Imissā paṭhamamahāsaṅgītiyā vattamānāya vinayasaṅgahāvasāne suttantapiṭake ādinikāyassa ādisuttaṃ brahmajālaṃ pucchantena āyasmatā mahākassapena – ‘‘brahmajālaṃ, āvuso ānanda, kattha bhāsita’’nti, evamādivuttavacanapariyosāne yattha ca bhāsitaṃ, yañcārabbha bhāsitaṃ, taṃ sabbaṃ pakāsento āyasmā ānando evaṃ me sutantiādimāha.
When this First Great Saṅgīti was taking place, at the end of the Vinaya collection, the Venerable Ānanda, revealing everything concerning where the Brahmajāla Sutta (the first sutta of the first nikāya in the Suttanta Piṭaka) was spoken and with reference to whom it was spoken, stated “Evaṃ me sutaṃ” (Thus have I heard) and so on, after the Venerable Mahākassapa had asked, “Venerable Ānanda, where was the Brahmajāla spoken?” and so on, finishing his words.
Khi Đại Kết Tập lần thứ nhất này đang diễn ra, vào cuối phần kết tập Luật, sau khi Tôn giả Mahākassapa hỏi về kinh Phạm Võng, bài kinh đầu tiên của Bộ Nikāya đầu tiên trong Tạng Kinh, bằng cách nói “Này Hiền giả Ānanda, kinh Phạm Võng được thuyết ở đâu?” v.v., và khi những lời này kết thúc, Tôn giả Ānanda đã nói “Như vầy tôi nghe” v.v., để công bố tất cả những gì đã được thuyết và về ai.
Tena vuttaṃ ‘‘brahmajālassāpi evaṃ me sutantiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādī’’ti.
Therefore, it is said, “The nidāna (introduction) of the Brahmajāla, beginning with ‘Evaṃ me sutaṃ,’ was spoken by the Venerable Ānanda during the First Great Saṅgīti.”
Do đó, đã nói rằng “Phần mở đầu của kinh Phạm Võng, bắt đầu bằng ‘Như vầy tôi nghe,’ đã được Tôn giả Ānanda nói trong thời điểm Đại Kết Tập lần thứ nhất.”
Atthato pana evaṃ-saddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāranidassanāvadhāraṇādianekatthappabhedo.
In terms of meaning, the word evaṃ has many distinctions of meaning, such as simile, instruction, praise, blame, acceptance of a statement, manner, indication, and emphasis.
Về ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như ví dụ, chỉ dẫn, tán thán, chỉ trích, chấp nhận lời nói, cách thức, minh họa, và khẳng định.
Tathāhesa – ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti (dha. pa. 53) evamādīsu upamāyaṃ āgato.
Thus, it appears in similes in phrases like “evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu (One thus born a mortal should do much good)” and so on.
Quả thật, nó xuất hiện với nghĩa ví dụ trong các câu như “Với một người đã sinh ra như vậy, phải làm nhiều việc thiện” (Dhp. 53).
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In instructions, in phrases like “evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ (Thus should you go forward, thus should you retreat)” and so on.
Với nghĩa chỉ dẫn trong các câu như “ Như vậy ngươi phải tiến tới, như vậy ngươi phải lùi lại” (A. IV, 122).
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In praise, in phrases like “Evametaṃ bhagavā, evametaṃ sugatā (So it is, Blessed One; so it is, Fortunate One)” and so on.
Với nghĩa tán thán trong các câu như “ Đúng vậy, bạch Thế Tôn, đúng vậy, bạch Thiện Thệ” (A. III, 66).
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In blame, in phrases like “Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī (Indeed, this wretch speaks praise of that shaven-headed ascetic on every occasion)” and so on.
Với nghĩa chỉ trích trong các câu như “ Như vậy là người tiện nữ này nói lời ca ngợi vị Sa-môn đầu trọc đó ở bất cứ đâu” (S. I, 187).
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In acceptance of a statement, in phrases like “Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ (The bhikkhus, indeed, replied to the Blessed One, ‘Yes, venerable sir’),” and so on.
Với nghĩa chấp nhận lời nói trong các câu như “ Thưa vâng, bạch Thế Tôn, các Tỳ-khưu ấy đã vâng lời Thế Tôn” (M. I, 1).
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In manner, in phrases like “Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī (Indeed, venerable sir, I understand the Dhamma taught by the Blessed One in this manner)” and so on.
Với nghĩa cách thức trong các câu như “ Như vậy, bạch Thế Tôn, con hiểu pháp được Thế Tôn thuyết” (M. I, 398).
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha.
“Come, young man, approach the recluse Ānanda, and having approached, ask the recluse Ānanda in my name about his freedom from serious illness, his freedom from minor ailments, his lightness of body, his strength, and his dwelling at ease.
“Này thanh niên, hãy đi đến nơi Sa-môn Ānanda đang ở, sau khi đến đó, hãy thay lời ta hỏi thăm Sa-môn Ānanda về sự không bệnh tật nặng, không đau đớn nhỏ, sự nhẹ nhàng trong đi đứng, sức khỏe, và sự an trú thoải mái.
‘‘Subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’’ti.
‘The young man Subha, son of Todeyya, asks about Venerable Ānanda’s freedom from serious illness, his freedom from minor ailments, his lightness of body, his strength, and his dwelling at ease.’
Thanh niên Subha, con trai của Todeyya, hỏi thăm Tôn giả Ānanda về sự không bệnh tật nặng, không đau đớn nhỏ, sự nhẹ nhàng trong đi đứng, sức khỏe, và sự an trú thoải mái.”
‘‘Evañca vadehi, sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’tiādīsu (dī. ni. 1.445) nidassane.
And say this: ‘May Venerable Ānanda, out of compassion, please approach the residence of the young man Subha, son of Todeyya.’”—in such instances of demonstration.
“Và hãy nói như thế này: ‘Xin Tôn giả Ānanda vì lòng từ bi mà hãy đến tư gia của thanh niên Subha, con trai của Todeyya’.” Trong các ví dụ như vậy, từ evaṃ được dùng để chỉ sự trình bày.
‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti?
“What do you think, Kālāmas? Are these things wholesome or unwholesome?”
“Các người nghĩ sao, này các người Kālāma, những pháp này là thiện hay bất thiện?”
Akusalā, bhante.
“Unwholesome, venerable sir.”
“Bạch Thế Tôn, là bất thiện.”
Sāvajjā vā anavajjā vāti?
“Blameworthy or blameless?”
“Có tội hay không có tội?”
Sāvajjā, bhante.
“Blameworthy, venerable sir.”
“Bạch Thế Tôn, có tội.”
Viññugarahitā vā viññuppasatthā vāti?
“Censured by the wise or praised by the wise?”
“Bị người trí khiển trách hay được người trí tán thán?”
Viññugarahitā, bhante.
“Censured by the wise, venerable sir.”
“Bạch Thế Tôn, bị người trí khiển trách.”
Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti?
“When undertaken and practiced, do they lead to harm and suffering or not? How does it seem to you in this matter?”
“Khi được thực hành và chấp giữ, chúng có đưa đến bất lợi và khổ đau hay không? Các người nghĩ sao về điều này?”
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
“When undertaken and practiced, venerable sir, they lead to harm and suffering. That is how it seems to us in this matter.”—in such instances of ascertainment.
“Bạch Thế Tôn, khi được thực hành và chấp giữ, chúng đưa đến bất lợi và khổ đau. Chúng con nghĩ về điều này như vậy.” Trong các ví dụ như vậy, từ evaṃ được dùng để chỉ sự xác định.
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Thus, here, this term should be understood in the senses of manner, demonstration, and ascertainment.
Do đó, từ này ở đây nên được hiểu theo nghĩa của cách thức, sự trình bày và sự xác định.
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.223).
In the sense of ascertainment—‘‘Among my monastic disciples who are learned, Ānanda is foremost; among those with insight, among those with mindfulness, among those with resolve, among those who attend, Ānanda is foremost.”
Theo nghĩa xác định – “Này các Tỳ-khưu, trong số các Tỳ-khưu đệ tử của ta, những người đa văn, Ānanda là bậc tối thắng. Trong số những người có trí tuệ, có niệm, có dũng lực, những người hầu hạ, Ānanda là bậc tối thắng.”
Evaṃ bhagavatā – ‘‘āyasmā ānando atthakusalo, dhammakusalo, byañjanakusalo, niruttikusalo, pubbāparakusalo’’ti (a. ni. 5.169).
Thus, by the Blessed One, “Venerable Ānanda is skilled in meaning, skilled in Dhamma, skilled in phrasing, skilled in language, skilled in sequence.”
Như vậy, Đức Thế Tôn đã nói: “Tôn giả Ānanda thiện xảo về ý nghĩa, thiện xảo về Pháp, thiện xảo về từ ngữ, thiện xảo về ngữ pháp, thiện xảo về trước sau.”
Evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti – ‘evaṃ me sutaṃ’, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
And thus, by the Dhamma-general, by displaying his power of retention in accordance with the praised state, he generates the desire to hear in beings, thinking: ‘Thus have I heard,’ and that Sutta should be understood as exactly so, neither deficient nor excessive in meaning or phrasing, and in no other way.
Và như vậy, Đại tướng Pháp (Sāriputta) đã tán thán, phù hợp với sự tán thán, để tạo ra ý muốn lắng nghe cho chúng sinh bằng cách trình bày sức mạnh ghi nhớ của mình: ‘ evaṃ me sutaṃ’ (Như vầy tôi nghe), và điều đó không thiếu, không thừa, không sai lệch về ý nghĩa hay từ ngữ, mà phải được hiểu đúng như vậy, không khác.
Me-saddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me được thấy trong ba nghĩa.
Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho.
For instance, in phrases like ‘‘Food chanted in verse is not to be eaten by me,” the meaning is ‘by me’.
Như trong “ gāthābhigītaṃ me abhojaneyya” (Thức ăn được tụng bằng kệ không nên dùng cho tôi), nó có nghĩa là ‘bởi tôi’ (mayā).
‘‘Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In phrases like ‘‘It would be good, venerable sir, if the Blessed One would teach me the Dhamma in brief,” the meaning is ‘to me’.
Như trong “ Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetū” (Bạch Thế Tôn, xin Thế Tôn hãy thuyết Pháp vắn tắt cho tôi), nó có nghĩa là ‘cho tôi’ (mayhaṃ).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like ‘‘Be, O monastics, heirs of Dhamma to me,” the meaning is ‘my’.
Như trong “ Dhammadāyādā me, bhikkhave, bhavathā” (Này các Tỳ-khưu, hãy là những người thừa kế Pháp của tôi), nó có nghĩa là ‘của tôi’ (mama).
Idha pana mayā sutanti ca, mama sutanti ca atthadvaye yujjati.
Here, however, it is appropriate in two meanings: ‘it was heard by me’ and ‘it is my hearing’.
Ở đây, nó phù hợp với hai nghĩa: ‘tôi đã nghe’ (mayā sutaṃ) và ‘của tôi là điều đã nghe’ (mama sutaṃ).
Sutanti ayaṃ suta-saddo saupasaggo ca anupasaggo ca – gamanavissutakilinna-upacitānuyoga-sotaviññeyya-sotadvārānusāra-viññātādianekatthappabhedo, tathā hissa ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
The word suta—this word suta, both with and without prefix—has many distinctions of meaning such as going, famous, wet, accumulated, exertion, audible by ear-consciousness, known through the ear-door, understood; for instance, in phrases like ‘‘he went into the army,” the meaning is ‘going’.
Từ suta này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như đi, nổi tiếng, ẩm ướt, tích lũy, chuyên tâm, nhận biết bằng tai, nhận biết qua cửa tai, đã biết, v.v. Như trong “ senāya pasuto”, nó có nghĩa là ‘người đi’.
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like ‘‘one who has heard the Dhamma and sees,” the meaning is ‘one whose Dhamma is famous’.
Trong “ Sutadhammassa passato”, nó có nghĩa là ‘người có Pháp nổi tiếng’.
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho.
In phrases like ‘‘one who is wet to one who is wet,” the meaning is ‘wet to wet’.
Trong “ Avassutā avassutassā”, nó có nghĩa là ‘người bị ướt/không bị ướt’ (bởi dục vọng).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like ‘‘a considerable amount of merit has been accumulated by you,” the meaning is ‘accumulated’.
Trong “ Tumhehi puññaṃ pasutaṃ anappaka”, nó có nghĩa là ‘đã tích lũy’.
‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like ‘‘the wise ones who are devoted to jhāna,” the meaning is ‘devoted to jhāna’.
Trong “ Ye jhānapasutā dhīrā”, nó có nghĩa là ‘những người chuyên tâm thiền định’.
‘Diṭṭhaṃ sutaṃ muta’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like ‘seen, heard, sensed,’ the meaning is ‘audible by ear-consciousness’.
Trong “ Diṭṭhaṃ sutaṃ muta”, nó có nghĩa là ‘những gì được nhận biết bằng tai’.
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like ‘‘one who retains what is heard, one who has stored what is heard,” the meaning is ‘one who retains what is known through the ear-door’.
Trong “ Sutadharo sutasannicayo”, nó có nghĩa là ‘người ghi nhớ những gì đã được nhận biết qua cửa tai’.
Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vāti attho.
Here, however, its meaning is ‘retained through the ear-door’ or ‘retention’.
Ở đây, nó có nghĩa là ‘đã được ghi nhớ qua cửa tai’ hoặc ‘sự ghi nhớ’.
‘Me’ saddassa hi ‘mayā’ti atthe sati ‘evaṃ mayā sutaṃ’ sotadvārānusārena upadhāritanti yujjati.
Indeed, if the word ‘me’ has the meaning ‘by me,’ then ‘thus it was heard by me, retained through the ear-door’ is appropriate.
Nếu từ ‘me’ có nghĩa là ‘bởi tôi’ (mayā), thì ‘ evaṃ mayā sutaṃ’ có nghĩa là ‘tôi đã nghe như vậy, đã được ghi nhớ qua cửa tai’.
‘Mamā’ti atthe sati evaṃ mama sutaṃ sotadvārānusārena upadhāraṇanti yujjati.
If it has the meaning ‘my,’ then ‘thus is my hearing, retention through the ear-door’ is appropriate.
Nếu từ ‘me’ có nghĩa là ‘của tôi’ (mama), thì ‘ evaṃ mama sutaṃ’ có nghĩa là ‘sự ghi nhớ của tôi là như vậy, đã được ghi nhớ qua cửa tai’.
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Thus, in these three words, evaṃ demonstrates the function of consciousness such as ear-consciousness.
Như vậy, trong ba từ này, evaṃ là sự trình bày về chức năng của thức (viññāṇa), như nhĩ thức (sotaviññāṇa) và các thức khác.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me demonstrates the individual endowed with the aforementioned consciousness.
Me là sự trình bày về cá nhân sở hữu thức đã nói.
Sutanti assavanabhāvapaṭikkhepato anūnādhikāviparītaggahaṇanidassanaṃ.
Sutaṃ demonstrates the non-deficient, non-excessive, and non-perverted grasping, by refuting the state of not having heard.
Suta là sự trình bày về sự thấu hiểu không thiếu, không thừa, không sai lệch, bằng cách bác bỏ trạng thái không nghe.
Tathā evanti tassā sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ.
Likewise, evaṃ expresses the state of that consciousness-process, which occurred through the ear-door, operating in various ways with regard to its object.
Tương tự, evaṃ là sự công bố về trạng thái vận hành của tiến trình thức (viññāṇavīthi) đã diễn ra qua cửa tai, vận hành trên đối tượng theo nhiều cách khác nhau.
Meti attappakāsanaṃ.
Me expresses oneself.
Me là sự công bố về bản thân.
Sutanti dhammappakāsanaṃ.
Sutaṃ expresses the Dhamma.
Suta là sự công bố về Pháp.
Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
Here is the summary: “No other task was performed by me with the consciousness-process operating in various ways regarding its object; rather, this task was performed, this Dhamma was heard.”
Tóm lại ở đây là: “Bởi tôi, với tiến trình thức đã vận hành trên đối tượng theo nhiều cách khác nhau, không có gì khác được thực hiện, mà điều này đã được thực hiện, Pháp này đã được nghe.”
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
Therein, evaṃ and me are designations that do not exist in the ultimate sense of reality.
Trong đó, evaṃ và me là những khái niệm không tồn tại theo nghĩa chân đế (paramattha).
Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha?
For what here exists in the ultimate sense that could be designated as evaṃ or me?
Thật vậy, có gì ở đây tồn tại theo chân đế mà có thể được gọi là evaṃ hay me?
Sutanti vijjamānapaññatti.
Sutaṃ is an existing designation.
Suta là một khái niệm tồn tại.
Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For that which is perceived here by the ear, that truly exists in the ultimate sense.
Vì những gì đã được nhận biết bằng tai ở đây là tồn tại theo chân đế.
Tathā ‘eva’nti ca, meti ca, taṃ taṃ upādāya vattabbato upādāpaññatti.
Likewise, evaṃ and me are conventional designations based on referring to this and that.
Tương tự, evaṃ và me là những khái niệm quy ước (upādāpaññatti) vì chúng được nói đến dựa trên những điều đó.
‘Suta’nti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a comparative designation, being spoken in comparison to what is seen and so forth.
Suta là một khái niệm so sánh (upanidhāpaññatti) vì nó được nói đến bằng cách so sánh với những gì đã thấy, v.v.
Ettha ca evanti vacanena asammohaṃ dīpeti.
And here, by the word evaṃ, he indicates non-confusion.
Ở đây, với từ evaṃ, vị ấy biểu thị sự không lầm lẫn.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For one who is confused is not capable of various kinds of penetration.
Vì người lầm lẫn không thể thâm nhập theo nhiều cách khác nhau.
‘Suta’nti vacanena sutassa asammosaṃ dīpeti.
By the word sutaṃ, he indicates non-forgetfulness of what was heard.
Với từ suta, vị ấy biểu thị sự không quên những gì đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For one whose hearing has been forgotten does not acknowledge, after some time, that it was heard by me.
Vì người đã quên những gì đã nghe sẽ không tuyên bố sau một thời gian rằng ‘tôi đã nghe’.
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, his wisdom is perfected by non-confusion, and his mindfulness is perfected by non-forgetfulness.
Như vậy, nhờ sự không lầm lẫn mà trí tuệ (paññā) được thành tựu, và nhờ sự không quên mà niệm (sati) được thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā.
Among those, by mindfulness preceded by wisdom, there is the ability to grasp and remember the syllables; by wisdom preceded by mindfulness, there is the ability to penetrate the meaning.
Trong đó, khả năng ghi nhớ văn tự là nhờ niệm có tuệ dẫn đầu, khả năng thấu hiểu ý nghĩa là nhờ tuệ có niệm dẫn đầu.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
Due to the combination of these two abilities, through the ability to guard the Dhamma treasury, complete with meaning and syllables, there is the accomplishment of being a Dhamma treasurer.
