."
Na manasi karissāmī (tôi sẽ không tác ý) là các sắc pháp đã hiện tiền với tôi do tác ý, khi nhìn thấy các sắc pháp thì nghi ngờ phát sinh, do đó bây giờ tôi sẽ không tác ý bất cứ điều gì, và đã trở nên im lặng. Nhắm vào sự im lặng đó, Ngài nói "amanasikāro udapādī" (sự không tác ý đã phát sinh).
Tathābhūtassa amanasikārassa abhāvaṃ āgamma uppilaṃ udapādi.
Due to the absence of such non-attention, "exaltation arose."
Vì không có sự không tác ý như vậy, nên uppilaṃ udapādi (sự phấn khích đã phát sinh).
Vīriyaṃ gāḷhaṃ paggahitanti thinamiddhachambhitattānaṃ vūpasamanatthaṃ accāraddhavīriyaṃ ahosi, tena citte samādhidūsikā gehassitā balavapīti uppannā.
"Energy was firmly exerted" means, excessive energy arose to suppress sloth, torpor, and agitation; due to this, a strong worldly joy, a corrupting influence on the mind for concentration, arose.
Vīriyaṃ gāḷhaṃ paggahitaṃ (tinh tấn đã được thúc đẩy mạnh mẽ) là tinh tấn quá mức đã xảy ra để dẹp bỏ hôn trầm, thụy miên và sự sợ hãi, do đó một sự vui thích mạnh mẽ liên quan đến gia đình, làm ô nhiễm tâm, đã phát sinh.
Tenāha ‘‘uppilaṃ uppanna’’nti.
Therefore it is said "exaltation arose."
Do đó, Ngài nói: "uppilaṃ uppannaṃ" (sự phấn khích đã phát sinh).
Tatoti sithilavīriyattā.
"Then" means due to lax energy.
Tato (từ đó) là do tinh tấn lỏng lẻo.
Patameyyāti ativiya khinnaṃ bhaveyya.
"He would be utterly weary" means he would be excessively tired.
Patameyyā (sẽ cực kỳ mệt mỏi).
Taṃ mamāti patthanāabhibhavanīyamanasīsena jappetīti abhijappā, taṇhā.
"That is mine" – this is a desire that, due to a mind overcome by longing, keeps murmuring, hence "ardent longing," which is craving.
Điều đó là của tôi, tức là sự khao khát, sự tham ái được lặp đi lặp lại bởi tâm bị chi phối bởi sự ước muốn, đó là abhijappā (sự tham ái).
Nānattā nānāsabhāvā saññā nānattasaññā.
Perceptions that are diverse and of diverse natures are diverse perceptions.
Các tưởng khác nhau, có bản chất khác nhau là tưởng về sự đa dạng (nānattasaññā).
Ativiya upari katvā nijjhānaṃ pekkhanaṃ atinijjhāyitattaṃ.
Contemplating or observing by excessively elevating it is excessive contemplation.
Quán sát và nhìn nhận một cách quá mức là sự quán sát quá mức (atinijjhāyitattaṃ).
Kasiṇarūpānaṃ vasenettha obhāsassa parittatāti āha ‘‘parittaṭṭhāne obhāsa’’nti.
Referring to the limitedness of the light in terms of kasiṇa-forms, it is said: “light in a limited space”.
Ở đây, do các sắc kasiṇa mà ánh sáng là nhỏ hẹp, nên nói “ánh sáng ở nơi nhỏ hẹp”.
Parittāni rūpānīti katipayāni, sā ca nesaṃ parittatā ṭhānavasenevāti āha ‘‘parittakaṭṭhāne rūpānī’’ti.
“Limited forms” means a few; and that limitedness of theirs is in terms of space, so it is said: “forms in a limited space”.
“Các sắc nhỏ hẹp” nghĩa là một vài, và sự nhỏ hẹp của chúng chỉ là ở nơi chốn, nên nói “các sắc ở nơi chốn nhỏ hẹp”.
‘‘Appamāṇañcevā’’tiādinā vutto dutiyavāro.
The second recitation is stated with “immeasurable”.
Giai đoạn thứ hai được nói đến bằng câu “Vô lượng” v.v…
Obhāsaparittataṃ sandhāya parikammasamādhi ‘‘paritto’’ti vutto tasseva obhāsassa appamāṇatāya appamāṇasamādhīti vacanato.
Referring to the limitedness of the light, the preliminary concentration is called “limited,” and by the same light's immeasurability, it is called immeasurable concentration.
Do ánh sáng nhỏ hẹp mà định sơ khởi được gọi là “nhỏ hẹp”, theo cách nói rằng do ánh sáng ấy vô lượng nên là định vô lượng.
Tasmiṃ samayeti tasmiṃ parittasamādhino uppannasamaye.
At that time means at the time of the arising of that limited concentration.
“Vào lúc ấy” nghĩa là vào lúc phát sinh định nhỏ hẹp ấy.
Dibbacakkhupi parittakaṃ hoti parittarūpagatadassanato.
Even the divine eye is limited because it perceives limited forms.
“Thiên nhãn cũng nhỏ hẹp” vì thấy các sắc ở nơi nhỏ hẹp.
245. Dukatikajjhānasamādhinti catukkanaye dukajjhānasamādhiṃ, pañcakanaye tikajjhānasamādhinti yojanā.
245. Concentration of the two and three jhāna is to be understood as the concentration of the two jhāna in the fourfold system, and the concentration of the three jhāna in the fivefold system.
245. “Định thiền nhị và tam” là cách phối hợp trong cách bốn thiền là định thiền nhị, trong cách năm thiền là định thiền tam.
Dukajjhānasamādhinti catukkanaye tatiyacatutthavasena dukajjhānasamādhiṃ, pañcakanaye catutthapañcamavasena dukajjhānasamādhiṃ.
Concentration of the two jhāna means the concentration of the two jhāna in the fourfold system, in the sense of the third and fourth, and the concentration of the two jhāna in the fivefold system, in the sense of the fourth and fifth.
“Định thiền nhị” là trong cách bốn thiền là định thiền nhị theo thiền thứ ba và thứ tư, trong cách năm thiền là định thiền nhị theo thiền thứ tư và thứ năm.
Tikacatukkajjhānasamādhinti catukkanaye tikajjhānasamādhiṃ, pañcakanaye catukkajjhānasamādhinti yojanā.
Concentration of the three and four jhāna is to be understood as the concentration of the three jhāna in the fourfold system, and the concentration of the four jhāna in the fivefold system.
“Định thiền tam và tứ” là cách phối hợp trong cách bốn thiền là định thiền tam, trong cách năm thiền là định thiền tứ.
Tividhanti sappītikavasena tippakāraṃ samādhiṃ.
Three kinds means concentration of three types in the sense of being accompanied by rapture.
“Ba loại” nghĩa là ba loại định theo trạng thái có hỷ.
Tadantogadhāti sappītikādisabhāvā.
Included within them means having the nature of being accompanied by rapture and so on.
“Bao gồm trong đó” nghĩa là có bản chất có hỷ v.v…
Kāmaṃ bhagavā purimayāme pubbenivāsānussatiñāṇaṃ, pacchimayāme dibbacakkhuñāṇaṃ nibbattentopi imāni ñāṇāni bhāvesiyeva.
Even though the Blessed One developed the knowledge of recollecting past lives in the first watch of the night and the divine eye knowledge in the last watch, he certainly developed these knowledges.
Dù Đức Thế Tôn đã làm phát sinh túc mạng trí vào canh đầu và thiên nhãn trí vào canh cuối, nhưng Ngài vẫn tu tập các trí này.
Vipassanāpādakāni pana ñāṇāni sandhāya, ‘‘pacchimayāme’’ti vuttaṃ, tenāha ‘‘bhagavato hī’’tiādi.
However, “in the last watch” was said with reference to the knowledges that are the basis for insight, therefore it is said: “for the Blessed One” and so on.
Nhưng câu “vào canh cuối” được nói đến để chỉ các trí làm nền tảng cho thiền quán, nên nói “quả thật của Đức Thế Tôn” v.v…
Pañcamajjhānassāti pañcamajjhānikassa vasena paṭhamajjhāniko maggo natthi.
There is no path that is of the first jhāna for one of the fifth jhāna.
“Của thiền thứ năm” nghĩa là không có đạo sơ thiền theo thiền thứ năm.
Soti pañcakanayo bhagavato lokiyo ahosi.
That fivefold system was mundane for the Blessed One.
“Nó” nghĩa là cách năm thiền là hữu lậu của Đức Thế Tôn.
Etanti etaṃ, ‘‘savitakkampi savicāraṃ samādhiṃ bhāvemī’’tiādivacanaṃ.
This refers to this statement, “I develop concentration that is accompanied by initial application and sustained application,” and so on.
“Điều này” nghĩa là lời nói “Tôi tu tập định có tầm có tứ” v.v…
Lokiyalokuttaramissakaṃ sandhāya vuttaṃ, na ‘‘lokiyaṃ vā lokuttarameva vā’’ti.
It is said with reference to a mixture of mundane and supramundane, not “only mundane or only supramundane.”
Được nói đến để chỉ sự pha trộn giữa hữu lậu và siêu thế, chứ không phải “chỉ là hữu lậu hoặc chỉ là siêu thế”.
Sesaṃ suviññeyyamevāti.
The rest is easily understandable.
Phần còn lại dễ hiểu.
246. Etehīti ducintitādīhi.
246. By these means by evil thoughts and so on.
246. “Bởi những điều này” nghĩa là bởi các điều suy nghĩ xấu v.v…
Etena lakkhaṇasaddassa karaṇatthatamāha.
By this, the instrumental sense of the word lakkhaṇa (characteristic) is explained.
Điều này cho thấy từ “lakkhaṇa” (đặc điểm) có nghĩa là công cụ.
Tānevāti lakkhaṇāni eva.
Only those means only the characteristics.
“Chính những điều đó” nghĩa là chính những đặc điểm.
Tassāti bālassa.
Of him means of the fool.
“Của người đó” nghĩa là của kẻ ngu.
‘‘Ayaṃ bālo’’ti nimīyati sañcānīyati etehīti bālanimittāni.
By these, one is marked or recognized as “This is a fool,” hence signs of a fool.
Những điều mà nhờ đó người ta nhận biết, biết rõ “Đây là kẻ ngu” nên là những dấu hiệu của kẻ ngu (bālanimittāni).
Apadānaṃ vuccati vikhyātaṃ kammaṃ.
Apadāna is said to be a well-known deed.
“Apadāna” được gọi là hành động nổi tiếng.
Ducintitādīni ca bāle vikhyātāni, avadhāraṇabhāve vā, tasmā bālassa apadānānīti bālāpadānāni.
Evil thoughts and so on are well-known in a fool, or in the sense of ascertainment; therefore, the well-known deeds of a fool are the fool's deeds.
Và các điều suy nghĩ xấu v.v… nổi tiếng ở kẻ ngu, hoặc theo nghĩa khẳng định, do đó là những hành động của kẻ ngu nên là những hành động của kẻ ngu (bālāpadānāni).
Abhijjhādīhi duṭṭhaṃ dūsitaṃ cintetīti ducintitacintī.
He thinks thoughts corrupted or defiled by covetousness and so on, hence one who thinks evil thoughts.
Do tham ái v.v… mà suy nghĩ điều xấu, làm ô uế nên là kẻ suy nghĩ điều xấu (ducintitacintī).
Lobhādīhi duṭṭhaṃ bhāsitaṃ musāvādādiṃ bhāsatīti dubbhāsitabhāsī.
He speaks words corrupted by greed and so on, such as false speech, hence one who speaks evil words.
Do tham lam v.v… mà nói lời xấu, nói lời nói dối v.v… nên là kẻ nói lời xấu (dubbhāsitabhāsī).
Tesaṃ tesaṃyeva vasena kattabbato dukkaṭakammaṃ pāṇātipātādiṃ karotīti dukkaṭakammakārī.
He performs evil deeds such as killing living beings, based on those very things, hence one who performs evil deeds.
Do chính những điều đó mà thực hiện hành động ác như sát sinh v.v… nên là kẻ làm hành động ác (dukkaṭakammakārī).
Tenāha ‘‘cintayanto’’tiādi.
Therefore, it is said: “thinking” and so on.
Do đó nói “khi suy nghĩ” v.v…
Tāni upanissāya jātanti tajjaṃ.
That which arises dependent on those is of that nature.
Phát sinh nương tựa vào chúng nên là tương ứng.
Tato eva tesaṃ sāruppaṃ anurūpanti tassāruppaṃ.
That which is suitable or appropriate to them from that very source is appropriate to them.