Nhờ sự kết hợp của hai khả năng đó, thành tựu của vị Thủ kho Pháp (Dhammabhaṇḍāgārika) là khả năng bảo hộ kho tàng Pháp (Dhammakosa) đầy đủ cả ý nghĩa (attha) và văn tự (byañjana).
Aparo nayo, evanti vacanena yoniso manasikāraṃ dīpeti.
Another method: By the word "evaṃ" (thus), he indicates proper attention (yoniso manasikāra).
Một cách khác, với từ “evaṃ” (như vầy), Ngài Ānanda chỉ ra sự chú tâm chân chánh (yoniso manasikāra).
Ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
For one who attends improperly, there is no penetration of various kinds.
Vì người không chú tâm chân chánh thì không thể thấu hiểu nhiều khía cạnh khác nhau.
Sutanti vacanena avikkhepaṃ dīpeti, vikkhittacittassa savanābhāvato.
By the word "sutaṃ" (heard), he indicates non-distraction, for one with a distracted mind does not hear.
Với từ “sutaṃ” (tôi đã nghe), Ngài chỉ ra sự không tán loạn, vì người tâm tán loạn thì không thể lắng nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Indeed, a person with a distracted mind, even when addressed with all good fortune, says, "I have not heard; please speak again."
Quả thật, một người tâm tán loạn, dù được thuyết giảng mọi điều tốt đẹp, vẫn nói: “Tôi chưa nghe, xin hãy nói lại.”
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by proper attention (yoniso manasikāra), he accomplishes right self-application and having done merit in the past, for these are absent in one who has not applied himself rightly or has not done merit in the past.
Ở đây, với sự chú tâm chân chánh, Ngài Ānanda thành tựu việc tự mình khéo đặt tâm (attasammāpaṇidhi) và những công đức đã làm trong quá khứ (katapuññatā).
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti.
By non-distraction, he accomplishes listening to the Saddhamma and reliance on good people.
Vì nếu không khéo đặt tâm hoặc không có công đức đã làm trong quá khứ thì sẽ không có được điều đó.
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthīti.
For a distracted person cannot hear, nor is there hearing for one who does not associate with good people.
Với sự không tán loạn, Ngài thành tựu việc nghe Chánh Pháp (saddhammassavana) và nương tựa bậc Chân nhân (sappurisūpanissaya). Bởi lẽ, người tâm tán loạn không thể lắng nghe, và người không nương tựa bậc Chân nhân thì không có sự lắng nghe.
Aparo nayo, yasmā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddesoti vuttaṃ, so ca evaṃ bhaddako ākāro na sammāappaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakenākārena pacchimacakkadvayasampattimattano dīpeti.
Another method: Because, as stated, "evaṃ" indicates various ways of proceeding for the mental continuum of a person, through which the grasp of various meanings and expressions occurs, and such an excellent manner does not exist for one whose mind is not rightly directed or who has not done meritorious deeds in the past; therefore, by this excellent manner, by "evaṃ," he indicates the accomplishment of the latter two wheels of fortune for himself.
Một cách khác, vì từ “evaṃ” chỉ ra sự thấu hiểu nhiều khía cạnh khác nhau trong dòng tâm thức của một người, và sự thấu hiểu đó không thể có ở người không khéo đặt tâm hoặc không có công đức đã làm trong quá khứ, nên với từ “evaṃ” này, Ngài Ānanda chỉ ra sự thành tựu hai yếu tố sau cùng của Bốn yếu tố hỗ trợ (cakkadvaya) của mình.
Sutanti savanayogena purimacakkadvayasampattiṃ.
By "sutaṃ," he indicates the accomplishment of the former two wheels of fortune through the act of hearing.
Với từ “sutaṃ” (tôi đã nghe), Ngài chỉ ra sự thành tựu hai yếu tố đầu tiên của Bốn yếu tố hỗ trợ, thông qua việc lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no hearing for one who lives in an unsuitable place or who lacks reliance on good people.
Vì người sống ở nơi không thích hợp hoặc không có sự nương tựa bậc Chân nhân thì không có sự lắng nghe.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhisiddhā hoti, purimacakkadvayasiddhiyā payogasuddhi, tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
Thus, by the accomplishment of the latter two wheels, purity of intention is accomplished; by the accomplishment of the former two wheels, purity of practice. And by that purity of intention, the attainment of clear realization is accomplished; by purity of practice, the attainment of scriptural knowledge.
Như vậy, nhờ sự thành tựu hai yếu tố sau cùng, sự thanh tịnh về ý chí (āsayasuddhi) của Ngài được thành tựu; nhờ sự thành tựu hai yếu tố đầu tiên, sự thanh tịnh về thực hành (payogasuddhi) được thành tựu. Nhờ sự thanh tịnh về ý chí đó, sự tinh thông về chứng đắc (adhigamabyattisiddhi) được thành tựu; nhờ sự thanh tịnh về thực hành, sự tinh thông về giáo điển (āgamabyattisiddhi) được thành tựu.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato yoniso manasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento – ‘‘evaṃ me suta’’ntiādimāha.
Therefore, the words of one whose practice and intention are pure and who is accomplished in both scriptural knowledge and realization, like the dawn preceding the rising of the sun, and like proper attention preceding skillful action, are worthy to be the preface to the word of the Blessed One. Thus, establishing the introduction in its proper place, he said, "Evaṃ me sutaṃ" (Thus have I heard), etc.
Do đó, lời nói của một vị có ý chí và thực hành thanh tịnh, thành tựu cả giáo điển và chứng đắc, xứng đáng là lời dẫn đầu lời dạy của Đức Thế Tôn, giống như rạng đông dẫn đường cho mặt trời mọc, và sự chú tâm chân chánh dẫn đường cho thiện nghiệp. Vì vậy, Ngài Ānanda đã đặt câu dẫn nhập ở vị trí thích hợp – “Evaṃ me sutaṃ” (Như vầy tôi đã nghe), v.v.
Aparo nayo, ‘eva’nti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: By the word "evaṃ," which indicates penetration of various kinds, he reveals the presence of his attainment of paṭisambhidā of meaning and analytical knowledge of expression.
Một cách khác, với từ “evaṃ” này, chỉ ra sự thấu hiểu nhiều khía cạnh khác nhau, Ngài Ānanda chỉ ra sự hiện hữu của sự thành tựu về Thắng giải Nghĩa (atthapaṭisambhidā) và Thắng giải Biện tài (paṭibhānapaṭisambhidā) của mình.
‘Suta’nti iminā sotabbappabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
By "sutaṃ," which indicates penetration of the distinction of what is to be heard, he reveals the presence of his attainment of paṭisambhidā of Dhamma and language.
Với từ “sutaṃ” này, chỉ ra sự thấu hiểu các loại pháp cần nghe, Ngài chỉ ra sự hiện hữu của sự thành tựu về Thắng giải Pháp (dhammapaṭisambhidā) và Thắng giải Ngôn ngữ (niruttipaṭisambhidā).
‘Eva’nti ca idaṃ yoniso manasikāradīpakaṃ vacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā, diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And by speaking the word "evaṃ," which indicates proper attention, he reveals, "These Dhammas have been reflected upon by me mentally, and thoroughly penetrated by insight."
Khi nói từ “evaṃ” này, chỉ ra sự chú tâm chân chánh, Ngài Ānanda chỉ ra rằng: “Những pháp này tôi đã quán xét bằng tâm, đã thấu hiểu rõ ràng bằng tuệ tri.”
‘Suta’nti idaṃ savanayogadīpakaṃ vacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By speaking the word "sutaṃ," which indicates the act of hearing, he reveals, "Many Dhammas have been heard by me, retained, and practiced orally."
Khi nói từ “sutaṃ” này, chỉ ra sự lắng nghe, Ngài Ānanda chỉ ra rằng: “Nhiều pháp tôi đã nghe, đã ghi nhớ, đã thực hành bằng lời nói.”
Tadubhayenāpi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, showing the completeness of meaning and syllables, he generates respect for listening.
Bằng cả hai từ đó, Ngài Ānanda chỉ ra sự viên mãn của ý nghĩa và văn tự, đồng thời khuyến khích sự chú tâm vào việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti, tasmā ādaraṃ janetvā sakkaccaṃ ayaṃ dhammo sotabboti.
For one who does not listen respectfully to Dhamma complete with meaning and syllables is excluded from great benefit. Therefore, one should listen to this Dhamma respectfully and attentively.
Vì người không lắng nghe Pháp một cách kính trọng, dù Pháp đó đầy đủ ý nghĩa và văn tự, sẽ bị thiệt thòi lớn về lợi ích. Do đó, Ngài Ānanda khuyến khích rằng Pháp này cần được lắng nghe một cách kính trọng và cẩn thận.
‘‘Evaṃ me suta’’nti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati.
Furthermore, by the entire statement "Evaṃ me sutaṃ," Venerable Ānanda, by not claiming the Dhamma taught by the Tathāgata as his own, transcends the level of ignoble persons.
Hơn nữa, với toàn bộ câu “Evaṃ me sutaṃ” này, Tôn giả Ānanda đã vượt qua cảnh giới của người không chân chánh (asappurisabhūmi), bằng cách không coi Pháp do Đức Như Lai thuyết giảng là của mình.
Sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
By declaring himself a disciple, he enters the level of noble persons.
Ngài bước vào cảnh giới của người chân chánh (sappurisabhūmi) bằng cách tự nhận mình là một đệ tử (sāvaka).
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Thus, he raises the mind from unwholesome Dhamma and establishes the mind in wholesome Dhamma.
Như vậy, Ngài đưa tâm thoát khỏi tà pháp và thiết lập tâm trong Chánh Pháp.
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By showing that "this was merely heard by me, it is indeed the word of the Blessed One himself," he frees himself, indicates the Teacher, establishes the word of the Buddha, and sets up the guidance of the Dhamma.
Bằng cách chỉ ra rằng: “Đây chỉ là điều tôi đã nghe, là lời của chính Đức Thế Tôn,” Ngài tự giải thoát mình, chỉ rõ vị Đạo Sư, truyền bá lời dạy của Đức Phật, và thiết lập nguyên tắc của Pháp (Dhammanetti).
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto – ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kātabbā’’ti sabbesaṃ devamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādeti.
Moreover, by stating "Evaṃ me sutaṃ," not claiming to have produced it himself, and by revealing the previous utterance, he declares: "This word was received by me directly from that Blessed One who is skilled in the four intrepidities, who possesses the ten powers, who stands in the position of the chief, who utters the lion's roar, who is the highest of all beings, the Lord of Dhamma, the King of Dhamma, the Master of Dhamma, the Lamp of Dhamma, the Refuge of Dhamma, the great Cakkavatti of the Saddhamma, the Perfectly Self-Enlightened One. In this Dhamma, regarding its meaning, doctrine, word, or expression, no doubt or perplexity should be entertained." Thus, he destroys the disbelief of all devas and humans in this Dhamma and produces the blessing of faith.
Hơn nữa, với câu “Evaṃ me sutaṃ” (Như vầy tôi đã nghe), Ngài Ānanda không nhận mình là người đã tạo ra Pháp, mà Ngài giải thích lời dạy trước đó rằng: “Đây là lời của Đức Thế Tôn, bậc đã thành tựu Tứ Vô Sở Úy (catuvesārajja), nắm giữ Thập Lực (dasabala), đứng vững ở vị trí Tối Thượng (āsabhaṭṭhāna), rống tiếng sư tử (sīhanāda), tối thượng trong tất cả chúng sinh, là Pháp Chủ (dhammissara), Pháp Vương (dhammarāja), Pháp Tôn (dhammādhipati), Pháp Đăng (dhammadīpa), Pháp Quy (dhammasaraṇa), Chuyển Luân Thánh Vương của Chánh Pháp tối thượng (saddhammavaracakkavatti), là Bậc Chánh Đẳng Giác (sammāsambuddha), lời này tôi đã trực tiếp tiếp nhận từ Ngài. Không nên có bất kỳ nghi ngờ hay do dự nào về ý nghĩa, Pháp, từ ngữ hay văn tự trong lời dạy này.” Như vậy, Ngài tiêu diệt sự bất tín (assaddhiya) và phát sinh sự thành tựu về tín (saddhāsampada) cho tất cả chư thiên và loài người đối với Pháp này.
Tenetaṃ vuccati –
Therefore, it is said:
Vì thế, có câu nói:
Tathā hissa – ‘‘appevanāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Thus, in such passages as "Perhaps we may approach tomorrow, depending on the time and opportunity," it means conjunction.
Như trong câu: “Appevanāma svepi upasaṅkameyyāma kālañca samayañca upādāyā” (Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ), v.v., nghĩa là sự hội tụ (samavāya).
‘‘Ekova kho bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
In such passages as "There is indeed, bhikkhus, one moment and one opportunity for the practice of the holy life," it means moment.
Trong câu: “Ekova kho bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā” (Này các Tỳ-kheo, chỉ có một khoảnh khắc, một thời điểm để sống Phạm hạnh), v.v., nghĩa là khoảnh khắc (khaṇa).
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In such passages as "the hot season, the stifling season," it means time.
Trong câu: “Uṇhasamayo pariḷāhasamayo” (Thời tiết nóng bức, thời tiết oi ả), v.v., nghĩa là thời gian (kāla).
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In such passages as "A great assembly in the forest," it means collection.
Trong câu: “Mahāsamayo pavanasmi” (Đại hội lớn trong rừng), v.v., nghĩa là tập hợp (samūha).
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati, bhaddāli nāma bhikkhu satthusāsane sikkhāya aparipūrakārī’ti.
"Also, Bhaddāli, this cause was not penetrated by you: 'The Blessed One is dwelling in Sāvatthī; the Blessed One will know me as 'the bhikkhu named Bhaddāli, who did not complete the training in the Teacher's Dispensation.' "
Trong câu: “Samayopi kho te, Bhaddāli, appaṭividdho ahosi, Bhagavā kho Sāvatthiyaṃ viharati, Bhagavāpi maṃ jānissati, Bhaddāli nāma bhikkhu Satthusāsane sikkhāya aparipūrakārī” (Này Bhaddāli, nguyên nhân đó cũng không được ông thấu hiểu. Đức Thế Tôn đang trú tại Sāvatthī. Đức Thế Tôn cũng sẽ biết về ta: ‘Tỳ-kheo tên Bhaddāli này đã không hoàn thành giới học trong Giáo Pháp của Đạo Sư’).
Ayampi kho, te bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
"Indeed, Bhaddāli, this cause also was not penetrated by you." In such passages, it means cause.
“Ayampi kho, te Bhaddāli, samayo appaṭividdho ahosī” (Này Bhaddāli, nguyên nhân này cũng không được ông thấu hiểu), v.v., nghĩa là nguyên nhân (hetu).
‘‘Tena kho pana samayena uggahamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In such passages as "Now at that time, the wandering ascetic Uggāhamāna, son of Samaṇamuṇḍikā, was dwelling in the Ekasālaka, Mallikā’s park, near Tindukācīra, among those who held various views," it means view.
Trong câu: “Tena kho pana samayena Uggahamāno Paribbājako Samaṇamuṇḍikāputto samayappavādake Tindukācīre Ekasālake Mallikāya ārāme paṭivasatī” (Vào lúc bấy giờ, du sĩ Uggahamāna, con trai của Samaṇamuṇḍikā, đang trú tại khu vườn của Mallikā, ở Ekasālaka, gần Tindukācīra, nơi các học thuyết được tranh luận), v.v., nghĩa là quan điểm (diṭṭhi).
Ādīsu paṭilābho.
In such passages, it means acquisition.
Trong các câu trên, nghĩa là đắc được (paṭilābha).
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (a. ni. 7.9) pahānaṃ.
In such passages as "By the right penetration of conceit, he made an end of suffering," it means abandonment.
Trong câu: “Sammā mānābhisamayā antamakāsi dukkhassā” (Do thấu hiểu đúng đắn về ngã mạn, đã chấm dứt khổ đau), v.v., nghĩa là đoạn trừ (pahāna).
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. 108) paṭivedho.
In such passages as "Suffering means the sense of affliction, the sense of being conditioned, the sense of torment, the sense of change, the sense of penetration," it means penetration.
Trong câu: “Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho” (Khổ có nghĩa là bị áp bức, có nghĩa là được tạo tác, có nghĩa là bị thiêu đốt, có nghĩa là biến hoại, có nghĩa là được thấu hiểu), v.v., nghĩa là thấu hiểu (paṭivedha).
Idha panassa kālo attho.
Here, however, its meaning is "time."
Ở đây, nghĩa của nó là thời gian (kāla).
Tena saṃvaccharautumāsaḍḍhamāsarattidivapubbaṇhamajjhanhikasāyanhapaṭhamamajjhi-mapacchimayāmamuhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
By this, it indicates one time among the distinctions of time, such as years, seasons, months, half-months, nights, days, forenoons, noons, afternoons, first, middle, and last watches, and muhuttas.
Với từ đó, Ngài chỉ ra rằng “một thời điểm” (ekaṃ samayaṃ) là một trong những thời điểm được phân loại như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge vā divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Though all suttas, in whichever year, season, month, fortnight, night, or day part they were spoken, were well-known and well-distinguished by the Elder's wisdom,
Mặc dù tất cả các bài kinh được thuyết giảng vào những năm, mùa, tháng, nửa tháng, phần đêm hoặc phần ngày khác nhau trong các thời điểm như đã nêu trên đều được vị Trưởng lão biết rõ và sắp xếp rõ ràng bằng tuệ tri.
Yasmā pana – ‘‘evaṃ me sutaṃ’’ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vāti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
But because, when it is said, "Thus have I heard, in such-and-such a year, in such-and-such a season, in such-and-such a month, in such-and-such a fortnight, in such-and-such a part of the night, or in such-and-such a part of the day," it is not possible to easily remember, or recite, or have it recited, and much would have to be said, therefore, having summarized that meaning with just one word, he said "on one occasion."
Vì nếu nói rằng – "Tôi đã nghe như vầy" vào năm đó, mùa đó, tháng đó, nửa tháng đó, phần đêm đó, hay phần ngày đó – thì không thể dễ dàng ghi nhớ, hoặc tự mình đọc tụng, hoặc khiến người khác đọc tụng, và cũng có nhiều điều phải nói. Do đó, sau khi gom nghĩa đó lại trong một từ duy nhất, Ngài đã nói "ekaṃ samayaṃ" (một thời).
Ye vā ime gabbhokkantisamayo, jātisamayo, saṃvegasamayo, abhinikkhamanasamayo, dukkarakārikasamayo, māravijayasamayo, abhisambodhisamayo diṭṭhadhammasukhavihārasamayo, desanāsamayo, parinibbānasamayoti, evamādayo bhagavato devamanussesu ativiya pakāsā anekakālappabhedā eva samayā.
Or, these occasions of the Blessed One that are extremely well-known among devas and humans are indeed of many different time-periods, such as: the time of conception, the time of birth, the time of spiritual urgency, the time of the great renunciation, the time of the austere practices, the time of conquering Māra, the time of full awakening, the time of dwelling in blissful abiding in the visible world, the time of teaching, and the time of parinibbāna.
Hoặc những thời như thời nhập thai, thời đản sinh, thời khởi tâm xúc động, thời xuất gia, thời khổ hạnh, thời chiến thắng Ma vương, thời chứng đắc Chánh Đẳng Giác, thời an trú lạc trú hiện tại, thời thuyết pháp, thời nhập Niết Bàn – những thời như vậy là những thời gian khác nhau, rất nổi tiếng của Đức Thế Tôn giữa chư thiên và loài người.
Tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Among those occasions, it indicates "on one occasion," that is, the one designated as the occasion of teaching.
Trong những thời đó, từ "ekaṃ samayaṃ" chỉ một thời được gọi là thời thuyết pháp.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ samayaṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
And among the occasions of the tasks of wisdom and compassion, it is the occasion of the task of compassion; among the occasions of practicing for one's own welfare and for the welfare of others, it is the occasion of practicing for the welfare of others; among the occasions for the two duties of those who have assembled, it is the occasion for a Dhamma talk; among the occasions for teaching and practice, it is the occasion for teaching. With reference to any one of these occasions, he said "on one occasion."
Và trong các thời thực hiện nhiệm vụ trí tuệ và từ bi, đó là thời thực hiện nhiệm vụ từ bi; trong các thời thực hành lợi ích cho mình và lợi ích cho người khác, đó là thời thực hành lợi ích cho người khác; trong các thời có hai việc cần làm cho những người đã hội họp, đó là thời thuyết pháp; trong các thời thực hành thuyết pháp, đó là thời thuyết pháp. Ngài đã nói "ekaṃ samayaṃ" (một thời) để chỉ một trong những thời đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti (dha. sa. 1) ca, ito aññesu ca suttapadesu – ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacananiddeso kato, vinaye ca – ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacananiddeso katoti?
Why, here, was it not done as in the Abhidhamma, where the locative case is used, as in "at which time, a sense-sphere*," and in other suttas, "At which time, O bhikkhus, a bhikkhu, secluded from sensual pleasures," or as in the Vinaya, where the instrumental case is used, as in "At that time the Buddha, the Blessed One"? Why instead was the accusative case of utilization used, as in "ekaṃ samayaṃ"?
Vì sao ở đây, không dùng cách chỉ định bằng ngữ cách định sở như trong Abhidhamma: "Vào thời gian mà cõi dục giới..." (Dhs. 1) và trong các đoạn kinh khác: "Này các Tỳ khưu, vào thời gian mà Tỳ khưu ly dục..." và cũng không dùng cách chỉ định bằng ngữ cách công cụ như trong Vinaya: "Vào thời gian đó, Đức Phật, Thế Tôn..." mà lại dùng cách chỉ định bằng ngữ cách đối cách "ekaṃ samayaṃ" (một thời)?
Tattha tathā idha ca aññathā atthasambhavato.
Because in those instances, the meaning is conveyed in that way, whereas here, it is conveyed in another way.
Vì ở đó và ở đây có sự khác biệt về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvena bhāvalakkhaṇattho ca sambhavati.
For in the Abhidhamma and in other suttas, the meaning of location and the meaning of bhāvena bhāvalakkhaṇa are possible.
Thật vậy, ở đó, trong Abhidhamma và trong các đoạn kinh khác, ý nghĩa định sở và ý nghĩa biểu thị trạng thái có thể xảy ra.
Adhikaraṇañhi kālattho, samūhattho ca samayo, tattha tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati, tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
Indeed, samaya has the meaning of time, which is a location, and the meaning of a collection; the existence of the dhammas such as contact, mentioned in those places, is marked by the existence of the samaya, which is designated as the moment, conjunction, and cause. Therefore, to illuminate that meaning, the locative case is used there.
Thời gian là định sở, và samaya (thời) có nghĩa là tập hợp. Với sự hiện hữu của samaya, được gọi là khoảnh khắc, sự kết hợp và nguyên nhân của các pháp như xúc đã được nói đến ở đó, sự hiện hữu của chúng được biểu thị. Do đó, để làm rõ ý nghĩa đó, cách chỉ định bằng ngữ cách định sở đã được sử dụng ở đó.
Antarā ca rājagahaṃ antarā ca nāḷandanti antarā-saddo kāraṇakhaṇacittavemajjhavivarādīsu dissati.
In between Rājagaha and between Nāḷandā, the word antarā is seen in the senses of reason, moment, mind, middle, interval, and so on.
Từ "antarā" trong "antarā ca Rājagahaṃ antarā ca Nāḷandaṃ" (giữa Rājagaha và Nāḷandā) được thấy trong các ý nghĩa như nguyên nhân, khoảnh khắc, tâm, ở giữa, khoảng trống, v.v.
‘‘Tadantaraṃ ko jāneyya aññatra tathāgatā’’ti (a. ni. 6.44) ca, ‘‘janā saṅgamma mantenti mañca tañca kimantara’’nti (saṃ. ni. 1.228) ca ādīsu hi kāraṇe antarā-saddo.
For in "Who other than the Tathāgata could know the reason for that?" and "People gather and consult, 'What is the reason concerning me and you?'" and so on, the word antarā is in the sense of reason.
Thật vậy, từ "antarā" có nghĩa là nguyên nhân trong các đoạn như: "Ai có thể biết được nguyên nhân đó, ngoại trừ Như Lai?" và "Người ta tụ họp bàn tán về tôi và ông, nguyên nhân là gì?".
‘‘Addasa maṃ, bhante, aññatarā itthī vijjantarikāya bhājanaṃ dhovantī’’tiādīsu (ma. ni. 2.149) khaṇe.
In "Venerable sir, a certain woman, while washing a bowl in a flash of lightning, saw me," and so on, it is in the sense of a moment.
Trong các đoạn như: "Bạch Thế Tôn, một người phụ nữ nào đó đang rửa bát trong khoảnh khắc lóe sáng đã thấy con", có nghĩa là khoảnh khắc.
‘‘Yassantarato na santi kopā’’tiādīsu (udā. 20) citte.
In "In whom there are no angers within the mind," and so on, it is in the sense of the mind.
Trong các đoạn như: "Người mà trong tâm không có sự sân hận", có nghĩa là tâm.
‘‘Antarā vosānamāpādī’’tiādīsu (cūḷava. 350) vemajjhe.
In "He reached a conclusion in the middle," and so on, it is in the sense of the middle.
Trong các đoạn như: "Đã đạt đến sự kết thúc ở giữa", có nghĩa là ở giữa.
‘‘Api cāyaṃ, bhikkhave, tapodā dvinnaṃ mahānirayānaṃ antarikāya āgacchatī’’tiādīsu (pārā. 231) vivare.
In "Moreover, bhikkhus, this Tapodā river flows through the interval between two great hells," and so on, it is in the sense of an interval.
Trong các đoạn như: "Này các Tỳ khưu, dòng Tapodā này chảy qua giữa hai đại địa ngục", có nghĩa là khoảng trống.
Svāyamidha vivare vattati, tasmā rājagahassa ca nāḷandāya ca vivareti evametthattho veditabbo.
Here, that word is used in the sense of an interval. Therefore, the meaning here should be understood as "in the interval of Rājagaha and Nāḷandā."
Ở đây, từ đó có nghĩa là khoảng trống, do đó ý nghĩa ở đây phải được hiểu là "trong khoảng trống giữa Rājagaha và Nāḷandā".
Antarā-saddena pana yuttattā upayogavacanaṃ kataṃ.
However, because it is connected with the word antarā, the accusative case is used.
Tuy nhiên, ngữ cách đối cách đã được sử dụng vì nó đi kèm với từ "antarā".
Īdisesu ca ṭhānesu akkharacintakā ‘‘antarā gāmañca nadiñca yātī’’ti evaṃ ekameva antarāsaddaṃ payujjanti, so dutiyapadenapi yojetabbo hoti, ayojiyamāne upayogavacanaṃ na pāpuṇāti.
And in such places, grammarians use only one antarā word, as in "antarā gāmañca nadiñca yāti" ("he goes between the village and the river"), and it has to be connected with the second word as well; if it is not so connected, the accusative case would not be obtained.
Và trong những trường hợp như vậy, các nhà ngữ pháp chỉ sử dụng một từ "antarā" như "antarā gāmañca nadiñca yāti" (đi giữa làng và sông), nhưng từ đó cũng phải được kết hợp với từ thứ hai; nếu không kết hợp, nó sẽ không đạt được ngữ cách đối cách.
Idha pana yojetvāyeva vuttoti.
Here, however, it has been stated with the connection already made.
Nhưng ở đây, nó đã được nói sau khi kết hợp.
Mahatā bhikkhusaṅghena saddhinti ‘mahatā’ti guṇamahattenapi mahatā, saṅkhyāmahattenapi mahatā.
Together with a great Saṅgha of bhikkhus means 'great' both in terms of greatness of quality and greatness of number.
Mahatā bhikkhusaṅghena saddhiṃ (cùng với một Tăng đoàn Tỳ khưu lớn) có nghĩa là "lớn" về phẩm chất và lớn về số lượng.
So hi bhikkhusaṅgho guṇehipi mahā ahosi, appicchatādiguṇasamannāgatattā.
For that Saṅgha of bhikkhus was great in qualities, being endowed with qualities such as fewness of wishes.
Thật vậy, Tăng đoàn Tỳ khưu đó lớn về phẩm chất, vì họ có đầy đủ các phẩm chất như ít dục.
Saṅkhyāyapi mahā, pañcasatasaṅkhyattā.
Also great in number, because of being five hundred in number.
Về số lượng cũng lớn, vì có số lượng năm trăm.
Bhikkhūnaṃ saṅgho ‘bhikkhusaṅgho’, tena bhikkhusaṅghena.
A community of bhikkhus is ‘bhikkhusaṅgha’; with that community of bhikkhus.
Tăng đoàn của các Tỳ-khưu là ‘Tỳ-khưu Tăng’, với Tỳ-khưu Tăng đó.
Diṭṭhisīlasāmaññasaṅghātasaṅkhātena samaṇagaṇenāti attho.
The meaning is: with the group of ascetics, designated as united by the commonality of view and virtue.
Ý nghĩa là ‘với nhóm Sa-môn được gọi là sự kết hợp của sự đồng nhất về chánh kiến và giới hạnh’.
Saddhinti ekato.
Saddhiṃ means together.
Từ Saddhiṃ (cùng với) là cùng nhau.
Suppiyopi kho paribbājakoti suppiyoti tassa nāmaṃ.
Suppiya the wanderer also: Suppiya is his name.
Từ Suppiyopi kho paribbājako (du sĩ Suppiya) – Suppiyo là tên của vị ấy.
Pi-kāro maggappaṭipannasabhāgatāya puggalasampiṇḍanattho.
The particle pi has the meaning of including a person because of the shared characteristic of being on the same path.
Tiếp đầu ngữ pi có nghĩa là tập hợp các cá nhân do có cùng tính chất là người đang đi trên đường.
Kho-kāro padasandhikaro, byañjanasiliṭṭhatāvasena vutto.
The particle kho is a word-connector, spoken for the sake of euphonic elegance of the consonants.
Tiếp đầu ngữ kho là từ nối câu, được nói đến theo cách liên kết các phụ âm.
Paribbājakoti sañjayassa antevāsī channaparibbājako.
Paribbājako means a wanderer of the six schools, a disciple of Sañjaya.
Paribbājako là du sĩ Sāñjaya, đệ tử của Sañjaya.
Idaṃ vuttaṃ hoti – ‘‘yadā bhagavā taṃ addhānamaggaṃ paṭipanno, tadā suppiyopi paribbājako paṭipanno ahosī’’ti.
This is what is meant: “When the Blessed One set out on that long journey, Suppiya the wanderer also set out.”
Điều này có nghĩa là: “Khi Đức Thế Tôn đang đi trên con đường đó, thì du sĩ Suppiya cũng đang đi trên con đường đó.”
Atītakālattho hettha hoti-saddo.
Here, the word ‘hoti’ has the meaning of past tense.
Ở đây, từ hoti có nghĩa là thì quá khứ.
Ādīsu hi satto māṇavoti vutto.
In such passages, a being is called ‘māṇavo’.
Trong những trường hợp như vậy, chúng sanh được gọi là māṇavo.
‘‘Māṇavehipi samāgacchanti katakammehipi akatakammehipī’’tiādīsu (ma. ni. 2.149) coro.
In passages such as, “They associate even with māṇavā, both those who have committed crimes and those who have not,” it means a thief.
Trong những trường hợp như ‘‘Māṇavehipi samāgacchanti katakammehipi akatakammehipī’’ (họ gặp gỡ cả những kẻ trộm đã gây tội và chưa gây tội), māṇavo được gọi là kẻ trộm.
‘‘Ambaṭṭho māṇavo, aṅgako māṇavo’’tiādīsu (dī. ni. 1.316) taruṇo ‘māṇavo’ti vutto.
In passages such as, “the māṇava Ambaṭṭha, the māṇava Aṅgaka,” a young person is called ‘māṇavo’.
Trong những trường hợp như ‘‘Ambaṭṭho māṇavo, Aṅgako māṇavo’’ (chàng trai Ambaṭṭha, chàng trai Aṅgaka), māṇavo được gọi là người trẻ tuổi.
Idhāpi ayamevattho.
Here too, this is the meaning.
Ở đây cũng là ý nghĩa này.
Idañhi vuttaṃ hoti – brahmadattena nāma taruṇantevāsinā saddhinti.
For this is what is said: with the young disciple named Brahmadatta.
Điều này có nghĩa là: “Cùng với đệ tử trẻ tuổi tên là Brahmadatta.”
Tatrāti tasmiṃ addhānamagge, tesu vā dvīsu janesu.
Tatra means on that long journey, or between those two persons.
Tatrā (ở đó) có nghĩa là trên con đường đó, hoặc trong hai người đó.
Sudanti nipātamattaṃ.
Sudaṃ is a mere particle.
Sudaṃ chỉ là một giới từ.
Anekapariyāyenāti pariyāya-saddo tāva vāradesanākāraṇesu vattati.
Anekapariyāyena: The word ‘pariyāya’ is used in the sense of a turn, a discourse, and a reason.
Từ Anekapariyāyenā (bằng nhiều cách) – từ pariyāya được dùng với ý nghĩa là lượt, lời dạy, và nguyên nhân.
‘‘Kassa nu kho, ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ntiādīsu (ma. ni. 3.398) hi vāre pariyāyasaddo vattati.
For in passages such as, “Whose turn is it today, Ānanda, to admonish the bhikkhunīs?” the word ‘pariyāya’ is used in the sense of a turn.
Trong những trường hợp như ‘‘Kassa nu kho, Ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ (Này Ānanda, hôm nay là lượt của ai để giáo huấn các Tỳ-khưu-ni?), từ pariyāya được dùng với ý nghĩa là lượt.
‘‘Madhupiṇḍikapariyāyotveva naṃ dhārehī’’tiādīsu (ma. ni. 1.205) desanāyaṃ.
In passages such as, “Remember it as the Honeyball Discourse (Madhupiṇḍikapariyāya),” it is used in the sense of a discourse.
Trong những trường hợp như ‘‘Madhupiṇḍikapariyāyotveva naṃ dhārehī’’ (Hãy ghi nhớ nó như là lời dạy về Madhupiṇḍika), nó được dùng với ý nghĩa là lời dạy.
‘‘Imināpi kho, te rājañña, pariyāyena evaṃ hotū’’tiādīsu (dī. ni. 2.411) kāraṇe.
In passages such as, “For this reason too, Your Majesty, let it be so for you,” it is used in the sense of a reason.
Trong những trường hợp như ‘‘Imināpi kho, te rājañña, pariyāyena evaṃ hotū’’ (Này vương tử, với lý do này, điều đó cũng nên là như vậy đối với ngài), nó được dùng với ý nghĩa là nguyên nhân.
Svāyamidhāpi kāraṇe vattati, tasmā ayamettha attho – ‘‘anekavidhena kāraṇenā’’ti, ‘‘bahūhi kāraṇehī’’ti vuttaṃ hoti.
Here too, it is used in the sense of a reason, therefore this is the meaning here: “for many kinds of reasons,” which means “for many reasons.”
Ở đây, từ này cũng được dùng với ý nghĩa là nguyên nhân. Do đó, ý nghĩa ở đây là ‘‘bằng nhiều loại nguyên nhân’’, có nghĩa là ‘‘bằng nhiều nguyên nhân’’.
Buddhassa avaṇṇaṃ bhāsatīti avaṇṇavirahitassa aparimāṇavaṇṇasamannāgatassāpi buddhassa bhagavato – ‘‘yaṃ loke jātivuḍḍhesu kattabbaṃ abhivādanādisāmīcikammaṃ ‘sāmaggiraso’ti vuccati, taṃ samaṇassa gotamassa natthi tasmā arasarūpo samaṇo gotamo, nibbhogo, akiriyavādo, ucchedavādo, jegucchī, venayiko, tapassī, apagabbho.
Speaks dispraise of the Buddha: Of the Blessed One, the Buddha, who is devoid of dispraise and endowed with immeasurable praise, he speaks dispraise, fault, and blame in various ways, saying that this and that non-reason is a reason, as follows: “The respectful conduct such as salutation that should be performed in the world towards those senior in birth, which is called the ‘taste of harmony,’ is absent in the ascetic Gotama; therefore, the ascetic Gotama has the nature of being tasteless, is without enjoyment, is a proponent of inaction, a proponent of annihilation, is loathsome, is a disciplinarian, is an ascetic, is without a good rebirth.
Buddhassa avaṇṇaṃ bhāsatī (nói lời phỉ báng Đức Phật) – đối với Đức Phật, Đức Thế Tôn, Đấng vô cấu, Đấng đầy đủ vô lượng công đức, vị ấy nói: “Không có sự tôn kính, lễ bái v.v... đáng được thực hiện đối với những người lớn tuổi về tuổi tác trên thế gian, điều được gọi là ‘hương vị của sự hòa hợp’, đối với Sa-môn Gotama. Do đó, Sa-môn Gotama là người không có hương vị, không có tài sản, là người chủ trương không hành động, là người chủ trương đoạn diệt, là người ghê tởm, là người cần được uốn nắn, là người khổ hạnh, là người không có khả năng.
Natthi samaṇassa gotamassa uttarimanussadhammo alamariyañāṇadassanaviseso.
The ascetic Gotama has no superhuman states, no special knowledge and vision befitting the noble ones.
Sa-môn Gotama không có pháp thượng nhân, không có sự đặc biệt về trí tuệ và cái thấy của bậc Thánh.
Takkapariyāhataṃ samaṇo gotamo dhammaṃ deseti, vīmaṃsānucaritaṃ, sayaṃpaṭibhānaṃ.
The ascetic Gotama teaches a Dhamma hammered out by reasoning, following his own investigations, a product of his own ingenuity.
Sa-môn Gotama thuyết pháp bị suy luận làm tổn hại, bị khảo sát làm tổn hại, là sự ứng biến tự thân.