Chính vì thế, sự phù hợp, tương ứng với chúng nên là sự tương ứng với chúng (tassāruppaṃ).
Tenāha ‘‘tajjātika’’ntiādi.
Therefore, it is said: “of that kind” and so on.
Do đó nói “thuộc loại đó” v.v…
Kacchamānāyāti kathiyamānāya.
While being spoken means while being narrated.
“Khi được nói” nghĩa là khi được kể.
248. Yasmā sattānaṃ yathūpacitāni kammāni katokāsāni tadupaṭṭhāpitāni kammanimittagatinimittāni maraṇassa āsannakāle cittassa āpāthaṃ āgacchantāni, tadā olambantāni viya abhibhavantāni viya ajjhottharantāni viya upaṭṭhahanti, tasmā vuttaṃ – ‘‘olambanādiākārena hi tāni upaṭṭhahantī’’ti.
248. Since the karmas accumulated by beings, having been performed and given opportunity, bringing forth karma-signs and destiny-signs, appear to the mind's threshold at the time of approaching death, as if hanging, overwhelming, or submerging, it is therefore said: “for they appear in the manner of hanging down and so on”.
Vì các nghiệp đã tích lũy của chúng sinh, đã tạo cơ hội, đã được chúng dựng lên, các nghiệp tướng và thú tướng khi đến gần thời điểm chết, chúng hiện ra như đang treo lơ lửng, như đang lấn át, như đang bao trùm, nên nói – “quả thật chúng hiện ra dưới hình thức treo lơ lửng v.v…”.
Upaṭṭhānākāro eva tadā cittassa gocarabhāvaṃ gacchatīti āha – ‘‘tasmiṃ upaṭṭhānākāre āpāthagate’’ti.
The manner of appearance itself becomes the object of the mind at that time, so it is said: “when that manner of appearance has come to the mind's threshold”.
Chính hình thức hiện ra ấy vào lúc đó trở thành đối tượng của tâm, nên nói – “khi hình thức hiện ra ấy đã trở thành đối tượng”.
249. Na sakkāti na vadatīti etena dvepi paṭisedhā pakatiatthāti ayamattho vutto hoti.
249. “It is not possible” means “he does not speak”; by this, it is explained that both negations have their natural meaning.
248. “Không thể” nghĩa là không nói, điều này có nghĩa là cả hai sự phủ định đều có nghĩa tự nhiên.
Na sukarāti pana iminā dukkarabhāvo dīpito, dukkarañca tāva upāyena sakkā kātunti dassento āha – ‘‘na sukaraṃ panā’’tiādi.
However, by “it is not easy,” difficulty is indicated, and showing that what is difficult can still be done by means, it is said: “it is not easy, however” and so on.
Nhưng với từ “không dễ” thì sự khó khăn được chỉ ra, và để cho thấy rằng điều khó khăn vẫn có thể thực hiện được bằng phương tiện, nên nói – “nhưng không dễ” v.v…
Tenāti vinivijjhitvā gamanena aññamaññaṃ saṃvijjhanena.
By that means by piercing through, by mutually piercing.
“Bởi điều đó” nghĩa là bởi sự xuyên qua, bởi sự xuyên thủng lẫn nhau.
Assāti corassa.
Of him means of the thief.
“Của người ấy” nghĩa là của tên trộm.
Ito uttaripīti majjhanhikasamayaṃ sāyanhasamayañca sattisatena.
Even beyond this means with a hundred spears at midday and at evening.
“Ngoài điều này” nghĩa là vào giữa trưa và buổi chiều với hàng trăm cây giáo.
250. Saṅkhampi na upetīti iminā saṅkhātabbamattaṃ natthīti dīpitaṃ hotīti āha – ‘‘gaṇanāmattampi na gacchatī’’ti.
250. “Does not amount to a count” indicates that there is not even a quantifiable amount, so it is said: “does not even go to the extent of a count”.
250. “Không đạt đến con số” điều này có nghĩa là không có gì đáng kể, nên nói – “không đạt đến dù chỉ là số lượng”.
Upanikkhepanamattampīti etthāpi eseva nayo.
“Not even a mere comparison” has the same meaning here.
“Dù chỉ là sự so sánh” cũng theo cách này.
Kalabhāganti kalānaṃ saṅgaṇanakoṭṭhāsaṃ.
A fraction means a countable portion of fractions.
“Phần nhỏ” nghĩa là phần tính toán của các phần nhỏ.
Tenāha ‘‘satimaṃ kala’’ntiādi.
Therefore, it is said: “a wise fraction” and so on.
Do đó nói “một phần nhỏ của trí nhớ” v.v…
Olokitamattampīti upanikkhepanavasena olokanamattakampi.
Not even a mere glance means not even a mere glance by way of comparison.
“Dù chỉ là sự nhìn” nghĩa là dù chỉ là sự nhìn theo cách so sánh.
Taṃ kammakāraṇanti taṃ pañcavidhabandhanakammakāraṇaṃ catunnampi passānaṃ vasena samparivattetvā karontiyeva, pāḷiyaṃ pana ekapassavasena āgatā.
That punishment means that punishment of the fivefold binding, continuously being carried out by turning him on all four sides, but in the Pāli, it is mentioned as one side.
“Sự tra tấn đó” nghĩa là sự tra tấn năm loại trói buộc đó, thực hiện bằng cách xoay tròn cả bốn phía, nhưng trong kinh điển thì chỉ nói đến một phía.
Gehassāti mahato gehassa.
Of a house means of a large house.
“Của ngôi nhà” nghĩa là của ngôi nhà lớn.
Sabbatoti sabbāvayavato.
From all sides means from all parts.
“Từ mọi phía” nghĩa là từ mọi bộ phận.
Sampajjalite ekajālībhūte.
Completely blazing means becoming a single flame.
“Bùng cháy” thành một ngọn lửa duy nhất.
Supakkuthitāyāti suṭṭhu nipakkāya.
Well-boiled means perfectly cooked.
“Đã sôi sục” nghĩa là đã sôi kỹ.
252. Durūpoti virūpo.
252. Ugly means disfigured.
252. “Xấu xí” nghĩa là dị dạng.
Duddasoti teneva virūpabhāvena aniṭṭhadassano.
Hard to look at means unpleasant to see due to that very disfigurement.
“Khó nhìn” nghĩa là không dễ chịu khi nhìn bởi chính sự dị dạng đó.
Lakuṇṭhakoti rasso.