Samaṇo gotamo na sabbaññū, na lokavidū, na anuttaro, na aggapuggalo’’ti.
The ascetic Gotama is not all-knowing, not a knower of the world, not the unsurpassed, not the foremost person.”
Sa-môn Gotama không phải là bậc Toàn Tri, không phải là bậc Thế Gian Giải, không phải là bậc Vô Thượng, không phải là bậc Tối Thượng.”
Evaṃ taṃ taṃ akāraṇameva kāraṇanti vatvā tathā tathā avaṇṇaṃ dosaṃ nindaṃ bhāsati.
Thus, claiming this and that non-reason as a reason, he speaks dispraise, fault, and blame in various ways.
Nói như vậy, vị ấy lấy những điều không phải là nguyên nhân làm nguyên nhân, và nói lời phỉ báng, lỗi lầm, chỉ trích theo nhiều cách khác nhau.
Antevāsī panassa – ‘‘amhākaṃ ācariyo aparāmasitabbaṃ parāmasati, anakkamitabbaṃ akkamati, svāyaṃ aggiṃ gilanto viya, hatthena asidhāraṃ parāmasanto viya, muṭṭhinā sineruṃ padāletukāmo viya, kakacadantapantiyaṃ kīḷamāno viya, pabhinnamadaṃ caṇḍahatthiṃ hatthena gaṇhanto viya ca vaṇṇārahasseva ratanattayassa avaṇṇaṃ bhāsamāno anayabyasanaṃ pāpuṇissati.
But his disciple thought: “Our teacher is touching what should not be touched, is treading where he should not tread. He will meet with ruin and disaster by speaking dispraise of the three jewels, which are worthy only of praise, just like one swallowing fire, like one touching the blade of a sword with his hand, like one wishing to split Mount Sineru with his fist, like one playing with a row of saw teeth, and like one grabbing a ferocious, musth-crazed elephant with his hand.
Còn đệ tử của vị ấy thì nói: “Thầy của chúng ta chạm vào những điều không nên chạm, bước lên những điều không nên bước. Vị ấy giống như nuốt lửa, như dùng tay chạm vào lưỡi gươm, như muốn đập nát núi Sineru bằng nắm đấm, như đang chơi đùa với hàng răng cưa, như dùng tay nắm lấy con voi hung dữ đang say, đang nói lời phỉ báng Ba Ngôi Báu đáng được ca ngợi, sẽ rơi vào sự hủy hoại và tai ương.
Ācariye kho pana gūthaṃ vā aggiṃ vā kaṇṭakaṃ vā kaṇhasappaṃ vā akkamante, sūlaṃ vā abhirūhante, halāhalaṃ vā visaṃ khādante, khārodakaṃ vā pakkhalante, narakapapātaṃ vā papatante, na antevāsinā taṃ sabbamanukātabbaṃ hoti.
But when a teacher is stepping on excrement, fire, thorns, or a black serpent, or is climbing onto a stake, or is eating deadly poison, or is slipping into a torrent of caustic water, or is falling into a hellish abyss, it is not for the disciple to imitate all of that.
Khi thầy bước lên phân, lửa, gai, hoặc rắn hổ mang, hoặc leo lên cây cọc nhọn, hoặc ăn chất độc halāhala, hoặc trượt chân xuống dòng nước mặn, hoặc rơi xuống vực thẳm địa ngục, thì đệ tử không nên làm theo tất cả những điều đó.
Kammassakā hi sattā attano kammānurūpameva gatiṃ gacchanti.
For beings are owners of their kamma; they go to a destination according to their own kamma.
Vì chúng sanh là chủ nhân của nghiệp, họ đi đến cảnh giới phù hợp với nghiệp của mình.
Neva pitā puttassa kammena gacchati, na putto pitu kammena, na mātā puttassa, na putto mātuyā, na bhātā bhaginiyā, na bhaginī bhātu, na ācariyo antevāsino, na antevāsī ācariyassa kammena gacchati.
A father does not go by the kamma of his son, nor a son by the kamma of his father; nor a mother of her son, nor a son of his mother; nor a brother of his sister, nor a sister of her brother; nor a teacher of his disciple, nor a disciple by the kamma of his teacher.
Cha không đi đến cảnh giới bằng nghiệp của con, con không đi đến cảnh giới bằng nghiệp của cha, mẹ không đi đến cảnh giới bằng nghiệp của con, con không đi đến cảnh giới bằng nghiệp của mẹ, anh/em không đi đến cảnh giới bằng nghiệp của chị/em gái, chị/em gái không đi đến cảnh giới bằng nghiệp của anh/em trai, thầy không đi đến cảnh giới bằng nghiệp của đệ tử, đệ tử không đi đến cảnh giới bằng nghiệp của thầy.
Mayhañca ācariyo tiṇṇaṃ ratanānaṃ avaṇṇaṃ bhāsati, mahāsāvajjo kho panāriyūpavādoti.
And my teacher speaks dispraise of the three jewels, but abuse of the noble ones is indeed a grave offense.”
Thầy của ta nói lời phỉ báng Ba Ngôi Báu, quả thật sự phỉ báng bậc Thánh là một tội lỗi lớn.”
Evaṃ yoniso ummujjitvā ācariyavādaṃ maddamāno sammākāraṇameva kāraṇato apadisanto anekapariyāyena tiṇṇaṃ ratanānaṃ vaṇṇaṃ bhāsitumāraddho, yathā taṃ paṇḍitajātiko kulaputto’’.
Thus, wisely emerging, refuting his teacher’s view, pointing to a proper reason as the reason, he began to speak praise of the three jewels in many ways, just as a wise man of good family would.
Sau khi suy nghĩ như vậy một cách đúng đắn, đè bẹp lời nói của thầy, chỉ ra những nguyên nhân đúng đắn là nguyên nhân, vị ấy bắt đầu nói lời ca ngợi Ba Ngôi Báu bằng nhiều cách khác nhau, giống như một thiện nam tử có trí tuệ.
Tena vuttaṃ – ‘‘suppiyassa pana paribbājakassa antevāsī brahmadatto māṇavo anekapariyāyena buddhassa vaṇṇaṃ bhāsati, dhammassa vaṇṇaṃ bhāsati, saṅghassa vaṇṇaṃ bhāsatī’’ti.
Therefore it was said: “But Suppiya the wanderer’s disciple, the young man Brahmadatta, speaks praise of the Buddha in many ways, speaks praise of the Dhamma, speaks praise of the Saṅgha.”
Do đó, đã nói: “Nhưng đệ tử của du sĩ Suppiya là chàng trai Brahmadatta đã nói lời ca ngợi Đức Phật bằng nhiều cách, nói lời ca ngợi Giáo Pháp, nói lời ca ngợi Tăng đoàn.”
Tattha vaṇṇanti vaṇṇa-saddo saṇṭhāna-jāti-rūpāyatana-kāraṇa-pamāṇa-guṇa-pasaṃsādīsu dissati.
Therein, the word vaṇṇa is seen in the senses of form, caste, visible object, reason, measure, quality, praise, and so on.
Ở đây, từ vaṇṇa (sắc) – từ vaṇṇa được thấy trong các ý nghĩa như hình dáng, chủng tộc, sắc xứ, nguyên nhân, thước đo, phẩm chất, lời khen ngợi v.v...
Tattha ‘‘mahantaṃ sapparājavaṇṇaṃ abhinimminitvā’’tiādīsu (saṃ. ni. 1.142) saṇṭhānaṃ vuccati.
Among these, in passages such as “having created the great form of a serpent king,” it refers to form.
Ở đây, trong những trường hợp như ‘‘mahantaṃ sapparājavaṇṇaṃ abhinimminitvā’’ (sau khi hóa hiện thành hình dáng của một vua rắn vĩ đại), nó được gọi là hình dáng.
‘‘Brāhmaṇova seṭṭho vaṇṇo, hīno añño vaṇṇo’’tiādīsu (ma. ni. 2.402) jāti.
In passages such as “The brahmin caste is the best; the other caste is inferior,” it refers to caste.
Trong những trường hợp như ‘‘Brāhmaṇova seṭṭho vaṇṇo, hīno añño vaṇṇo’’ (chủng tộc Bà-la-môn là tối thượng, các chủng tộc khác là thấp kém), nó được gọi là chủng tộc.
‘‘Paramāya vaṇṇapokkharatāya samannāgato’’tiādīsu (dī. ni. 1.303) rūpāyatanaṃ.
In passages such as “endowed with the highest excellence of complexion,” it refers to a visible object.
Trong những trường hợp như ‘‘Paramāya vaṇṇapokkharatāya samannāgato’’ (đầy đủ vẻ đẹp tối thượng), nó được gọi là sắc xứ.
Ādīsu kāraṇaṃ.
In such passages, it refers to a reason.
Trong những trường hợp như vậy, nó là nguyên nhân.
‘‘Tayo pattassa vaṇṇā’’tiādīsu (pārā. 602) pamāṇaṃ.
In passages such as “three vaṇṇā of a bowl,” it refers to a measure.
Trong những trường hợp như ‘‘Tayo pattassa vaṇṇā’’ (ba loại màu sắc của lá), nó là thước đo.
‘‘Kadā saññūḷhā pana, te gahapati, ime samaṇassa gotamassa vaṇṇā’’tiādīsu (ma. ni. 2.77) guṇo.
In passages such as “When, householder, did you grasp these vaṇṇā of the ascetic Gotama?” it refers to a quality.
Trong những trường hợp như ‘‘Kadā saññūḷhā pana, te gahapati, ime samaṇassa gotamassa vaṇṇā’’ (Này gia chủ, những phẩm chất này của Sa-môn Gotama đã được ngài nhận biết từ khi nào?), nó là phẩm chất.
‘‘Vaṇṇārahassa vaṇṇaṃ bhāsatī’’tiādīsu (a. ni. 2.135) pasaṃsā.
In passages such as, "He speaks the praise of one worthy of praise," it means praise.
Trong các câu như: “Nói lên lời tán thán của người đáng được tán thán”, đó là lời tán thán.
Idha guṇopi pasaṃsāpi.
Here, it means both virtue and praise.
Ở đây, cả phẩm chất (guṇa) và lời tán thán (pasaṃsā) đều được nói đến.
Ayaṃ kira taṃ taṃ bhūtameva kāraṇaṃ apadisanto anekapariyāyena ratanattayassa guṇūpasañhitaṃ pasaṃsaṃ abhāsi.
It is said that this one, pointing out that very true reason, spoke praise connected with the virtues of the Three Jewels in many ways.
Nghe nói, người này (Brahmadatta) đã nói lời tán thán liên quan đến phẩm chất của Tam Bảo (Ratanattaya) bằng nhiều cách khác nhau, chỉ ra những lý do thực sự.
Tattha – ‘‘itipi so bhagavā arahaṃ sammāsambuddho’’tiādinā (pārā. 1) nayena, ‘‘ye bhikkhave, buddhe pasannā agge te pasannā’’tiādinā ‘‘ekapuggalo, bhikkhave, loke uppajjamāno uppajjati…pe… asamo asamasamo’’tiādinā (a. ni. 1.174) ca nayena buddhassa vaṇṇo veditabbo.
Therein, the praise of the Buddha should be understood by the method of "Thus is the Blessed One: an Arahant, a Perfectly Enlightened One," and so on; and by the method of "Monks, those who have confidence in the Buddha have confidence in the supreme," and so on; and by the method of "Monks, one person arising in the world arises... unequalled, equal to the unequalled," and so on.
Trong đó, phẩm chất của Đức Phật (Buddha) cần được hiểu theo cách như: “Đức Thế Tôn ấy là bậc A-la-hán, bậc Chánh Đẳng Giác” và “Này các Tỳ-khưu, những ai có niềm tin nơi Đức Phật, họ có niềm tin nơi điều tối thượng” và “Này các Tỳ-khưu, một cá nhân xuất hiện trên thế gian… (v.v.)… là vô song, không ai sánh bằng.”
‘‘Svākkhāto bhagavatā dhammo’’ti (dī. ni. 2.159) ca ‘‘ālayasamugghāto vaṭṭupacchedo’’ti (iti. 90, a. ni. 4.34) ca, ‘‘ye bhikkhave, ariye aṭṭhaṅgike magge pasannā, agge te pasannā’’ti ca evamādīhi nayehi dhammassa vaṇṇo veditabbo.
The praise of the Dhamma should be understood by methods such as "The Dhamma is well-expounded by the Blessed One," and "It is the uprooting of attachments, the cutting off of the cycle," and "Monks, those who have confidence in the Noble Eightfold Path have confidence in the supreme," and so forth.
Phẩm chất của Giáo Pháp (Dhamma) cần được hiểu theo các cách như: “Giáo Pháp đã được Đức Thế Tôn khéo thuyết giảng” và “là sự nhổ tận gốc ái dục, sự đoạn trừ luân hồi” và “Này các Tỳ-khưu, những ai có niềm tin nơi Bát Chánh Đạo cao quý, họ có niềm tin nơi điều tối thượng.”
‘‘Suppaṭipanno bhagavato sāvakasaṅgho’’ti (dī. ni. 2.159) ca, ‘‘ye, bhikkhave, saṅghe pasannā, agge te pasannā’’ti (a. ni. 4.34) ca evamādīhi pana nayehi saṅghassa vaṇṇo veditabbo.
The praise of the Saṅgha, however, should be understood by methods such as "The Saṅgha of the Blessed One's disciples has practiced well," and "Monks, those who have confidence in the Saṅgha have confidence in the supreme," and so forth.
Phẩm chất của Tăng Đoàn (Saṅgha) cần được hiểu theo các cách như: “Tăng đoàn đệ tử của Đức Thế Tôn là những bậc hành trì chân chánh” và “Này các Tỳ-khưu, những ai có niềm tin nơi Tăng đoàn, họ có niềm tin nơi điều tối thượng.”
Pahontena pana dhammakathikena pañcanikāye navaṅgaṃ satthusāsanaṃ caturāsītidhammakkhandhasahassāni ogāhitvā buddhādīnaṃ vaṇṇo pakāsetabbo.
However, a capable Dhamma-preacher should proclaim the praise of the Buddha and the others after having penetrated the five Nikāyas, the nine-fold teaching of the Master, and the eighty-four thousand aggregates of the Dhamma.
Tuy nhiên, một vị pháp sư (dhammakathika) có khả năng cần phải đi sâu vào năm bộ Nikāya, vào giáo pháp của Đức Đạo Sư với chín chi phần, và vào tám vạn bốn ngàn pháp uẩn để tuyên bố phẩm chất của Đức Phật và các bậc khác.
Imasmiñhi ṭhāne buddhādīnaṃ guṇe pakāsento atitthena pakkhando dhammakathikoti na sakkā vattuṃ.
Indeed, in this matter, it cannot be said of one who proclaims the virtues of the Buddha and the others, that he is a Dhamma-preacher who has rushed into an improper landing-place.
Thật vậy, tại điểm này, không thể nói rằng một vị pháp sư tuyên bố phẩm chất của Đức Phật và các bậc khác là một vị pháp sư đã đi lạc vào bến không đúng.
Īdisesu hi ṭhānesu dhammakathikassa thāmo veditabbo.
For in such matters, the strength of the Dhamma-preacher should be known.
Thật vậy, tại những điểm như thế này, sức mạnh của vị pháp sư cần được biết đến.
Brahmadatto pana māṇavo anussavādimattasambandhitena attano thāmena ratanattayassa vaṇṇaṃ bhāsati.
The young man Brahmadatta, however, speaks the praise of the Three Jewels with his own strength, which is connected only with what has been heard by tradition and so on.
Tuy nhiên, thanh niên Brahmadatta đã nói lên phẩm chất của Tam Bảo (Ratanattaya) bằng sức mạnh của mình, vốn chỉ liên quan đến những gì được nghe kể lại (anussava) và những điều tương tự.
Itiha te ubho ācariyantevāsīti evaṃ te dve ācariyantevāsikā.
Thus, those two, the teacher and the pupil, means: thus those two, the teacher and pupil.
Hai vị thầy trò ấy có nghĩa là hai vị thầy trò đó.
Aññamaññassāti añño aññassa.
Of each other means: one of another.
Của nhau có nghĩa là người này của người kia.
Ujuvipaccanīkavādāti īsakampi apariharitvā ujumeva vividhapaccanīkavādā, anekavāraṃ viruddhavādā eva hutvāti attho.
Speaking in direct opposition means: without avoiding it even a little, they spoke in direct and varied opposition; the meaning is that they repeatedly held conflicting views.
Nói lời đối nghịch trực tiếp có nghĩa là không né tránh dù chỉ một chút, mà nói những lời đối nghịch trực tiếp và đa dạng, tức là đã nói những lời mâu thuẫn nhiều lần.
Ācariyena hi ratanattayassa avaṇṇe bhāsite antevāsī vaṇṇaṃ bhāsati, puna itaro avaṇṇaṃ, itaro vaṇṇanti evaṃ ācariyo sāraphalake visarukkhaāṇiṃ ākoṭayamāno viya punappunaṃ ratanattayassa avaṇṇaṃ bhāsati.
For when the teacher spoke dispraise of the Three Jewels, the pupil spoke praise; then the other spoke dispraise, and the other praise. Thus, like one hammering a poisonous wooden wedge into a plank of heartwood, the teacher repeatedly spoke dispraise of the Three Jewels.
Khi vị thầy nói lời phỉ báng Tam Bảo (Ratanattaya), người đệ tử nói lời tán thán; rồi người kia nói lời phỉ báng, người này nói lời tán thán. Cứ thế, vị thầy nhiều lần nói lời phỉ báng Tam Bảo, như thể đang đóng một cái đinh gỗ độc vào một tấm ván gỗ quý.
Antevāsī pana suvaṇṇarajatamaṇimayāya āṇiyā taṃ āṇiṃ paṭibāhayamāno viya punappunaṃ ratanattayassa vaṇṇaṃ bhāsati.
The pupil, however, like one counteracting that wedge with a wedge made of gold, silver, and jewels, repeatedly spoke praise of the Three Jewels.
Còn người đệ tử thì nhiều lần nói lời tán thán Tam Bảo, như thể đang dùng một cái đinh bằng vàng, bạc, ngọc để đẩy lùi cái đinh đó.
Tena vuttaṃ – ‘‘ujuvipaccanīkavādā’’ti.
Therefore, it was said: "speaking in direct opposition."
Vì thế, đã nói: “Nói lời đối nghịch trực tiếp.”
Kasmā pana bhagavā taṃ addhānaṃ paṭipanno?
But why did the Blessed One set out on that journey?
Tại sao Đức Thế Tôn lại đi trên con đường đó?
Kasmā ca suppiyo anubandho?
And why did Suppiya follow?
Và tại sao Suppiya lại đi theo?
Kasmā ca so ratanattayassa avaṇṇaṃ bhāsatīti?
And why did he speak dispraise of the Three Jewels?
Và tại sao người đó lại nói lời phỉ báng Tam Bảo?
Bhagavā tāva tasmiṃ kāle rājagahaparivattakesu aṭṭhārasasu mahāvihāresu aññatarasmiṃ vasitvā pātova sarīrappaṭijagganaṃ katvā bhikkhācāravelāyaṃ bhikkhusaṅghaparivuto rājagahe piṇḍāya carati.
The Blessed One, at that time, having stayed in one of the eighteen great monasteries surrounding Rājagaha, attended to his body early in the morning, and at the time for the alms round, surrounded by the Saṅgha of monks, went for alms in Rājagaha.
Đức Thế Tôn vào thời điểm đó, sau khi trú tại một trong mười tám đại tinh xá xung quanh Rājagaha, đã dậy sớm để chăm sóc thân thể, rồi vào giờ khất thực, Ngài cùng với Tăng đoàn Tỳ-khưu đi khất thực trong thành Rājagaha.
So taṃ divasaṃ bhikkhusaṅghassa sulabhapiṇḍapātaṃ katvā pacchābhattaṃ piṇḍapātapaṭikkanto bhikkhusaṅghaṃ pattacīvaraṃ gāhāpetvā – ‘‘nāḷandaṃ gamissāmī’’ti, rājagahato nikkhamitvā taṃ addhānaṃ paṭipanno.
On that day, having made alms-food easy to obtain for the Saṅgha of monks, after the meal, having returned from the alms-round, he had the Saṅgha of monks take their bowls and robes, and thinking, "I will go to Nāḷandā," he left Rājagaha and set out on that journey.
Vào ngày hôm đó, sau khi sắp xếp cho Tăng đoàn Tỳ-khưu dễ dàng nhận được vật thực, và sau khi dùng bữa trưa, Đức Thế Tôn đã rời khỏi nơi thọ thực, bảo Tăng đoàn Tỳ-khưu mang y bát, rồi nói: “Ta sẽ đi đến Nāḷandā,” và rời Rājagaha để đi trên con đường đó.
Suppiyopi kho tasmiṃ kāle rājagahaparivattake aññatarasmiṃ paribbājakārāme vasitvā paribbājakaparivuto rājagahe bhikkhāya carati.
Suppiya also, at that time, having stayed in a certain monastery for wanderers surrounding Rājagaha, surrounded by wanderers, went for alms in Rājagaha.
Vào thời điểm đó, Suppiya cũng trú tại một trong những tịnh xá du sĩ (paribbājakārāma) xung quanh Rājagaha, và cùng với nhóm du sĩ của mình đi khất thực trong thành Rājagaha.
Sopi taṃ divasaṃ paribbājakaparisāya sulabhabhikkhaṃ katvā bhuttapātarāso paribbājake paribbājakaparikkhāraṃ gāhāpetvā – nāḷandaṃ gamissāmicceva bhagavato taṃ maggaṃ paṭipannabhāvaṃ ajānantova anubandho.
He too, on that day, having made alms easy to obtain for the assembly of wanderers, and having had his morning meal, had the wanderers take their requisites, and thinking, "I will go to Nāḷandā," he followed, not knowing that the Blessed One had set out on that same path.
Vào ngày hôm đó, sau khi sắp xếp cho nhóm du sĩ của mình dễ dàng nhận được vật thực, và sau khi dùng bữa sáng, người đó đã bảo các du sĩ mang theo vật dụng của du sĩ, rồi nói: “Ta sẽ đi đến Nāḷandā,” và đi theo sau Đức Thế Tôn mà không biết rằng Ngài đã đi trên con đường đó.
Sace pana jāneyya nānubandheyya.
But if he had known, he would not have followed.
Nếu biết, anh ta sẽ không đi theo.
So ajānitvāva gacchanto gīvaṃ ukkhipitvā olokayamāno bhagavantaṃ addasa buddhasiriyā sobhamānaṃ rattakambalaparikkhittamiva jaṅgamakanakagirisikharaṃ.
While going along without knowing, he lifted his neck and looked, and saw the Blessed One, shining with the splendour of a Buddha, like a moving golden mountain peak draped with a red blanket.
Vì không biết, khi đang đi, anh ta ngẩng cổ lên nhìn và thấy Đức Thế Tôn đang tỏa sáng với vẻ uy nghi của một vị Phật, như một đỉnh núi vàng di động được bao phủ bởi một tấm chăn đỏ.
Asīti anubyañjanānurañjitañca pana bhagavato sarīraṃ vikasitakamaluppalamiva, saraṃ sabbapāliphullamiva pāricchattakaṃ, tārāmarīcivikasitamiva, gaganatalaṃ siriyā avahasantamiva, byāmappabhāparikkhepavilāsinī cassa dvattiṃsavaralakkhaṇamālā ganthetvā ṭhapitadvattiṃsacandamālāya dvattiṃsasūriyamālāya paṭipāṭiyā ṭhapitadvattiṃsacakkavattidvattiṃsasakkadevarājadvattiṃsamahābrahmānaṃ siriṃ siriyā abhibhavantimiva.
Furthermore, the Blessed One's body, adorned with the eighty minor characteristics, was like a blooming lotus or water lily, like a pāricchattaka tree in full bloom with all its leaves, like the sky resplendent with the rays of the stars, as if mocking its splendor. And his garland of the thirty-two excellent major characteristics, a thing of beauty with its surrounding aura of a fathom's breadth, seemed to surpass in splendor the splendor of thirty-two universal monarchs, thirty-two Sakkas, kings of the gods, and thirty-two Mahābrahmās, placed in a row like a garland of thirty-two moons or a garland of thirty-two suns.
Thân Đức Thế Tôn được tô điểm bằng tám mươi tướng phụ (anubyañjana), như một hồ sen nở rộ với tất cả các loại hoa sen, như cây pāricchattaka nở hoa khắp nơi, như bầu trời đêm rực rỡ ánh sao; và vầng hào quang một tầm tay của Ngài, như một chuỗi ba mươi hai tướng tốt được kết lại, dường như lấn át vẻ uy nghi của ba mươi hai mặt trăng, ba mươi hai mặt trời, ba mươi hai Chuyển Luân Vương, ba mươi hai vị vua trời Sakka và ba mươi hai vị Đại Phạm Thiên được sắp đặt theo thứ tự.
Tañca pana bhagavantaṃ parivāretvā ṭhitā bhikkhū sabbeva appicchā santuṭṭhā pavivittā asaṃsaṭṭhā codakā pāpagarahino vattāro vacanakkhamā sīlasampannā samādhipaññāvimuttivimuttiññāṇadassanasampannā.
And the monks standing around that Blessed One were all content with little, satisfied, secluded, unentangled, reprovers, censurers of evil, speakers, tolerant of speech, endowed with virtue, concentration, wisdom, liberation, and the knowledge and vision of liberation.
Và các Tỳ-khưu vây quanh Đức Thế Tôn đều là những người thiểu dục, biết đủ, sống độc cư, không giao thiệp, hay khiển trách (người khác), ghét điều ác, hay khuyên răn, chịu đựng lời khuyên, đầy đủ giới hạnh, đầy đủ định, tuệ, giải thoát và tri kiến giải thoát.
Tesaṃ majjhe bhagavā rattakambalapākāraparikkhitto viya kañcanathambho, rattapadumasaṇḍamajjhagatā viya suvaṇṇanāvā, pavāḷavedikāparikkhitto viya aggikkhandho, tārāgaṇaparivārito viya puṇṇacando migapakkhīnampi cakkhūni pīṇayati, pageva devamanussānaṃ.
In their midst, the Blessed One was like a golden pillar surrounded by a rampart of red blankets, like a golden boat in a grove of red lotuses, like a mass of fire surrounded by a coral railing, like the full moon surrounded by a host of stars, delighting the eyes of even animals and birds, let alone gods and humans.
Giữa họ, Đức Thế Tôn, như một cây cột vàng được bao quanh bởi bức tường vải đỏ, như một chiếc thuyền vàng giữa một rừng hoa sen đỏ, như một đống lửa được bao quanh bởi hàng rào san hô, như vầng trăng tròn được vây quanh bởi các vì sao, làm mãn nhãn cả chim muông, huống chi là chư thiên và loài người.
Tasmiñca pana divase yebhuyyena asītimahātherā meghavaṇṇaṃ paṃsukūlaṃ ekaṃsaṃ karitvā kattaradaṇḍaṃ ādāya suvammavammitā viya gandhahatthino vigatadosā vantadosā bhinnakilesā vijaṭitajaṭā chinnabandhanā bhagavantaṃ parivārayiṃsu.
And on that day, for the most part, the eighty great elders, having arranged their cloud-colored rag-robes over one shoulder and taking up their staffs, surrounded the Blessed One like noble elephants clad in fine armor, free from faults, having vomited out faults, with defilements shattered, with tangles untangled, and with bonds cut off.
Và vào ngày hôm đó, phần lớn tám mươi vị Đại Trưởng Lão, khoác y phấn tảo màu mây lên một bên vai và cầm gậy, như những con voi hương được trang bị áo giáp vàng, đã đoạn trừ mọi phiền não, đã nhổ bỏ mọi tham ái, đã phá tan mọi cấu uế, đã gỡ bỏ mọi nút thắt, đã chặt đứt mọi ràng buộc, vây quanh Đức Thế Tôn.
So sayaṃ vītarāgo vītarāgehi, sayaṃ vītadoso vītadosehi, sayaṃ vītamoho vītamohehi, sayaṃ vītataṇho vītataṇhehi, sayaṃ nikkileso nikkilesehi, sayaṃ buddho anubuddhehi parivārito; pattaparivāritaṃ viya kesaraṃ, kesaraparivāritā viya kaṇṇikā, aṭṭhanāgasahassaparivārito viya chaddanto nāgarājā, navutihaṃsasahassaparivārito viya dhataraṭṭho haṃsarājā, senaṅgaparivārito viya cakkavattirājā, devagaṇaparivārito viya sakko devarājā, brahmagaṇaparivārito viya hārito mahābrahmā, aparimitakālasañcitapuññabalanibbattāya acinteyyāya anopamāya buddhalīlāya cando viya gaganatalaṃ taṃ maggaṃ paṭipanno hoti.
He, being himself free from passion, is surrounded by those free from passion; himself free from aversion, surrounded by those free from aversion; himself free from delusion, surrounded by those free from delusion; himself free from craving, surrounded by those free from craving; himself without defilements, surrounded by those without defilements; himself a Buddha, surrounded by those who have become Buddhas after him; like the filament surrounded by its petals, like the pericarp surrounded by its filaments, like Chaddanta the king of elephants surrounded by eight thousand elephants, like Dhataraṭṭha the king of swans surrounded by ninety thousand swans, like a universal monarch surrounded by the constituents of his army, like Sakka the king of gods surrounded by the host of gods, like Hārita the great Brahmā surrounded by the host of Brahmās, he had entered upon that path with the incomparable, unimaginable Buddha-grace produced by the power of merit accumulated over an immeasurable period of time, like the moon entering the expanse of the sky.
Ngài tự mình đã đoạn trừ tham ái, được bao quanh bởi các bậc đã đoạn trừ tham ái; tự mình đã đoạn trừ sân hận, được bao quanh bởi các bậc đã đoạn trừ sân hận; tự mình đã đoạn trừ si mê, được bao quanh bởi các bậc đã đoạn trừ si mê; tự mình đã đoạn trừ tham ái, được bao quanh bởi các bậc đã đoạn trừ tham ái; tự mình đã không còn phiền não, được bao quanh bởi các bậc đã không còn phiền não; tự mình là bậc Giác Ngộ, được bao quanh bởi các bậc tùy giác ngộ (A-la-hán); giống như nhụy hoa được bao quanh bởi các cánh hoa, giống như đài hoa được bao quanh bởi các nhụy hoa, giống như voi chúa Chaddanta được bao quanh bởi tám ngàn con voi, giống như vua thiên nga Dhataraṭṭha được bao quanh bởi chín mươi ngàn con thiên nga, giống như vua Chuyển Luân Thánh Vương được bao quanh bởi bốn binh chủng, giống như Sakka, vua chư Thiên, được bao quanh bởi đoàn chư Thiên, giống như Đại Phạm Thiên Hārita được bao quanh bởi đoàn Phạm Thiên, Ngài đã đi trên con đường đó với phong thái của một Đức Phật không thể nghĩ bàn, vô song, được sinh ra từ sức mạnh công đức tích lũy trong vô lượng thời gian, giống như mặt trăng trên bầu trời.
Athevaṃ bhagavantaṃ anopamāya buddhalīlāya gacchantaṃ bhikkhū ca okkhittacakkhū santindriye santamānase uparinabhe ṭhitaṃ puṇṇacandaṃ viya bhagavantaṃyeva namassamāne disvāva paribbājako attano parisaṃ avalokesi.
Then, upon seeing the Blessed One traveling with such incomparable Buddha-grace, and the bhikkhus with downcast eyes, serene faculties, and peaceful minds, who were paying homage only to the Blessed One, who was like the full moon in the sky above, the wanderer glanced at his own assembly.
Khi Đức Thế Tôn đang đi với phong thái Phật Đà vô song như vậy, vị du sĩ kia nhìn thấy các Tỳ-khưu với mắt nhìn xuống, các căn an tịnh, tâm an tịnh, đang đảnh lễ Đức Thế Tôn như vầng trăng tròn trên bầu trời, liền nhìn lại hội chúng của mình.
Sā hoti kājadaṇḍake olambetvā gahitoluggaviluggapiṭṭhakatidaṇḍamorapiñchamattikāpattapasibbakakuṇḍikādianekaparikkhārabhārabharitā.
That assembly was laden with the burden of many requisites—such as dilapidated and rickety small stools, tripods, peacock-feather fans, clay bowls, small bags, and water pots—which were carried hanging from shoulder-poles.
Hội chúng của ông ta đầy ắp các vật dụng của du sĩ như gậy, ghế ba chân đã cũ nát hư hỏng, lông công, bình bát đất, túi vải, bình nước, v.v., treo lủng lẳng trên cây gậy mang vai.
‘‘Asukassa hatthā sobhaṇā, asukassa pādā’’ti evamādiniratthakavacanā mukharā vikiṇṇavācā adassanīyā apāsādikā.
They were boisterous, speaking useless words such as, "So-and-so's hands are beautiful, so-and-so's feet are beautiful," with scattered speech, unpleasant to see, and uninspiring.
Họ nói những lời vô ích như: “Tay của người kia đẹp quá, chân của người kia đẹp quá”, v.v., ồn ào, lời nói tán loạn, không đáng nhìn, không đáng kính.
Tassa taṃ disvā vippaṭisāro udapādi.
Seeing that, remorse arose in him.
Khi nhìn thấy điều đó, vị du sĩ ấy khởi lên sự hối hận.
Idāni tena bhagavato vaṇṇo vattabbo bhaveyya.
At this point, he should have spoken in praise of the Blessed One.
Đáng lẽ lúc này ông ta phải ca ngợi Đức Thế Tôn.
Yasmā panesa lābhasakkārahāniyā ceva pakkhahāniyā ca niccampi bhagavantaṃ usūyati.
But because of the loss of gains and honor, and the loss of his following, he was always jealous of the Blessed One.
Tuy nhiên, vì ông ta luôn ganh tị với Đức Thế Tôn do sự mất mát lợi lộc và danh tiếng.
Aññatitthiyānañhi yāva buddho loke nuppajjati, tāvadeva lābhasakkārā nibbattanti, buddhuppādato pana paṭṭhāya parihīnalābhasakkārā honti, sūriyuggamane khajjopanakā viya nissirīkataṃ āpajjanti.
For as long as a Buddha does not arise in the world, the other sectarians receive gains and honor, but from the time of a Buddha's arising, their gains and honor diminish; like fireflies at sunrise, they become devoid of splendor.
Quả thật, đối với các ngoại đạo, chừng nào Đức Phật chưa xuất hiện trên thế gian, chừng đó họ còn có được lợi lộc và danh tiếng; nhưng từ khi Đức Phật xuất hiện, lợi lộc và danh tiếng của họ suy giảm, trở nên không còn vẻ vang như đom đóm khi mặt trời mọc.
Upatissakolitānañca sañjayassa santike pabbajitakāleyeva paribbājakā mahāparisā ahesuṃ, tesu pana pakkantesu sāpi tesaṃ parisā bhinnā.
Even at the time when Upatissa and Kolita went forth under Sañjaya, the wanderers had a large following, but when those two left, that following of theirs broke up.
Và khi Upatissa và Kolita còn xuất gia với Sañjaya, hội chúng của ông ta rất đông đảo, nhưng khi họ rời đi, hội chúng đó cũng tan rã.
Iti imehi dvīhi kāraṇehi ayaṃ paribbājako yasmā niccampi bhagavantaṃ usūyati, tasmā taṃ usūyavisuggāraṃ uggiranto ratanattayassa avaṇṇameva bhāsatīti veditabbo.
It should be understood that due to these two reasons, this wanderer was always jealous of the Blessed One; therefore, vomiting out the venom of that jealousy, he spoke only in dispraise of the Triple Gem.
Vì vậy, do hai lý do này, vị du sĩ này luôn ganh tị với Đức Thế Tôn, nên cần phải hiểu rằng ông ta đang phun ra chất độc ganh tị đó, chỉ nói lời phỉ báng Tam Bảo.
Tattha ambalaṭṭhikāti rañño uyyānaṃ.
Therein, Ambalaṭṭhikā is the king's park.
Ở đây, Ambalaṭṭhikā là vườn của nhà vua.
Tassa kira dvārasamīpe taruṇaambarukkho atthi, taṃ ‘‘ambalaṭṭhikā’’ti vadanti.
It is said that near its gate there was a young mango tree, which they called "ambalaṭṭhikā" (the tender mango).
Nghe nói, gần cổng vườn có một cây xoài non, người ta gọi đó là “Ambalaṭṭhikā”.
Tassa avidūre bhavattā uyyānampi ambalaṭṭhikā tveva saṅkhyaṃ gataṃ.
Because it was not far from it, the park also came to be known as Ambalaṭṭhikā.
Vì khu vườn nằm không xa cây xoài đó, nên khu vườn cũng được gọi là Ambalaṭṭhikā.
Taṃ chāyūdakasampannaṃ pākāraparikkhittaṃ suyojitadvāraṃ mañjusā viya suguttaṃ.
It was endowed with shade and water, enclosed by a wall, with a well-fitted gate, and as secure as a chest.
Khu vườn đó có nhiều bóng mát và nước, được bao quanh bởi tường rào, cổng được lắp đặt chắc chắn, được bảo vệ cẩn mật như một chiếc rương.
Tattha rañño kīḷanatthaṃ paṭibhānacittavicittaṃ agāraṃ akaṃsu.
There, they had built a house, exquisitely beautiful with spontaneous and imaginative artistry, for the king's recreation.
Ở đó, người ta đã xây một ngôi nhà lộng lẫy, tinh xảo, đẹp đẽ để nhà vua vui chơi.
Taṃ ‘‘rājāgāraka’’nti vuccati.