Lakuṇṭaka means short.
“Lùn tịt” nghĩa là thấp bé.
Paviṭṭhagīvoti khandhantaraṃ anupaviṭṭhagīvo.
With neck drawn in means with the neck drawn into the shoulders.
“Cổ rụt” nghĩa là cổ rụt vào giữa vai.
Mahodaroti vipulakucchi.
With a large belly means with a vast abdomen.
“Bụng lớn” nghĩa là bụng to.
Yebhuyyena hi lakuṇṭakā sattā rassagīvā puthulakucchikāva hontīti tathā vuttaṃ.
Indeed, short people mostly have short necks and broad bellies, so it is said as such.
Quả thật, hầu hết các chúng sinh lùn tịt đều có cổ rụt và bụng to, nên được nói như vậy.
Kāṇo nāma cakkhuvikaloti vuttaṃ – ‘‘ekakkhikāṇo vā ubhayakkhikāṇo vā’’ti.
A blind person is said to be one with defective eyes: “one-eyed or two-eyed blind”.
Người mù là người thiếu mắt, nên nói – “mù một mắt hay mù cả hai mắt”.
Kuṇīti hatthavikalo vuccatīti āha – ‘‘ekahatthakuṇī vā ubhayahatthakuṇī vā’’ti.
Kuṇī is said to be one with a defective hand, so it is said: “one-handed or two-handed crippled”.
“Què cụt” được gọi là người thiếu tay, nên nói – “què cụt một tay hay què cụt cả hai tay”.
Vātādinā upahatakāyapakkho idha pakkhahatoti adhippeto, na pakkhihatoti āha – ‘‘pakkhahatoti pīṭhasappī’’ti.
One whose body is afflicted by wind (disease) and so on is here meant by one with paralyzed limbs, not one struck by a bird, so it is said: “pakkhahatoti pīṭhasappī” (paralyzed means one who crawls on their bottom).
Người bị liệt nửa người do gió v.v… ở đây được hiểu là người bị liệt, chứ không phải người bị chim đánh, nên nói – “người bị liệt là người bò bằng mông”.
Dukkhānupabandhadassanatthanti aparāparajātīsu vipākadukkhassa anupabandhavasena pavattidassanatthaṃ.
Dukkhānupabandhadassanatthaṃ means for the purpose of showing the continuous occurrence of suffering of vipāka in subsequent existences.
Để chỉ ra sự tiếp nối của khổ có nghĩa là để chỉ ra sự diễn tiến của khổ quả một cách tiếp nối không ngừng trong các kiếp sống khác nhau.
Kalīyati khalīyati appahīyati sāsanaṃ etenāti kali, jutaparājayo.
That by which the dispensation is weakened, falters, or is not abandoned, is kali, a defeat of splendor.
Giáo pháp bị suy yếu, bị trở ngại, không được từ bỏ bởi cái này, nên gọi là kali, sự thất bại của sự rực rỡ.
So eva gahasadisatāya ‘‘kaliggaho’’ti vutto.
That very kali, due to its house-like nature, is called "kaliggaho."
Chính cái đó, vì giống như sự nắm giữ, nên được gọi là “kaliggaha”.
Adhibandhanti kuṭumbassa adhivutthassa mūlabhūtassa attano bandhitabbataṃ.
Adhibandhaṃ means one's own binding, which is the root of the family that one dwells in.
Sự ràng buộc chính có nghĩa là sự ràng buộc của chính mình, là căn bản cho một gia đình đang sinh sống.
Tenāha ‘‘attanāpi bandhaṃ nigaccheyyā’’ti.
Therefore it is said: "he would bind himself."
Vì thế, đã nói: “chính mình cũng sẽ bị ràng buộc”.
Bālabhūmiyā bālabhāvassa matthakappatti nirayagāmikammakāritāti ‘‘niraye nibbattati’’cceva vuttaṃ.
The culmination of foolishness, the state of being a fool, is the performance of actions leading to hell; thus it is simply said: "is reborn in hell."
Sự đạt đến đỉnh cao của trạng thái ngu si, tức là tạo ra nghiệp dẫn đến địa ngục, nên đã nói “sinh vào địa ngục”.
Taggahaṇeneva pana tato mudumudutarādikammavasena sesāpāyesu aparāparanibbattādibālabhūmi vibhāvitā hotīti.
By the mention of that, however, the other foolish states of rebirth in the remaining lower realms, due to actions that are progressively milder, are also revealed.
Tuy nhiên, chỉ với sự đề cập đó, trạng thái ngu si được biểu thị là sinh vào các khổ cảnh khác một cách từ từ, tùy theo các nghiệp nhẹ hơn, v.v.
253. Vuttānusārenāti ‘‘bālo aya’’ntiādinā vuttassa atthavacanassa ‘‘paṇḍito aya’’nti etehi lakkhīyatītiādinā anusārena.
253. Vuttānusārena means in accordance with the meaning expressed by "This is a fool," and "This is a wise person," indicated by these characteristics.
253. Theo như đã nói có nghĩa là theo như lời giải thích ý nghĩa đã nói “người này là kẻ ngu si”, v.v., bằng những điều này “người này là người trí”, v.v.
Manosucaritādīnaṃ vasenāti cintento anabhijjhā-abyāpāda-sammādassanaṃ sucintitameva cintetītiādinā manosucaritānaṃ tiṇṇaṃ sucaritānaṃ vasena yojetabbāni.
Manosucaritādīnaṃ vasena means they should be connected by way of the three good conducts of mind, such as "thinking, he thinks only non-covetousness, non-ill-will, and right view, well-thought-out."
Theo các thân thiện hành, v.v. có nghĩa là phải kết hợp theo ba ý thiện hành: suy nghĩ không tham lam, không sân hận, chánh kiến, tức là chỉ suy nghĩ những điều đã được suy nghĩ đúng đắn, v.v.
256. Uposathaṃ (dī. ni. ṭī. 2.243) vuccati aṭṭhaṅgasamannāgataṃ sabbadivasesu gahaṭṭhehi rakkhitabbasīlaṃ, samādānavasena taṃ etassa atthīti uposathiko, tassa.
256. Uposatha (Dī. Nī. Ṭī. 2.243) refers to the eight-membered precept to be observed by householders on all days; uposathiko is one who has it by way of undertaking it, for him.