It is called the "royal rest house."
Ngôi nhà đó được gọi là “nhà vua” (Rājāgāraka).
Suppiyopi khoti suppiyopi tasmiṃ ṭhāne sūriyaṃ oloketvā – ‘‘akālo dāni gantuṃ, bahū khuddakamahallakā paribbājakā, bahuparissayo ca ayaṃ maggo corehipi vāḷayakkhehipi vāḷamigehipi.
Suppiya also means: Suppiya also, at that place, looked at the sun and thought, "It is now the wrong time to travel. There are many wanderers, both young and old, and this road is very dangerous because of thieves, fierce yakkhas, and wild beasts.
Suppiya cũng vậy, Suppiya cũng nhìn mặt trời ở nơi đó và nghĩ: “Bây giờ không phải lúc để đi nữa, có rất nhiều du sĩ nhỏ tuổi và lớn tuổi, và con đường này rất nguy hiểm bởi cướp bóc, yêu quái và thú dữ.
Ayaṃ kho pana samaṇo gotamo uyyānaṃ paviṭṭho, samaṇassa ca gotamassa vasanaṭṭhāne devatā ārakkhaṃ gaṇhanti, handāhampi idha ekarattivāsaṃ upagantvā sveva gamissāmī’’ti tadevuyyānaṃ pāvisi.
But this recluse Gotama has entered the park, and in the dwelling place of the recluse Gotama, deities provide protection. Well then, I too will take up a one-night stay here and go tomorrow." So he entered that same park.
Sa-môn Gotama này đã vào khu vườn, và ở nơi Sa-môn Gotama trú ngụ, các vị chư Thiên sẽ bảo vệ, vậy thì ta cũng nên ở lại đây một đêm và ngày mai sẽ đi.” Thế là ông ta cũng vào khu vườn đó.
Tato bhikkhusaṅgho bhagavato vattaṃ dassetvā attano attano vasanaṭṭhānaṃ sallakkhesi.
Then the Saṅgha of bhikkhus, having shown their duties towards the Blessed One, each marked out his own dwelling place.
Sau đó, Tăng đoàn đã thực hiện các bổn phận đối với Đức Thế Tôn và chọn chỗ ở cho riêng mình.
Paribbājakopi uyyānassa ekapasse paribbājakaparikkhāre otāretvā vāsaṃ upagacchi saddhiṃ attano parisāya.
The wanderer also, on one side of the park, had the wanderers' requisites unloaded and took up residence with his assembly.
Vị du sĩ kia cũng hạ các vật dụng của du sĩ xuống một bên khu vườn và trú ngụ cùng với hội chúng của mình.
Pāḷiyamārūḷhavaseneva pana – ‘‘saddhiṃ attano antevāsinā brahmadattena māṇavenā’’ti vuttaṃ.
However, it is stated according to the way it is presented in the Pāḷi text: " together with his disciple, the young man Brahmadatta."
Tuy nhiên, trong Pāḷi, chỉ nói theo cách thông thường: “cùng với đệ tử của mình là thanh niên Brahmadatta.”
Evaṃ vāsaṃ upagato pana so paribbājako rattibhāge dasabalaṃ olokesi.
Having thus taken up residence, that wanderer looked at the one of Ten Powers during the night.
Khi đã trú ngụ như vậy, vị du sĩ đó vào ban đêm đã nhìn Đức Thập Lực (Đức Phật).
Tasmiñca samaye samantā vippakiṇṇatārakā viya padīpā jalanti, majjhe bhagavā nisinno hoti, bhikkhusaṅgho ca bhagavantaṃ parivāretvā.
And at that time, lamps were burning all around like scattered stars, and in the middle sat the Blessed One, with the Saṅgha of bhikkhus surrounding him.
Vào lúc đó, các ngọn đèn sáng rực như những vì sao rải rác khắp nơi, Đức Thế Tôn đang ngồi ở giữa, và Tăng đoàn đang vây quanh Đức Thế Tôn.
Tattha ekabhikkhussapi hatthakukkuccaṃ vā pādakukkuccaṃ vā ukkāsitasaddo vā khipitasaddo vā natthi.
There, not even a single bhikkhu made a clumsy movement of the hand or foot, nor was there the sound of coughing or sneezing.
Trong số các Tỳ-khưu đó, không một ai có cử chỉ tay chân lóng ngóng, tiếng ho hay tiếng khạc nhổ.
Sā hi parisā attano ca sikkhitasikkhatāya satthari ca gāravenāti dvīhi kāraṇehi nivāte padīpasikhā viya niccalā sannisinnāva ahosi.
Indeed, for two reasons—their own well-trained discipline and their reverence for the Teacher—that assembly was sitting perfectly still, like the flame of a lamp in a windless place.
Hội chúng đó, do sự tu học đã được rèn luyện của chính mình và sự tôn kính đối với Bậc Đạo Sư, đã ngồi yên lặng như ngọn đèn trong nơi không có gió.
Paribbājako taṃ vibhūtiṃ disvā attano parisaṃ olokesi.
The wanderer saw that splendor and looked at his own assembly.
Vị du sĩ nhìn thấy sự trang nghiêm đó liền nhìn lại hội chúng của mình.
Tattha keci hatthaṃ khipanti, keci pādaṃ, keci vippalapanti, keci nillālitajivhā paggharitakheḷā, dante khādantā kākacchamānā gharugharupassāsino sayanti.
There, some were flinging their arms, some their legs; some were talking deliriously; some were sleeping with their tongues lolling out, saliva dribbling, grinding their teeth, making croaking sounds, and breathing heavily.
Ở đó, một số người vung tay, một số người vung chân, một số người lảm nhảm, một số người lưỡi thè ra, nước dãi chảy ròng, nghiến răng, kêu réo và thở khò khè mà ngủ.
So ratanattayassa guṇavaṇṇe vattabbepi issāvasena puna avaṇṇameva ārabhi.
He, although he should have spoken in praise of the qualities of the Triple Gem, again began to speak only in dispraise due to jealousy.
Mặc dù đáng lẽ phải ca ngợi các đức tính của Tam Bảo, nhưng do sự ganh tị, ông ta lại bắt đầu phỉ báng.
Brahmadatto pana vuttanayeneva vaṇṇaṃ.
Brahmadatta, however, spoke in praise in the way already described.
Còn Brahmadatta thì ca ngợi theo cách đã nói.
Tena vuttaṃ – ‘‘tatrāpi sudaṃ suppiyo paribbājako’’ti sabbaṃ vattabbaṃ.
Because of that, it was said: " There, too, it seems, the wanderer Suppiya," and all of it should be stated.
Vì vậy, có lời nói: “Ở đó, du sĩ Suppiya cũng vậy,” tất cả đều phải được nói.
Tattha tatrāpīti tasmimpi, ambalaṭṭhikāyaṃ uyyāneti attho.
Therein, there, too means: in that very park at Ambalaṭṭhikā; that is the meaning.
Ở đây, tatrāpī có nghĩa là “cũng ở đó, trong khu vườn Ambalaṭṭhikā.”
3. Sambahulānanti bahukānaṃ.
3. A good number of means many.
3. Sambahulānaṃ có nghĩa là “nhiều.”
Tattha vinayapariyāyena tayo janā ‘‘sambahulā’’ti vuccanti.
In this context, according to the Vinaya tradition, three persons are called "a good number."
Trong đó, theo cách nói của Luật tạng, ba người được gọi là “sambahulā” (nhiều).
Tato paraṃ saṅgho.
More than that is a Saṅgha.
Từ đó trở đi là Tăng đoàn.
Suttantapariyāyena pana tayo tayova tato paṭṭhāya sambahulā.
However, according to the Suttanta tradition, from three onwards are a good number.
Còn theo cách nói của Kinh tạng, ba người trở lên được gọi là sambahulā.
Idha suttantapariyāyena ‘‘sambahulā’’ti veditabbā.
Here, "a good number" should be understood according to the Suttanta tradition.
Ở đây, cần phải hiểu là “sambahulā” theo cách nói của Kinh tạng.
Maṇḍalamāḷeti katthaci dve kaṇṇikā gahetvā haṃsavaṭṭakacchannena katā kūṭāgārasālāpi ‘‘maṇḍalamāḷo’’ti vuccati, katthaci ekaṃ kaṇṇikaṃ gahetvā thambhapantiṃ parikkhipitvā katā upaṭṭhānasālāpi ‘‘maṇḍalamāḷo’’ti vuccati.
In the round pavilion: In some places, a hall with a pinnacled roof, made by taking two pinnacles and covering it with a swan-circle pattern, is also called a "round pavilion." In some places, a service hall, made by taking one pinnacle and surrounding it with a row of pillars, is also called a "round pavilion."
Maṇḍalamāḷe – ở một số nơi, một sảnh đường có mái nhọn được làm bằng cách lấy hai đỉnh và lợp bằng hình chim thiên nga được gọi là “maṇḍalamāḷa”; ở một số nơi khác, một sảnh đường phục vụ được làm bằng cách lấy một đỉnh và bao quanh bởi hàng cột cũng được gọi là “maṇḍalamāḷa”.
Idha pana nisīdanasālā ‘‘maṇḍalamāḷo’’ti veditabbo.
Here, however, a sitting hall should be understood as a "round pavilion."
Ở đây, cần phải hiểu “maṇḍalamāḷa” là sảnh đường để ngồi.
Sannisinnānanti nisajjanavasena.
Were sitting together refers to the act of sitting.
Sannisinnānaṃ có nghĩa là “theo cách ngồi xuống.”
Sannipatitānanti samodhānavasena.
Were assembled together refers to the act of coming together.
Sannipatitānaṃ có nghĩa là “theo cách tụ họp.”
Ayaṃ saṅkhiyadhammoti saṅkhiyā vuccati kathā, kathādhammoti attho.
This topic of conversation: saṅkhiyā is said to be talk; the meaning is the substance of the talk.
Ayaṃ saṅkhiyadhammo – saṅkhiyā có nghĩa là lời nói, tức là “pháp thoại”.
Udapādīti uppanno.
Arose means it came up.
Udapādī có nghĩa là “đã phát sinh”.
Katamo pana soti?
But what was it?
Vậy đó là gì?
Acchariyaṃ āvusoti evamādi.
"It is wonderful, friends," and so forth.
Là “Thật hy hữu, thưa chư hiền giả,” v.v.
Tattha andhassa pabbatārohaṇaṃ viya niccaṃ na hotīti acchariyaṃ. Ayaṃ tāva saddanayo.
Therein, it is not something that happens constantly, like a blind person climbing a mountain, thus it is wonderful. This, for now, is the etymological explanation.
Ở đây, điều gì không xảy ra thường xuyên, giống như người mù leo núi, thì được gọi là acchariyaṃ (hy hữu). Đây là cách giải thích theo ngữ pháp.
Ayaṃ pana aṭṭhakathānayo – accharāyogganti acchariyaṃ. Accharaṃ paharituṃ yuttanti attho.
This, however, is the commentarial explanation: it is worthy of a snap of the fingers, thus it is wonderful. The meaning is that it is fitting to snap one's fingers.
Còn đây là cách giải thích của Chú giải: điều gì đáng để vỗ tay thì gọi là acchariyaṃ. Có nghĩa là điều gì phù hợp để vỗ tay.
Abhūtapubbaṃ bhūtanti abbhutaṃ. Ubhayaṃ petaṃ vimhayassevādhivacanaṃ.
What has not been before has come to be, thus it is astounding. Both of these are synonyms for amazement.
Điều gì chưa từng xảy ra trước đây mà nay xảy ra thì gọi là abbhutaṃ (kỳ diệu). Cả hai từ này đều là đồng nghĩa của sự kinh ngạc.
Yāvañcidanti yāva ca idaṃ tena suppaṭividitatāya appameyyattaṃ dasseti.
To what an extent indicates immeasurability on account of its having been so well penetrated.
Yāvañcidaṃ – điều này thể hiện sự vô lượng của sự thấu hiểu hoàn hảo đó.
Idānissa suppaṭividitabhāvaṃ dassetuṃ ayañhītiādimāha.
Now, to show that it was thoroughly penetrated, he said, “For these...” and so on.
Bây giờ, để chỉ ra sự thấu hiểu rõ ràng này, Ngài nói: “ Ayañhi (Thật vậy)...” v.v.
Idaṃ vuttaṃ hoti yā ca ayaṃ bhagavatā ‘‘dhātuso, bhikkhave, sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi saddhiṃ saṃsandanti samenti, kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samenti.
This is what was said: That which was known by the Blessed One, this diversity of dispositions, diversity of inclinations, diversity of views, diversity of approvals, and diversity of preferences of beings, known by the knowledge of the diversity of dispositions, by the knowledge of omniscience, as if measuring with a bushel or weighing with a scale, when he said: “Monks, beings associate and come together by way of element. Those of inferior disposition associate and come together with those of inferior disposition. Those of noble disposition associate and come together with those of noble disposition.
Điều này có nghĩa là, sự khác biệt về khuynh hướng (nānādhimuttikatā), sự khác biệt về ý định (nānajjhāsayatā), sự khác biệt về quan điểm (nānādiṭṭhikatā), sự khác biệt về sự chấp nhận (nānākhantitā), sự khác biệt về sở thích (nānārucitā) của chúng sanh, như Đức Thế Tôn đã nói: “Này các Tỳ-khưu, chúng sanh hòa hợp và kết hợp theo giới (dhātu). Những người có khuynh hướng thấp kém hòa hợp và kết hợp với những người có khuynh hướng thấp kém. Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng.
Atītampi kho, bhikkhave, addhānaṃ dhātusova sattā saṃsandiṃsu samiṃsu, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandiṃsu samiṃsu, anāgatampi kho, bhikkhave, addhānaṃ…pe… saṃsandissanti samessanti, etarahipi kho, bhikkhave, paccuppannaṃ addhānaṃ dhātusova sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samentī’’ti evaṃ sattānaṃ nānādhimuttikatā, nānajjhāsayatā, nānādiṭṭhikatā, nānākhantitā, nānārucitā, nāḷiyā minantena viya tulāya tulayantena viya ca nānādhimuttikatāñāṇena sabbaññutaññāṇena viditā, sā yāva suppaṭividitā.
In the past, too, monks, beings associated and came together by way of element. Those of inferior disposition... those of noble disposition associated and came together with those of noble disposition. In the future, too, monks... they will associate and come together. And now, too, monks, in the present, beings associate and come together by way of element. Those of inferior disposition... those of noble disposition associate and come together with those of noble disposition”—that was so thoroughly penetrated.
Này các Tỳ-khưu, trong thời quá khứ, chúng sanh cũng hòa hợp và kết hợp theo giới. Những người có khuynh hướng thấp kém... v.v... Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng. Này các Tỳ-khưu, trong thời vị lai... v.v... sẽ hòa hợp và kết hợp. Này các Tỳ-khưu, ngay cả trong thời hiện tại này, chúng sanh cũng hòa hợp và kết hợp theo giới. Những người có khuynh hướng thấp kém... v.v... Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng.” Sự khác biệt về khuynh hướng này đã được Ngài biết bằng trí tuệ về sự khác biệt về khuynh hướng (nānādhimuttikatāñāṇa), tức là Nhất Thiết Chủng Trí (sabbaññutaññāṇa), như người đo bằng ống đong (nāḷi) hoặc cân bằng cân (tulā). Sự khác biệt đó được thấu hiểu một cách rất rõ ràng.
Dvepi nāma sattā ekajjhāsayā dullabhā lokasmiṃ.
Even two beings of the same inclination are rare in the world.
Thật khó tìm thấy hai chúng sanh có cùng một ý định trên thế gian.
Ekasmiṃ gantukāme eko ṭhātukāmo hoti, ekasmiṃ pivitukāme eko bhuñjitukāmo.
When one wants to go, another wants to stay; when one wants to drink, another wants to eat.
Khi một người muốn đi, người kia lại muốn ở lại; khi một người muốn uống, người kia lại muốn ăn.
Imesu cāpi dvīsu ācariyantevāsīsu ayañhi ‘‘suppiyo paribbājako…pe… bhagavantaṃ piṭṭhito piṭṭhito anubandhā honti bhikkhusaṅghañcā’’ti.
And even among these two, the teacher and the disciple, it is said: “For these... the wanderer Suppiya... were following closely behind the Blessed One and the Sangha of monks.”
Trong hai vị thầy và đệ tử này, “Thật vậy, du sĩ Suppiya... v.v... theo sau Đức Thế Tôn và Tăng đoàn”.
Tattha itihameti itiha ime, evaṃ imeti attho.
Therein, itihameti means iti ha ime, the meaning is “thus these.”
Ở đây, “itihame” có nghĩa là “itiha ime”, tức là “những người này như vậy”.
Sesaṃ vuttanayameva.
The rest is in the way already stated.
Phần còn lại cũng theo cách đã nói.
4. Atha kho bhagavā tesaṃ bhikkhūnaṃ imaṃ saṅkhiyadhammaṃ viditvāti ettha viditvāti sabbaññutaññāṇena jānitvā.
4. Then the Blessed One, having known this reasoned talk of those monks: Here, having known means having known with the knowledge of omniscience.
4. Trong câu “Rồi Đức Thế Tôn, sau khi biết được lời bàn luận này của các Tỳ-khưu”, chữ “biết được” (viditvā) có nghĩa là biết bằng Nhất Thiết Chủng Trí.
Bhagavā hi katthaci maṃsacakkhunā disvā jānāti – ‘‘addasā kho bhagavā mahantaṃ dārukkhandhaṃ gaṅgāya nadiyā sotena vuyhamāna’’ntiādīsu (saṃ. ni. 4.241) viya.
For the Blessed One sometimes knows by seeing with the fleshly eye, as in such passages as: “The Blessed One saw a great log being carried along by the current of the river Ganges.”
Đức Thế Tôn đôi khi biết bằng cách thấy bằng nhục nhãn (maṃsacakkhu), như trong các đoạn: “Đức Thế Tôn đã thấy một khúc gỗ lớn đang trôi theo dòng sông Gaṅgā” v.v.
Katthaci dibbacakkhunā disvā jānāti – ‘‘addasā kho bhagavā dibbena cakkhunā visuddhena atikkantamānusakena tā devatāyo sahassasseva pāṭaligāme vatthūni parigaṇhantiyo’’tiādīsu (dī. ni. 2.152) viya.
Sometimes he knows by seeing with the divine eye, as in such passages as: “The Blessed One saw with the divine eye, purified and surpassing the human, those devatās taking possession of sites in the village of Pāṭali.”
Đôi khi Ngài biết bằng cách thấy bằng thiên nhãn (dibbacakkhu), như trong các đoạn: “Đức Thế Tôn đã thấy bằng thiên nhãn thanh tịnh, siêu việt loài người, các vị thiên nữ ấy đang chiếm giữ các khu đất ở làng Pāṭali với số lượng hàng ngàn” v.v.
Katthaci pakatisotena sutvā jānāti – ‘‘assosi kho bhagavā āyasmato ānandassa subhaddena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 2.213) viya.
Sometimes he knows by hearing with the ordinary ear, as in such passages as: “The Blessed One heard this conversation of the venerable Ānanda with the wanderer Subhadda.”
Đôi khi Ngài biết bằng cách nghe bằng tai thường (pakatisota), như trong các đoạn: “Đức Thế Tôn đã nghe cuộc đàm thoại này giữa Tôn giả Ānanda và du sĩ Subhadda” v.v.
Katthaci dibbasotena sutvā jānāti – ‘‘assosi kho bhagavā dibbāya sotadhātuyā visuddhāya atikkantamānusikāya sandhānassa gahapatissa nigrodhena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 3.54) viya.
Sometimes he knows by hearing with the divine ear, as in such passages as: “The Blessed One heard with the divine ear element, purified and surpassing the human, this conversation of Sandhāna the householder with the wanderer Nigrodha.”
Đôi khi Ngài biết bằng cách nghe bằng thiên nhĩ (dibbasota), như trong các đoạn: “Đức Thế Tôn đã nghe bằng thiên nhĩ giới thanh tịnh, siêu việt loài người, cuộc đàm thoại này giữa gia chủ Sandhāna và du sĩ Nigrodha” v.v.
Idha pana sabbaññutaññāṇena sutvā aññāsi.
Here, however, he knew by hearing with the knowledge of omniscience.
Ở đây, Ngài đã biết bằng cách nghe với Nhất Thiết Chủng Trí.
Kiṃ karonto aññāsi?
While doing what did he know?
Ngài đã biết khi đang làm việc gì?
Pacchimayāmakiccaṃ, kiccañca nāmetaṃ sātthakaṃ, niratthakanti duvidhaṃ hoti.
While performing the duties of the last watch of the night. This duty is of two kinds: beneficial and without benefit.
Đó là công việc của canh cuối (pacchimayāmakicca). Và công việc này có hai loại: có lợi ích (sātthaka) và không có lợi ích (niratthaka).
Tattha niratthakakiccaṃ bhagavatā bodhipallaṅkeyeva arahattamaggena samugghātaṃ kataṃ.
Therein, the duty without benefit was completely eradicated by the Blessed One with the path of Arahantship right at the seat of enlightenment.
Trong đó, công việc không có lợi ích đã được Đức Thế Tôn nhổ tận gốc bằng đạo A-la-hán (arahattamagga) ngay tại Bồ-đề tòa (bodhipallaṅka).
Sātthakaṃyeva pana bhagavato kiccaṃ hoti.
Only beneficial duty remains for the Blessed One.
Nhưng công việc của Đức Thế Tôn chỉ là công việc có lợi ích.
Taṃ pañcavidhaṃ – purebhattakiccaṃ, pacchābhattakiccaṃ, purimayāmakiccaṃ, majjhimayāmakiccaṃ, pacchimayāmakiccanti.
It is fivefold: the duty before the meal, the duty after the meal, the duty of the first watch of the night, the duty of the middle watch of the night, and the duty of the last watch of the night.
Công việc đó có năm loại: công việc trước bữa ăn (purebhattakicca), công việc sau bữa ăn (pacchābhattakicca), công việc canh đầu (purimayāmakicca), công việc canh giữa (majjhimayāmakicca), và công việc canh cuối (pacchimayāmakicca).
Bhagavā hi pātova uṭṭhāya upaṭṭhākānuggahatthaṃ sarīraphāsukatthañca mukhadhovanādisarīraparikammaṃ katvā yāva bhikkhācāravelā tāva vivittāsane vītināmetvā, bhikkhācāravelāyaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ pārupitvā pattamādāya kadāci ekako, kadāci bhikkhusaṅghaparivuto, gāmaṃ vā nigamaṃ vā piṇḍāya pavisati; kadāci pakatiyā, kadāci anekehi pāṭihāriyehi vattamānehi.
The Blessed One, having risen early in the morning and performed bodily care such as washing his face for the well-being of his attendant and for his own physical comfort, would spend the time in a secluded seat until the time for the alms-round. At the time for the alms-round, having dressed, tied his waistband, put on his robe, and taken his bowl, he would enter a village or town for alms, sometimes alone, sometimes surrounded by the Sangha of monks; sometimes in the usual way, sometimes with many miracles occurring.
Đức Thế Tôn, vào buổi sáng sớm, thức dậy, làm các việc vệ sinh thân thể như rửa mặt v.v. để giúp đỡ các thị giả và để thân thể được thoải mái. Sau đó, Ngài an trú trong chỗ vắng vẻ cho đến giờ đi khất thực. Đến giờ khất thực, Ngài đắp y, thắt đai lưng, khoác y, cầm bát, đôi khi một mình, đôi khi có Tăng đoàn vây quanh, đi vào làng hoặc thị trấn để khất thực; đôi khi một cách tự nhiên, đôi khi với nhiều phép lạ xảy ra.
Seyyathidaṃ, piṇḍāya pavisato lokanāthassa purato purato gantvā mudugatavātā pathaviṃ sodhenti, valāhakā udakaphusitāni muñcantā magge reṇuṃ vūpasametvā upari vitānaṃ hutvā tiṭṭhanti, apare vātā pupphāni upasaṃharitvā magge okiranti, unnatā bhūmippadesā onamanti, onatā unnamanti, pādanikkhepasamaye samāva bhūmi hoti, sukhasamphassāni padumapupphāni vā pāde sampaṭicchanti.
For instance, when the Lord of the World enters for alms, gentle winds go before him, cleaning the path. Clouds, releasing drops of water, settle the dust on the road and remain above like a canopy. Other winds gather flowers and scatter them on the path. Raised areas of ground become level, and low areas rise up. At the moment his foot is placed, the ground becomes even. Lotus flowers with a pleasant touch receive his feet.
Như thế này: khi Đức Thế Tôn, vị cứu tinh của thế gian, đi khất thực, những làn gió nhẹ nhàng đi trước dọn sạch mặt đất; những đám mây nhỏ thả những giọt nước làm lắng bụi trên đường, rồi đứng lại như một mái che ở phía trên; những làn gió khác mang hoa đến rải trên đường; những chỗ đất cao thì hạ thấp xuống, những chỗ đất thấp thì nâng cao lên, khi Ngài đặt chân xuống thì mặt đất bằng phẳng; hoặc những bông sen mềm mại đón lấy chân Ngài.
Indakhīlassa anto ṭhapitamatte dakkhiṇapāde sarīrato chabbaṇṇarasmiyo nikkhamitvā suvaṇṇarasapiñjarāni viya citrapaṭaparikkhittāni viya ca pāsādakūṭāgārādīni alaṅkarontiyo ito cito ca dhāvanti, hatthiassavihaṅgādayo sakasakaṭṭhānesu ṭhitāyeva madhurenākārena saddaṃ karonti, tathā bherivīṇādīni tūriyāni manussānañca kāyūpagāni ābharaṇāni.
The moment his right foot is placed within the city-gate post, six-colored rays emanate from his body and dart here and there, adorning palaces, storied dwellings, and so on, making them like golden cages or as if draped with colorful cloths. Elephants, horses, birds, and others, while remaining in their own places, make sounds in a sweet manner, as do drums, lutes, and other musical instruments, and the ornaments worn on people's bodies.
Khi bàn chân phải của Ngài vừa đặt vào ngưỡng cửa (indakhīla), sáu màu hào quang từ thân Ngài phóng ra, chiếu sáng khắp nơi, trang hoàng các cung điện, lầu các v.v. như được bao phủ bởi nước vàng ròng hoặc được trang trí bằng những tấm thảm đầy màu sắc. Voi, ngựa, chim chóc v.v. đang ở chỗ của chúng cũng phát ra tiếng kêu ngọt ngào; các nhạc cụ như trống, đàn vīṇā v.v. và các đồ trang sức trên thân người cũng vậy.
Tena saññāṇena manussā jānanti – ‘‘ajja bhagavā idha piṇḍāya paviṭṭho’’ti.
By this sign, people know: “Today the Blessed One has entered here for alms.”
Nhờ những dấu hiệu đó, mọi người biết: “Hôm nay, Đức Thế Tôn đã vào đây để khất thực”.
Te sunivatthā supārutā gandhapupphādīni ādāya gharā nikkhamitvā antaravīthiṃ paṭipajjitvā bhagavantaṃ gandhapupphādīhi sakkaccaṃ pūjetvā vanditvā – ‘‘amhākaṃ, bhante, dasa bhikkhū, amhākaṃ vīsati, paññāsaṃ…pe… sataṃ dethā’’ti yācitvā bhagavatopi pattaṃ gahetvā āsanaṃ paññapetvā sakkaccaṃ piṇḍapātena paṭimānenti.
They, well-dressed and well-robed, taking perfumes, flowers, and so forth, leave their homes, enter the main street, respectfully worship the Blessed One with perfumes, flowers, and so forth, and having paid homage, they request: “Venerable Sir, give us ten monks; give us twenty, fifty… up to… a hundred.” Taking the Blessed One’s bowl as well, they prepare a seat and respectfully attend to him with almsfood.
Họ, mặc y phục chỉnh tề, khoác áo ngoài cẩn thận, mang theo hương hoa và các vật phẩm khác, rời nhà đi ra con đường giữa, thành kính cúng dường và đảnh lễ Đức Thế Tôn bằng hương hoa và các vật phẩm khác, rồi thỉnh cầu: “Bạch Thế Tôn, xin Ngài ban cho chúng con mười vị Tỳ-khưu, hai mươi vị, năm mươi vị… cho đến một trăm vị.” Sau khi thỉnh cầu như vậy, họ nhận bát của Đức Thế Tôn, sắp đặt chỗ ngồi, và thành kính chờ đợi Ngài thọ thực.
Bhagavā katabhattakicco tesaṃ sattānaṃ cittasantānāni oloketvā tathā dhammaṃ deseti, yathā keci saraṇagamanesu patiṭṭhahanti, keci pañcasu sīlesu, keci sotāpattisakadāgāmianāgāmiphalānaṃ aññatarasmiṃ; keci pabbajitvā aggaphale arahatteti.
The Blessed One, having finished his meal, surveys the mental continuities of those beings and teaches the Dhamma in such a way that some become established in the goings for refuge, some in the five precepts, some in one of the fruits of stream-entry, once-returning, or non-returning; and some, having gone forth, in the highest fruit, Arahantship.
Đức Thế Tôn, sau khi hoàn tất việc thọ thực, quán sát tâm thức của những chúng sinh ấy và thuyết giảng Dhamma sao cho một số người an trú vào Tam quy, một số an trú vào năm giới, một số đạt được một trong các quả vị Dự lưu (Sotāpatti), Nhất lai (Sakadāgāmi), Bất hoàn (Anāgāmi); một số xuất gia và đạt được quả vị tối thượng là A-la-hán (Arahatta).
Evaṃ mahājanaṃ anuggahetvā uṭṭhāyāsanā vihāraṃ gacchati.
Having thus favored the great assembly of people, he rises from his seat and goes to the monastery.
Sau khi độ chúng như vậy, Ngài rời chỗ ngồi và đi về tịnh xá.
Tattha gantvā maṇḍalamāḷe paññattavarabuddhāsane nisīdati, bhikkhūnaṃ bhattakiccapariyosānaṃ āgamayamāno.
Having gone there, he sits on the excellent Buddha-seat prepared in the assembly hall, waiting for the monks to finish their meal duties.
Đến đó, Ngài ngồi trên Phật tòa cao quý đã được sắp đặt trong sảnh đường hình tròn, chờ đợi chư Tỳ-khưu hoàn tất việc thọ thực.
Tato bhikkhūnaṃ bhattakiccapariyosāne upaṭṭhāko bhagavato nivedeti.
Then, when the monks have finished their meal duties, the attendant informs the Blessed One.
Sau đó, khi chư Tỳ-khưu đã hoàn tất việc thọ thực, vị thị giả báo cho Đức Thế Tôn biết.
Atha bhagavā gandhakuṭiṃ pavisati.
Then the Blessed One enters the gandhakuṭi.
Rồi Đức Thế Tôn đi vào Gandhakuṭi.
Idaṃ tāva purebhattakiccaṃ.
This, for now, is the duty before the meal.
Đây là Phật sự trước bữa ăn (purebhattakicca).
Atha bhagavā evaṃ katapurebhattakicco gandhakuṭiyā upaṭṭhāne nisīditvā pāde pakkhāletvā pādapīṭhe ṭhatvā bhikkhusaṅghaṃ ovadati – ‘‘bhikkhave, appamādena sampādetha, dullabho buddhuppādo lokasmiṃ, dullabho manussattapaṭilābho, dullabhā sampatti, dullabhā pabbajjā, dullabhaṃ saddhammassavana’’nti.
Then the Blessed One, having thus completed his duties before the meal, sits in attendance at the gandhakuṭi, washes his feet, and standing on the footstool, admonishes the Saṅgha of monks: “Monks, strive with diligence. Rare is the arising of a Buddha in the world, rare is the attainment of a human state, rare is good fortune, rare is the going forth, rare is the hearing of the true Dhamma.”
Sau khi hoàn tất Phật sự trước bữa ăn như vậy, Đức Thế Tôn ngồi tại tiền sảnh của Gandhakuti, rửa chân, đặt chân lên bệ rửa chân, rồi giáo huấn Tăng đoàn Tỳ-khưu: “Này chư Tỳ-khưu, hãy tinh tấn thành tựu (các pháp lành) với sự không phóng dật (appamāda), sự xuất hiện của chư Phật trong thế gian là khó, sự thành tựu thân người là khó, sự thành tựu (các điều kiện thuận lợi) là khó, sự xuất gia là khó, sự lắng nghe Chánh pháp là khó.”
Tattha keci bhagavantaṃ kammaṭṭhānaṃ pucchanti.
There, some ask the Blessed One for a meditation subject.
Trong số đó, một số vị thỉnh Đức Thế Tôn về đề mục thiền định (kammaṭṭhāna).
Bhagavāpi tesaṃ cariyānurūpaṃ kammaṭṭhānaṃ deti.
The Blessed One gives them a meditation subject suitable to their dispositions.
Đức Thế Tôn cũng ban đề mục thiền định phù hợp với căn tính của họ.
Tato sabbepi bhagavantaṃ vanditvā attano attano rattiṭṭhānadivāṭṭhānāni gacchanti.
Then all of them, having paid homage to the Blessed One, go to their respective night-time and day-time places.
Sau đó, tất cả đều đảnh lễ Đức Thế Tôn và đi đến chỗ ở ban đêm và chỗ ở ban ngày của mình.
Keci araññaṃ, keci rukkhamūlaṃ, keci pabbatādīnaṃ aññataraṃ, keci cātumahārājikabhavanaṃ…pe… keci vasavattibhavananti.
Some go to the forest, some to the foot of a tree, some to one of the mountains or other such places, some to the realm of the Four Great Kings… up to… some to the Vasavatti realm.
Một số đi vào rừng, một số đến gốc cây, một số đến một trong các ngọn núi, v.v., một số đến cõi Tứ Đại Thiên Vương (Cātumahārājika-bhāvana)… cho đến một số đến cõi Hóa Lạc Tự Tại Thiên (Vasavatti-bhāvana).
Tato bhagavā gandhakuṭiṃ pavisitvā sace ākaṅkhati, dakkhiṇena passena sato sampajāno muhuttaṃ sīhaseyyaṃ kappeti.
Then the Blessed One, entering the gandhakuṭi, if he wishes, lies down for a moment on his right side in the lion’s posture, mindful and fully aware.
Sau đó, Đức Thế Tôn đi vào Gandhakuti và nếu muốn, Ngài nằm nghỉ tư thế sư tử (sīhaseyya) trong chốc lát, tỉnh giác và chánh niệm, nghiêng về phía bên phải.
Atha samassāsitakāyo vuṭṭhahitvā dutiyabhāge lokaṃ voloketi.
Then, with his body refreshed, he rises and in the second part surveys the world.
Rồi, với thân thể đã được nghỉ ngơi, Ngài đứng dậy và quán sát thế gian vào phần thứ hai (của buổi chiều).
Tatiyabhāge yaṃ gāmaṃ vā nigamaṃ vā upanissāya viharati tattha mahājano purebhattaṃ dānaṃ datvā pacchābhattaṃ sunivattho supāruto gandhapupphādīni ādāya vihāre sannipatati.
In the third part, the great mass of people from the village or town near which he is staying, having given alms in the morning, gather at the monastery in the afternoon, well-dressed and well-robed, bearing perfumes, flowers, and so forth.
Vào phần thứ ba (của buổi chiều), đại chúng trong làng hay thị trấn mà Ngài đang trú ngụ, sau khi đã bố thí trước bữa ăn, mặc y phục chỉnh tề, khoác áo ngoài cẩn thận, mang theo hương hoa và các vật phẩm khác, tập trung tại tịnh xá.
Tato bhagavā sampattaparisāya anurūpena pāṭihāriyena gantvā dhammasabhāyaṃ paññattavarabuddhāsane nisajja dhammaṃ deseti kālayuttaṃ samayayuttaṃ, atha kālaṃ viditvā parisaṃ uyyojeti, manussā bhagavantaṃ vanditvā pakkamanti.
Then the Blessed One, with a miracle appropriate for the assembled company, goes to the Dhamma hall, sits on the excellent Buddha-seat that has been prepared, and teaches the Dhamma that is suitable for the time and occasion. Then, knowing the time, he dismisses the assembly. The people pay homage to the Blessed One and depart.
Sau đó, Đức Thế Tôn, với thần thông (pāṭihāriya) phù hợp với hội chúng đã tề tựu, đi đến Pháp đường, ngồi trên Phật tòa cao quý đã được sắp đặt và thuyết giảng Dhamma thích hợp với thời gian và hoàn cảnh. Rồi, biết đã đến lúc, Ngài giải tán hội chúng, và mọi người đảnh lễ Đức Thế Tôn rồi ra về.
Idaṃ pacchābhattakiccaṃ.
This is the duty after the meal.
Đây là Phật sự sau bữa ăn (pacchābhattakicca).
So evaṃ niṭṭhitapacchābhattakicco sace gattāni osiñcitukāmo hoti, buddhāsanā vuṭṭhāya nhānakoṭṭhakaṃ pavisitvā upaṭṭhākena paṭiyāditaudakena gattāni utuṃ gaṇhāpeti.
Having thus completed his duties after the meal, if he wishes to bathe his limbs, he rises from the Buddha-seat, enters the bathhouse, and has the attendant apply water that has been prepared to warm his limbs.
Sau khi hoàn tất Phật sự sau bữa ăn như vậy, nếu Ngài muốn tắm rửa thân thể, Ngài rời Phật tòa, đi vào phòng tắm và để thị giả dùng nước đã chuẩn bị sẵn để làm mát thân thể.
Upaṭṭhākopi buddhāsanaṃ ānetvā gandhakuṭipariveṇe paññapeti.
The attendant also brings the Buddha-seat and prepares it in the precincts of the gandhakuṭi.