256. Uposatha (Dī. Ni. Ṭī. 2.243) được gọi là giới có tám chi phần, là giới mà các gia chủ phải giữ vào tất cả các ngày; người có giới đó do thọ trì nên là uposathika, tức là của người ấy.
Tenāha ‘‘samādinnauposathaṅgassā’’ti.
Therefore it is said: "for one who has undertaken the Uposatha limbs."
Vì thế, đã nói: “của người đã thọ trì chi phần uposatha”.
Tadāti tasmiṃ kāle, yasmiṃ pana kāle cakkavattibhāvasaṃvattaniya-dāna-sīlādi-puññasambhārasamudāgamasampanno pūritacakkavattivatto kādīpadesavisesapaccājātiyā ceva kularūpabhogādhipateyyādiguṇavisesasampattiyā ca tadanurūpe attabhāve ṭhito hoti, tasmiṃ kāle.
Tadā means at that time, namely, at the time when the supreme person destined to be a Cakkavatti, having accumulated the requisites of merit such as generosity and virtue, and having fulfilled the Cakkavatti vows, is reborn in specific regions like Kādi, and is endowed with special qualities such as family, beauty, wealth, and sovereignty, and is established in a body suitable for that; at that time.
Khi đó có nghĩa là vào thời điểm đó, tức là vào thời điểm mà vị nhân vật tối thượng sẽ trở thành Chuyển Luân Vương đã thành tựu viên mãn các phước báu như bố thí, trì giới, v.v., đã hoàn thành các hạnh của Chuyển Luân Vương, và đã sinh vào một vùng đất đặc biệt như Kādī, đồng thời thành tựu các phẩm chất đặc biệt như dòng tộc, sắc đẹp, tài sản, quyền lực, v.v., và đang ở trong thân tướng phù hợp với điều đó, vào thời điểm đó.
Tādise hi kāle cakkavattibhāvī purisuttamo yathāvuttaguṇasamannāgato rājā khattiyo hutvā muddhāvasitto visuddhasīlo anuposathaṃ satasahassavissajjanādinā sammāpaṭipattiṃ paṭipajjati, na yadā cakkaratanaṃ uppajjati, tadā eva.
For at such a time, the Cakkavatti-to-be, the supreme man, being a king, a Khattiya, endowed with the aforementioned qualities, anointed, of pure virtue, practices the right conduct without the Uposatha, by spending hundreds of thousands and so on, not only when the chakra-jewel arises.
Vì vào thời điểm như vậy, vị nhân vật tối thượng sẽ là Chuyển Luân Vương, là một vị vua Sát-đế-lợi đã được quán đảnh, thành tựu các phẩm chất đã nói, có giới hạnh thanh tịnh, thực hành chánh hạnh bằng cách bố thí hàng trăm ngàn, v.v., chứ không phải chỉ khi bánh xe báu xuất hiện.
Tenāha – ‘‘pāto…pe… dhammatā’’ti.(Tattha damo indriyasaṃvaro, saṃyamo sīlasaṃvaro.)
Therefore it is said: "in the morning... etc. ... is the rule." (Here, damo is sense-restraint, saṃyamo is moral restraint.)
Vì thế, đã nói – “sáng sớm…pe… là tự nhiên”. (Trong đó, damo là sự chế ngự các căn, saṃyamo là sự chế ngự giới hạnh.)
Vuttappakārapuññakammapaccayanti cakkavattibhāvāvahadānadamasaṃyamādipuññakammahetukaṃ.
Vuttappakārapuññakammapaccayaṃ means caused by meritorious deeds such as generosity, self-control, and restraint, which lead to the state of a Cakkavatti, as described.
Do nhân nghiệp phước đã nói có nghĩa là do nghiệp phước như bố thí, chế ngự, tự chủ, v.v., dẫn đến trạng thái Chuyển Luân Vương.
Nīlamaṇisaṅghāṭasadisanti indanīlamaṇisañcayasamānaṃ.
Nīlamaṇisaṅghāṭasadisaṃ means resembling a heap of sapphire jewels.
Giống như một khối ngọc bích có nghĩa là giống như một khối ngọc Indanīla.
Dibbānubhāvayuttattāti dassanīyatā manuññaghosatā ākāsagāmitā obhāsavissajjanā appaṭighātatā rañño icchitatthanipphattikāraṇatāti evamādīhi dibbasadisehi ānubhāvehi samannāgatattā.
Dibbānubhāvayuttattā means being endowed with divine-like powers such as being delightful to behold, having a pleasant sound, moving through the air, emitting light, being unobstructed, and causing the king's desired aims to be fulfilled.
Do có thần thông siêu phàm có nghĩa là do có thần thông giống như thần thông của chư thiên, như sự đáng xem, giọng nói dễ chịu, khả năng bay trên không, phát ra ánh sáng, không bị cản trở, là nguyên nhân thành tựu điều vua mong muốn, v.v.
Sabbehi ākārehīti sabbehi sundarehi ākārehi.
By all aspects means by all beautiful aspects.
Với tất cả hình thái có nghĩa là với tất cả hình thái tốt đẹp.
Paripūranti paripuṇṇaṃ.
Full means complete.
Hoàn hảo có nghĩa là đầy đủ.
Sā cassa pāripūri idāneva vitthārīyati.
And that completeness of his is now being elaborated.
Sự hoàn hảo đó sẽ được giải thích chi tiết ngay bây giờ.
Paricchedalekhādīnīti ādi-saddena mālākammādiṃ saṅgaṇhāti.
Dividing lines and so forth; the word and so forth includes garlands and so on.
Các đường phân chia, v.v. Với từ v.v. bao gồm cả các công việc trang trí hoa văn, v.v.
Surattātiādīsu surattaggahaṇena mahānāmavaṇṇataṃ paṭikkhipati, suddhaggahaṇena saṃkiliṭṭhataṃ, siniddhaggahaṇena lūkhataṃ.
In very red and so on, the mention of very red rejects the color of the Mahānāma tree; the mention of pure rejects defilement; the mention of smooth rejects roughness.
Trong các từ surattā, v.v., từ suratta (đỏ tươi) bác bỏ màu của quả mận lớn, từ suddha (thuần khiết) bác bỏ sự ô nhiễm, từ siniddha (mịn màng) bác bỏ sự thô ráp.
Kāmaṃ tassa cakkaratanassa nemimaṇḍalaṃ asandhikaṃva nibbattaṃ, sabbatthakameva pana kevalaṃ pavāḷavaṇṇova na sobhatīti pakaticakkassa sandhiyuttesu ṭhānesu rattajambunadaparikkhataṃ ahosi, taṃ sandhāya vuttaṃ ‘‘sandhīsu panassā’’tiādi.
Although the rim of that wheel-jewel was formed without joints, it is not beautiful if it is only coral-colored throughout; therefore, in the places where a natural wheel has joints, it was adorned with red Jambunada gold. It is with reference to this that it is said, "And in its joints" and so on.
Mặc dù vành bánh xe báu đó được tạo ra không có khớp nối, nhưng vì màu san hô đơn thuần không đẹp ở mọi nơi, nên ở những chỗ có khớp nối của bánh xe thông thường, nó được trang trí bằng vàng Jambunada đỏ. Điều đó được nói đến trong “sandhīsu panassā”, v.v.
Nemimaṇḍalapiṭṭhiyanti nemimaṇḍalassa piṭṭhipadese.
On the surface of the rim means on the surface region of the rim.
Trên mặt vành bánh xe có nghĩa là ở phần mặt của vành bánh xe.
Dasannaṃ dasannaṃ arānamantareti dasannaṃ dasannaṃ arānaṃ antarasamīpe padese.
Between every ten spokes means in the region near the space between every ten spokes.
Giữa mười mười nan hoa có nghĩa là ở vùng gần giữa mười mười nan hoa.
Chiddamaṇḍalacittoti maṇḍalasaṇṭhānachiddavicitto.
Adorned with circular holes means adorned with holes in the shape of circles.
Được trang trí bằng các lỗ hình tròn có nghĩa là được trang trí bằng các lỗ có hình dạng tròn.
Sukusalasamannāhatassāti suṭṭhu kusalena sippinā pahatassa, vāditassāti attho.
Struck by a very skilled craftsman means struck by a very skilled artisan, or played, is the meaning.
Của người đã được khéo léo tác động có nghĩa là của người đã được nghệ nhân khéo léo chạm khắc, tức là đã được chơi.
Vaggūti manoramo rajanīyoti suṇantānaṃ rāguppādako.
Pleasing means delightful; charming means generating passion in those who hear it.
Vaggū có nghĩa là dễ chịu, rajanīyo có nghĩa là gây ra sự say mê cho người nghe.
Kamanīyoti kanto.
Desirable means lovely.
Kamanīyo có nghĩa là đáng yêu.
Samosaritakusumadāmāti olambitasugandhakusumadāmā.
With fragrant flower garlands hanging down means with fragrant flower garlands suspended.
Các vòng hoa rủ xuống có nghĩa là các vòng hoa thơm ngát được treo rủ xuống.
Nemiparikkhepassāti nemipariyantaparikkhepassa.
Of the rim's circumference means of the circumference at the edge of the rim.
Của chu vi vành có nghĩa là của chu vi mép vành.
Nābhipanāḷiyā dvinnaṃ passānaṃ vasena ‘‘dvinnampi nābhipanāḷīna’’nti vuttaṃ.
"Of both navel-grooves" is said with reference to the two sides of the navel-groove.
Do có hai bên của lỗ trục, nên đã nói “của cả hai lỗ trục”.
Ekā eva hi sā panāḷi.
For there is only one such groove.
Thực ra, chỉ có một lỗ trục đó.
Yehīti yehi dvīhi sīhamukhehi.
By which means by which two lion-mouths.
Yehī có nghĩa là bởi hai miệng sư tử đó.
Puna yehīti muttākalāpehi.
Again, by which means by pearl necklaces.
Lại yehī có nghĩa là bởi các chuỗi ngọc trai.
Āgatanandanoti āgato hutvā nandijanano.
Bringing joy upon arrival means having arrived, it generates joy.
Mang đến niềm vui có nghĩa là đến và tạo ra niềm vui.
Āgataṃ vā āgamanaṃ, tena nandatīti āgatanandano.
Or, arrival is that which arrives, and by that it rejoices, hence bringing joy upon arrival.
Hoặc sự đến, do đó mà vui mừng, nên là mang đến niềm vui.
Gamanena socetīti gamanasocano.
It causes sorrow by departure, hence causing sorrow by departure.
Do sự ra đi mà gây đau khổ, nên là gây đau khổ khi ra đi.
Upakappethāti uparūpari kappetha saṃvidahatha, upanethāti attho.
Provide means to arrange, to prepare, to bring forth.
Hãy sắp xếp có nghĩa là hãy sắp xếp, chuẩn bị liên tục, tức là hãy mang đến.
Upaparikkhitvāti hetutopi sabhāvatopi phalatopi diṭṭhadhammikasamparāyikaādīnavatopi vīmaṃsitvā.
Having examined means having investigated from the perspective of cause, nature, result, and the disadvantages in this world and the next.
Sau khi xem xét kỹ lưỡng có nghĩa là sau khi xem xét từ nguyên nhân, từ bản chất, từ kết quả, từ các tai họa hiện tại và tương lai, v.v.
Vibhāventi paññāya atthaṃ vibhūtaṃ karontīti vibhāvino, paññavanto.
They clarify the meaning with wisdom, making it manifest, hence clarifiers, meaning wise ones.
Làm cho ý nghĩa trở nên rõ ràng bằng trí tuệ, nên gọi là vibhāvino, tức là những người có trí tuệ.
Anuyantāti anuvattakā.
Followers means those who follow.
Người đi theo có nghĩa là người tuân theo.
Ogacchamānanti osīdantaṃ.
Sinking means submerging.
Đang chìm xuống có nghĩa là đang lún xuống.
Yojanamattanti vitthārato yojanamattaṃ padesaṃ.
A yojana in extent means a region a yojana in breadth.
Khoảng cách một dojana có nghĩa là một vùng đất rộng một dojana.
Gambhīrabhāvena pana yathā bhūmi dissati, evaṃ ogacchati.
However, due to its depth, the ground is seen as if it were sinking.
Tuy nhiên, do sự sâu thẳm, nó chìm xuống như thể mặt đất có thể nhìn thấy.
Tenāha ‘‘mahāsamuddatala’’ntiādi.
Therefore, it is said, "the bottom of the great ocean" and so on.
Vì thế, đã nói “đáy đại dương”, v.v.
Ante cakkaratanaṃ udakena senāya anajjhottharaṇatthaṃ.
The wheel-jewel at the end is to prevent the army from being submerged by water.
Bánh xe báu ở cuối để quân đội không bị nước nhấn chìm.
258. Haricandanādīhīti ādi-saddena catujjātiyagandhādiṃ saṅgaṇhāti.
258. Haricandanādīhi: The word "ādi" (etc.) includes the four kinds of perfumes and so on.
258. Haricandanādīhi (gỗ đàn hương xanh, v.v.) – với từ vân vân (ādi), bao gồm các loại hương liệu bốn loại, v.v.
Āgamanaṃ cintethāti vadanti cakkavattivattassa pūritatāya paricitattā.
They say, "consider its coming," because the practice of a Universal Monarch has been fulfilled and become familiar.
Họ nói rằng hãy suy nghĩ về sự đến vì đã quen thuộc với việc hoàn thành các bổn phận của một vị Chuyển Luân Vương.
Bhūmiphusanakehi vāladhi, varaṅgaṃ hatthoti imehi ca tīhi, catūhi pādehi cāti sattahi avayavehi ṭhitattā sattapatiṭṭho.
It is "sattapatiṭṭho" (seven-footed) because it stands on seven parts: the tail touching the ground, the excellent trunk, and the four feet.
Vì đứng bằng bảy bộ phận: đuôi chạm đất, vòi, voi (thân voi) và bốn chân nên gọi là sattapatiṭṭho (đứng vững trên bảy điểm).
Itaresaṃ amaccādīnaṃ cintayantānaṃ na āgacchati.
For others, such as the ministers, it does not come even when they think of it.
Đối với những người khác như các vị đại thần, khi suy nghĩ thì nó không đến.
Apanetvāti attano ānubhāvena apanetvā.
Apanetvā means removing them by its own power.
Apanetvā (loại bỏ) nghĩa là loại bỏ bằng thần thông của chính mình.
Gandhameva hi tassa itare hatthino na sahanti.
Indeed, other elephants cannot bear its fragrance.
Vì những con voi khác không chịu được mùi hương của nó.
‘‘Itthiratanaṃ pātubhavatī’’ti vatvā assa pātubhavanākāraṃ dassetuṃ, ‘‘maddarājakulato vā’’tiādi vuttaṃ.
After saying "the woman gem appears," the phrase "or from the Madda royal family" and so on is stated to show the manner of her appearance.
Sau khi nói “Báu Nữ xuất hiện”, để chỉ ra cách xuất hiện của nó, đã nói “hoặc từ dòng dõi vua Madda”, v.v.
Maddaraṭṭhaṃ kira abhirūpānaṃ itthīnaṃ uppattiṭṭhānaṃ.
The Madda country is said to be the birthplace of beautiful women.
Vương quốc Madda được cho là nơi sinh ra những người phụ nữ xinh đẹp.
Saṇṭhānapāripūriyāti hatthapādādisarīrāvayavānaṃ susaṇṭhitatāya.
Saṇṭhānapāripūriyā means due to the perfect formation of the body parts such as hands and feet.
Saṇṭhānapāripūriyā (với sự hoàn hảo về hình dáng) nghĩa là với sự cân đối hoàn hảo của các bộ phận cơ thể như tay, chân, v.v.
Avayavapāripūriyā hi samudāyapāripūrisiddhi.
Indeed, the perfection of the whole is achieved through the perfection of its parts.
Vì sự hoàn hảo của các bộ phận dẫn đến sự hoàn hảo của tổng thể.
Rūpanti sarīraṃ.
Rūpaṃ refers to the body.
Rūpaṃ (sắc) nghĩa là thân thể.
Dassanīyāti surūpabhāvena passitabbayuttā.
Dassanīyā means worthy of being seen due to her beauty.
Dassanīyā (đáng chiêm ngưỡng) nghĩa là đáng được nhìn ngắm vì vẻ đẹp của mình.
Somanassavasena cittaṃ pasādeti yoniso cintentānaṃ kammaphalasaddhāya vasena.
Somanassavasena cittaṃ pasādeti: She gladdens the mind of those who contemplate appropriately, due to their faith in the fruit of kamma.
Somanassavasena cittaṃ pasādeti (làm cho tâm thanh tịnh vì hoan hỷ) đối với những người suy xét một cách đúng đắn, vì đức tin vào quả báo của nghiệp.
Pasādāvahattāti kāraṇavacanena yathā pāsādikatāya vaṇṇapokkharatāsiddhi vuttā, evaṃ dassanīyatāya pāsādikatāsiddhi, abhirūpatāya ca dassanīyatāsiddhi vattabbāti nayaṃ dasseti.
Pasādāvahattā: By this causal statement, it shows the method that just as the perfection of radiance and complexion is stated through attractiveness, so too is the perfection of attractiveness through pleasantness to behold, and the perfection of pleasantness to behold through beauty.
Pasādāvahattā (vì mang lại sự thanh tịnh) – với lời giải thích về nguyên nhân, như đã nói về sự thành tựu của vẻ đẹp và sự tươi tắn do sự thanh tịnh, thì cũng phải nói về sự thành tựu của sự thanh tịnh do tính đáng chiêm ngưỡng, và sự thành tựu của tính đáng chiêm ngưỡng do vẻ đẹp, đó là cách chỉ dẫn.
Paṭilomato vā vaṇṇapokkharatāya pāsādikatāsiddhi, pāsādikatāya dassanīyatāsiddhi, dassanīyatāya abhirūpatāsiddhi yojetabbā.
Alternatively, one should combine: the perfection of pleasantness to behold through radiance and complexion, the perfection of pleasantness to behold through attractiveness, and the perfection of beauty through pleasantness to behold.
Hoặc theo thứ tự ngược lại, sự thành tựu của sự thanh tịnh do vẻ đẹp và sự tươi tắn, sự thành tựu của tính đáng chiêm ngưỡng do sự thanh tịnh, và sự thành tựu của vẻ đẹp do tính đáng chiêm ngưỡng cần được kết hợp.
Evaṃ sarīrasampattivasena abhirūpatādike dassetvā idāni sarīre dosābhāvavasenapi te dassetuṃ, ‘‘abhirūpā vā’’tiādi vuttaṃ.
Thus, having shown beauty and so on by way of physical accomplishment, it is now stated, "abhirūpā vā" (or beautiful) and so on, to show them also by way of the absence of physical defects.
Như vậy, sau khi chỉ ra vẻ đẹp, v.v., nhờ sự hoàn hảo của thân thể, bây giờ để chỉ ra chúng nhờ sự không có khuyết điểm trong thân thể, đã nói “abhirūpā vā” (hoặc xinh đẹp), v.v.
Tattha yathā pamāṇayuttā, evaṃ ārohapariṇāhayogato ca pāsādikā nātidīghatādayo.
Here, just as they are well-proportioned, so too are they attractive due to the appropriate height and circumference, and the absence of excessive height, etc.
Ở đây, những phẩm chất như không quá cao, v.v., là đáng chiêm ngưỡng vì sự cân đối về chiều cao và chu vi, cũng như sự cân đối về kích thước.
Evaṃ manussānaṃ dibbarūpatāsampattipīti ‘‘appattā dibbavaṇṇa’’nti vuttaṃ.
Thus, "appattā dibbavaṇṇaṃ" (not attaining divine radiance) is stated, meaning that humans possess a similar accomplishment to divine beauty.
Như vậy, sự hoàn hảo của vẻ đẹp thần thánh ở con người được nói là “appattā dibbavaṇṇaṃ” (không đạt đến vẻ đẹp thần thánh).
Kāyavipattiyāti sarīradosassa.
Kāyavipattiyā refers to physical defects.
Kāyavipattiyā (của sự khiếm khuyết thân thể) nghĩa là của khuyết điểm thân thể.
Abhāvoti accantameva dūrībhāvo.
Abhāvo means complete absence.
Abhāvo (sự không có) nghĩa là hoàn toàn không có.
Satavihatassāti satakkhattuṃ vihatassa.
Satavihatassā means having been beaten a hundred times.
Satavihatassā (được đánh tơi trăm lần) nghĩa là được đánh tơi trăm lần.
Satavihatassāti ca idaṃ kappāsapicuvasena vuttaṃ, tūlapicuno pana vihananameva natthi.
And satavihatassa is stated in terms of a cotton boll, but there is no beating for a kapok boll.
Và điều này, satavihatassā (được đánh tơi trăm lần) được nói theo nghĩa của bông gòn, nhưng đối với sợi bông thì không có việc đánh tơi.
Kuṅkumatagaraturukkhayavanapupphāni catujjāti.
Saffron, tagara wood, and yavan flowers are the "four kinds".
Nghệ tây, tagara, cây turukkha và hoa yavana là bốn loại.
Tamālatagaraturukkhayavanapupphānīti apare.
Others say Tamāla, tagara wood, and yavan flowers.
Theo một số người khác, đó là tamāla, tagara, cây turukkha và hoa yavana.
Mātugāmo nāma yebhuyyena saṭhajātiko, itthiratanassa pana taṃ natthīti dassetuṃ, ‘‘svāssā’’tiādi vuttaṃ.
Women are generally of a deceitful nature, but to show that the woman gem does not possess that, "svāssā" (she) and so on is stated.
Phụ nữ thường có tính xảo trá, nhưng Báu Nữ không có điều đó, để chỉ ra điều này, đã nói “svāssā” (nàng ấy), v.v.
Guṇāti rūpaguṇā ceva ācāraguṇā ca.
Guṇā refers to both qualities of form and qualities of conduct.
Guṇā (các đức tính) nghĩa là cả đức tính về sắc đẹp và đức tính về hành vi.
Purimakammānubhāvenāti tassā purimakammānubhāvena.
Purimakammānubhāvena means by the power of her past kamma.
Purimakammānubhāvena (do năng lực của nghiệp quá khứ) nghĩa là do năng lực của nghiệp quá khứ của nàng.
Itthiratanassa tabbhāvasaṃvattaniyapurimakammassa ānubhāvena, cakkavattinopi parivārasaṃvattaniyaṃ puññakammaṃ tādisassa phalavisesassa upanissayo hotiyeva.
Indeed, the power of her past kamma, which leads to her being a woman gem, and the meritorious kamma of the Universal Monarch, which leads to his retinue, are conditions for such a special result.
Do năng lực của nghiệp quá khứ đã tạo ra trạng thái của Báu Nữ, và công đức của vị Chuyển Luân Vương đã tạo ra tùy tùng cũng là điều kiện hỗ trợ cho một loại quả đặc biệt như vậy.
Tenāha ‘‘cakkavattino puññaṃ upanissāyā’’ti.
Therefore, it is said: "conditioned by the merit of the Universal Monarch."
Vì vậy, đã nói “cakkavattino puññaṃ upanissāya” (nhờ công đức của vị Chuyển Luân Vương).
Etena sesaratanesupi tesaṃ visesānaṃ tadupanissayatā vibhāvitā evāti daṭṭhabbaṃ.
By this, it should be understood that the specificity of these qualities in the other gems is also conditioned by that merit.
Với điều này, cần hiểu rằng các đặc tính của các báu vật còn lại cũng được giải thích là do điều kiện hỗ trợ đó.
Pubbe ekadesavasena labbhamānapāripūrī rañño cakkavattibhāvūpagamanato paṭṭhāya sabbākārapāripūrā jātā.
The perfection previously obtainable in part has become complete in every aspect from the time the king attained the state of a Universal Monarch.
Sự hoàn hảo từng phần có được trước đây đã trở nên hoàn hảo về mọi mặt kể từ khi nhà vua đạt được trạng thái Chuyển Luân Vương.
260. Kaṭaggaho vuccati jayaggaho sakānaṃ paṇānaṃ kaṭabhāvena atthasiddhivasena saṅgaṇhananti katvā.
260. Kaṭaggaho is called the capture of victory, by gathering the lives of one's own people through the means of the fulfillment of their purpose, which is "kaṭa".
260. Kaṭaggaho được gọi là sự chiến thắng, vì nó bao gồm việc đạt được mục đích bằng cách coi mạng sống của mình là một phần của sự chiến thắng.
Tenāha ‘‘jayaggāhenā’’ti.
Therefore, it is said: "by capturing victory."
Vì vậy, đã nói “jayaggāhena” (bằng sự chiến thắng).
Ekappahārenevāti ekappayogeneva satasahassāni adhigaccheyyāti yojanā.
Ekappahāreneva: The connection is "one should acquire hundreds of thousands with a single effort."
Ekappahārenevā (chỉ với một lần tấn công) nghĩa là chỉ với một lần nỗ lực có thể đạt được hàng trăm ngàn (vàng).
Sesaṃ vuttanayattā suviññeyyameva.
The rest is easily understood by the method already stated.
Phần còn lại là dễ hiểu vì đã được giải thích theo cách tương tự.