Vị thị giả cũng mang Phật tòa đến và sắp đặt ở khu vực sân sau của Gandhakuti.
Bhagavā surattadupaṭṭaṃ nivāsetvā kāyabandhanaṃ bandhitvā uttarāsaṅgaṃ ekaṃsaṃ karitvā tattha gantvā nisīdati ekakova muhuttaṃ paṭisallīno, atha bhikkhū tato tato āgamma bhagavato upaṭṭhānaṃ āgacchanti.
The Blessed One, having put on a fine red double-layered robe, tied the waist-band, and arranged his upper robe over one shoulder, goes there and sits for a moment alone in seclusion. Then monks arrive from here and there to attend upon the Blessed One.
Đức Thế Tôn, mặc y phục trong màu đỏ thẫm, thắt đai lưng, khoác y thượng một bên vai, đi đến đó và ngồi một mình trong chốc lát để tịnh cư (paṭisallīna). Sau đó, chư Tỳ-khưu từ các nơi khác đến để hầu hạ Đức Thế Tôn.
Tattha ekacce pañhaṃ pucchanti, ekacce kammaṭṭhānaṃ, ekacce dhammassavanaṃ yācanti.
There, some ask questions, some ask for a meditation subject, and some request to hear the Dhamma.
Tại đó, một số vị thỉnh vấn đề, một số thỉnh đề mục thiền định, một số thỉnh nghe Pháp.
Bhagavā tesaṃ adhippāyaṃ sampādento purimayāmaṃ vītināmeti.
The Blessed One, fulfilling their wishes, passes the first watch of the night.
Đức Thế Tôn, đáp ứng nguyện vọng của họ, trải qua canh đầu (purimayāma).
Idaṃ purimayāmakiccaṃ.
This is the duty of the first watch.
Đây là Phật sự canh đầu (purimayāmakicca).
Pacchimayāmaṃ pana tayo koṭṭhāse katvā purebhattato paṭṭhāya nisajjāya pīḷitassa sarīrassa kilāsubhāvamocanatthaṃ ekaṃ koṭṭhāsaṃ caṅkamena vītināmeti.
Then, having divided the last watch into three parts, he spends one part in walking meditation to relieve the weariness of his body, which has been afflicted by sitting since before the meal.
Đối với canh cuối (pacchimayāma), Ngài chia làm ba phần. Phần thứ nhất, Ngài đi kinh hành để giải tỏa sự mệt mỏi của cơ thể do ngồi lâu từ trước bữa ăn.
Dutiyakoṭṭhāse gandhakuṭiṃ pavisitvā dakkhiṇena passena sato sampajāno sīhaseyyaṃ kappeti.
In the second part, he enters the gandhakuṭi and lies down on his right side in the lion’s posture, mindful and fully aware.
Trong phần thứ hai, Ngài đi vào Gandhakuti và nằm nghỉ tư thế sư tử, tỉnh giác và chánh niệm, nghiêng về phía bên phải.
Tatiyakoṭṭhāse paccuṭṭhāya nisīditvā purimabuddhānaṃ santike dānasīlādivasena katādhikārapuggaladassanatthaṃ buddhacakkhunā lokaṃ voloketi.
In the third part, he rises, and sitting down, surveys the world with his Buddha-eye to see individuals who have made their aspiration in the presence of previous Buddhas through giving, virtue, and so on.
Trong phần thứ ba, Ngài đứng dậy và ngồi xuống, quán sát thế gian bằng Phật nhãn (buddhacakkhu) để thấy những người đã tạo công đức như bố thí, trì giới, v.v., dưới sự hướng dẫn của chư Phật quá khứ.
Idaṃ pacchimayāmakiccaṃ.
This is the duty of the last watch.
Đây là Phật sự canh cuối (pacchimayāmakicca).
Ñatvā ca panassa etadahosi – ‘‘ime bhikkhū mayhaṃ sabbaññutaññāṇaṃ ārabbha guṇaṃ kathenti, etesañca sabbaññutaññāṇakiccaṃ na pākaṭaṃ, mayhameva pākaṭaṃ.
And having known, this occurred to him: “These monks are speaking of the quality of my knowledge of omniscience, but the function of the knowledge of omniscience is not clear to them; it is clear only to me.
Sau khi biết, ý nghĩ này khởi lên trong Ngài: “Chư Tỳ-khưu này đang ca ngợi công đức Toàn giác trí của Ta, nhưng công việc của Toàn giác trí này không hiển lộ đối với họ, mà chỉ hiển lộ đối với riêng Ta.
Mayi pana gate ete attano kathaṃ nirantaraṃ ārocessanti, tato nesaṃ ahaṃ taṃ aṭṭhuppattiṃ katvā tividhaṃ sīlaṃ vibhajanto, dvāsaṭṭhiyā ṭhānesu appaṭivattiyaṃ sīhanādaṃ nadanto, paccayākāraṃ samodhānetvā buddhaguṇe pākaṭe katvā, sineruṃ ukkhipento viya suvaṇṇakūṭena nabhaṃ paharanto viya ca dasasahassilokadhātukampanaṃ brahmajālasuttantaṃ arahattanikūṭena niṭṭhāpento desessāmi, sā me desanā parinibbutassāpi pañcavassasahassāni sattānaṃ amatamahānibbānaṃ sampāpikā bhavissatī’’ti.
When I go there, they will relate their conversation to me without interruption. Then, making that the occasion for the teaching, I will expound on the threefold virtue; roar the lion's roar, which is irrefutable in sixty-two instances; connect the law of dependent origination; clarify the qualities of a Buddha; and, as if lifting up Mount Sineru, as if striking the sky with a golden hammer, I will teach the Brahmajāla Suttanta, which causes the ten-thousandfold world-system to tremble, concluding it with the pinnacle of Arahantship. That teaching of mine, even after I have attained parinibbāna, will for five thousand years lead beings to the deathless, great Nibbāna.”
Nếu Ta đi, họ sẽ tiếp tục kể câu chuyện của mình. Do đó, Ta sẽ lấy câu chuyện đó làm duyên khởi (aṭṭhuppatti), phân tích ba loại giới (sīla), tuyên bố tiếng rống sư tử (sīhanāda) không thể bị phản bác ở sáu mươi hai điểm, tổng hợp các nhân duyên (paccayākāra), làm hiển lộ các đức Phật, và thuyết giảng kinh Phạm Võng (Brahmajāla-suttanta) làm rung chuyển mười ngàn thế giới, như thể nhấc núi Sineru hay dùng búa vàng đập vào bầu trời, kết thúc bằng đỉnh cao A-la-hán (arahatta). Bài pháp đó của Ta, dù Ta đã nhập Niết-bàn, sẽ là phương tiện đưa chúng sinh đến Đại Niết-bàn bất tử trong năm ngàn năm.”
Evaṃ cintetvā yena maṇḍalamāḷo tenupasaṅkamīti.
Having reflected thus, he approached the assembly hall.
Suy nghĩ như vậy, Ngài đi đến sảnh đường hình tròn.
Yenāti yena disābhāgena, so upasaṅkamitabbo.
By which means: by which direction he was to approach.
Yenā (bằng cách nào, nơi nào) có nghĩa là bằng phương hướng nào, nơi đó nên được đến.
Bhummatthe vā etaṃ karaṇavacanaṃ, yasmiṃ padese so maṇḍalamāḷo, tattha gatoti ayamettha attho.
Or, this instrumental phrase is used in the locative sense. The meaning here is: he went to that place where the assembly hall was.
Hoặc từ này (yena) là một từ chỉ công cụ (karaṇavacana) ở nghĩa vị trí (bhummattha), nghĩa là Ngài đã đến nơi mà sảnh đường hình tròn đó ở.
Paññatte āsane nisīdīti buddhakāle kira yattha yattha ekopi bhikkhu viharati sabbattha buddhāsanaṃ paññattameva hoti.
He sat down on the prepared seat: It is said that in the time of the Buddha, wherever even one monk was dwelling, a Buddha-seat was always kept prepared.
Ngồi trên chỗ đã được sắp đặt (paññatte āsane nisīdī): Người ta nói rằng vào thời Đức Phật, bất cứ nơi nào có một Tỳ-khưu trú ngụ, ở đó đều có một Phật tòa được sắp đặt.
Bhagavā kira attano santike kammaṭṭhānaṃ gahetvā phāsukaṭṭhāne viharante manasi karoti – ‘‘asuko mayhaṃ santike kammaṭṭhānaṃ gahetvā gato, sakkhissati nu kho visesaṃ nibbattetuṃ no vā’’ti.
It is said that the Blessed One would bear in mind those who had received a meditation subject from him and were dwelling in a suitable place, thinking: “Such-and-such a person received a meditation subject from me and has gone. Will he be able to produce a special attainment or not?”
Đức Thế Tôn thường quan tâm đến những vị đã nhận đề mục thiền định từ Ngài và đang trú ngụ ở những nơi thuận lợi: “Vị kia đã nhận đề mục thiền định từ Ta và đã đi, liệu có thể thành tựu được sự tiến bộ hay không?”
Atha naṃ passati kammaṭṭhānaṃ vissajjetvā akusalavitakkaṃ vitakkayamānaṃ, tato ‘‘kathañhi nāma mādisassa satthu santike kammaṭṭhānaṃ gahetvā viharantaṃ imaṃ kulaputtaṃ akusalavitakkā abhibhavitvā anamatagge vaṭṭadukkhe saṃsāressantī’’ti tassa anuggahatthaṃ tattheva attānaṃ dassetvā taṃ kulaputtaṃ ovaditvā ākāsaṃ uppatitvā puna attano vasanaṭṭhānameva gacchati.
Then He sees him, having abandoned his meditation subject, thinking an unwholesome thought. Thereupon, thinking, “How can unwholesome thoughts overcome this clansman—who is dwelling after having taken a meditation subject in the presence of a teacher like me—and cause him to transmigrate in the suffering of the round of rebirths, which has an unknown beginning?”, for the sake of helping him, He manifests Himself right there, advises that clansman, rises into the air, and then returns to His own dwelling place.
Rồi Ngài thấy vị ấy đã từ bỏ đề mục thiền, đang tư duy những ác tầm. Thế rồi, Ngài nghĩ: "Làm sao mà ác tầm lại có thể chế ngự và khiến người thiện gia này, người đã thọ nhận đề mục thiền từ một vị Thầy như Ta, phải luân hồi trong khổ đau của vòng luân hồi vô tận?" Vì lợi ích của vị ấy, Ngài hiện thân ngay tại đó, giáo huấn vị thiện gia ấy, rồi bay lên không trung và trở về chỗ ở của mình.
Athevaṃ ovadiyamānā te bhikkhū cintayiṃsu – ‘‘satthā amhākaṃ manaṃ jānitvā āgantvā amhākaṃ samīpe ṭhitaṃyeva attānaṃ dasseti’’.
Then, those bhikkhus, being thus advised, thought: “The Teacher, knowing our minds, comes and reveals Himself standing near us.”
Sau đó, những Tỳ-khưu được giáo huấn như vậy đã suy nghĩ: "Đức Đạo Sư biết tâm ý của chúng ta, Ngài đến và hiện thân ngay bên cạnh chúng ta."
Tasmiṃ khaṇe – ‘‘bhante, idha nisīdatha, idha nisīdathā’’ti āsanapariyesanaṃ nāma bhāroti.
At that moment, the search for a seat, saying, “Venerable sir, sit here, sit here,” is a burden.
Vào khoảnh khắc đó, việc tìm kiếm chỗ ngồi với lời thỉnh cầu "Bạch Thế Tôn, xin Ngài an tọa tại đây, xin Ngài an tọa tại đây" là một gánh nặng.
Te āsanaṃ paññapetvāva viharanti.
They dwell only after having prepared a seat.
Các Tỳ-khưu ấy đã trải chỗ ngồi sẵn và trú ngụ.
Yassa pīṭhaṃ atthi, so taṃ paññapeti.
Whoever has a stool, he prepares it.
Ai có ghế thì trải ghế.
Yassa natthi, so mañcaṃ vā phalakaṃ vā kaṭṭhaṃ vā pāsāṇaṃ vā vālukapuñjaṃ vā paññapeti.
Whoever does not have one, prepares a couch, or a plank, or a piece of wood, or a stone, or a heap of sand.
Ai không có thì trải giường, hoặc ván gỗ, hoặc khúc cây, hoặc tảng đá, hoặc đống cát.
Taṃ alabhamānā purāṇapaṇṇānipi saṅkaḍḍhitvā tattha paṃsukūlaṃ pattharitvā ṭhapenti.
Not obtaining these, they gather even old leaves and, spreading a rag-robe thereon, they place it.
Nếu không tìm được những thứ đó, họ sẽ gom những lá cây cũ, trải tấm vải nhặt từ đống rác lên đó và đặt xuống.
Idha pana rañño nisīdanāsanameva atthi, taṃ papphoṭetvā paññapetvā parivāretvā te bhikkhū bhagavato adhimuttikañāṇamārabbha guṇaṃ thomayamānā nisīdiṃsu.
But here, there was the king's very own seat for sitting. Having shaken it out and prepared it, those bhikkhus sat down surrounding it, praising the quality of the Blessed One, beginning with his adhimuttikañāṇa.
Tại đây, chỉ có chỗ ngồi của nhà vua. Các Tỳ-khưu đã phủi bụi, trải chỗ ngồi đó, vây quanh và ngồi xuống, tán thán công đức của Đức Thế Tôn liên quan đến trí tuệ tùy theo khuynh hướng (adhimuttikañāṇa).
Taṃ sandhāya vuttaṃ – ‘‘paññatte āsane nisīdī’’ti.
Referring to that, it was said: “He sat down on the prepared seat.”
Liên quan đến điều đó, đã được nói: "Ngồi trên chỗ đã được trải."
Evaṃ nisinno pana jānantoyeva kathāsamuṭṭhāpanatthaṃ bhikkhū pucchi.
Having sat down thus, however, though knowing, He asked the bhikkhus in order to raise the topic of conversation.
Đức Thế Tôn sau khi an tọa như vậy, dù đã biết rõ, vẫn hỏi các Tỳ-khưu để khởi đầu câu chuyện.
Te cassa sabbaṃ kathayiṃsu.
And they told Him everything.
Và các vị ấy đã kể lại tất cả cho Ngài.
Tena vuttaṃ – ‘‘nisajja kho bhagavā’’tiādi.
Therefore, it was said: “Having sat down, the Blessed One…,” and so on.
Do đó, đã được nói: "Này các Tỳ-khưu, Đức Thế Tôn đã an tọa," v.v.
Tattha kāya nutthāti katamāya nu kathāya sannisinnā bhavathāti attho.
Therein, kāya nuttha means: for what talk, now, are you assembled?
Trong đó, kāya nutthā có nghĩa là: "Các ngươi đang hội họp với câu chuyện gì?"
Kāya netthātipi pāḷi, tassā katamāya nu etthāti attho kāya notthātipi pāḷi.
There is also the reading kāya nettha; its meaning is: for what talk, now, here? There is also the reading kāya nottha.
Cũng có bản Pali là kāya netthā, có nghĩa là "Các ngươi đang hội họp với câu chuyện gì ở đây?" và cũng có bản Pali là kāya notthā.
Tassāpi purimoyeva attho.
Its meaning is also the same as the former.
Ý nghĩa của bản này cũng giống như bản trước.
Antarākathāti, kammaṭṭhānamanasikārauddesaparipucchādīnaṃ antarā aññā ekā kathā.
Antarākathā means a certain other talk in between the contemplation of the meditation subject, recitation, inquiry, and so on.
Antarākathā có nghĩa là: một câu chuyện khác xen vào giữa việc tác ý đề mục thiền, tụng đọc, hỏi đáp, v.v.
Vippakatāti, mama āgamanapaccayā apariniṭṭhitā sikhaṃ appattā.
Vippakatā means unfinished on account of my arrival, not having reached its culmination.
Vippakatā có nghĩa là: chưa hoàn tất, chưa đạt đến đỉnh điểm do sự hiện diện của Ta.
Tena kiṃ dasseti?
What does He show by this?
Điều đó muốn chỉ ra điều gì?
‘‘Nāhaṃ tumhākaṃ kathābhaṅgatthaṃ āgato, ahaṃ pana sabbaññutāya tumhākaṃ kathaṃ niṭṭhāpetvā matthakappattaṃ katvā dassāmīti āgato’’ti nisajjeva sabbaññupavāraṇaṃ pavāreti.
“I have not come to interrupt your conversation; rather, I have come because, through my omniscience, I will bring your talk to a conclusion and make it reach its culmination.” Thus, having just sat down, He extends the invitation of an omniscient one.
"Ta không đến để ngắt lời các ngươi, mà Ta đến với trí tuệ Toàn Giác để hoàn tất câu chuyện của các ngươi và đưa nó đến đỉnh điểm." Như vậy, ngay khi an tọa, Ngài đã tuyên bố sự toàn tri của mình.
Ayaṃ kho no, bhante, antarākathā vippakatā, atha bhagavā anuppattoti etthāpi ayamadhippāyo.
Also in the passage “This, venerable sir, was our talk in between that was unfinished, and then the Blessed One arrived,” this is the intention:
Trong câu "Này Thế Tôn, câu chuyện này của chúng con chưa hoàn tất, và Đức Thế Tôn đã đến," ý nghĩa cũng là như vậy.
Ayaṃ bhante amhākaṃ bhagavato sabbaññutaññāṇaṃ ārabbha guṇakathā vippakatā, na rājakathādikā tiracchānakathā, atha bhagavā anuppatto; taṃ no idāni niṭṭhāpetvā desethāti.
“Venerable sir, this talk of ours on the qualities concerning the Blessed One’s knowledge of omniscience was unfinished—not an animal talk such as talk about kings. Then the Blessed One arrived. Now, please conclude it for us and teach.”
Bạch Thế Tôn, câu chuyện này của chúng con chưa hoàn tất, đó là câu chuyện tán thán công đức trí tuệ Toàn Giác của Đức Thế Tôn, không phải là những câu chuyện thấp hèn như chuyện vua chúa, v.v. Và Đức Thế Tôn đã đến; xin Ngài hãy hoàn tất và thuyết giảng cho chúng con ngay bây giờ.
Ettāvatā ca yaṃ āyasmatā ānandena kamalakuvalayujjalavimalasādhurasasalilāya pokkharaṇiyā sukhāvataraṇatthaṃ nimmalasilātalaracanavilāsasobhitaratanasopānaṃ, vippakiṇṇamuttātalasadisavālukākiṇṇapaṇḍarabhūmibhāgaṃ titthaṃ viya suvibhattabhittivicitravedikāparikkhittassa nakkhattapathaṃ phusitukāmatāya viya, vijambhitasamussayassa pāsādavarassa sukhārohaṇatthaṃ dantamayasaṇhamuduphalakakañcanalatāvinaddhamaṇigaṇappabhāsamudayujjalasobhaṃ sopānaṃ viya, suvaṇṇavalayanūpurādisaṅghaṭṭanasaddasammissitakathitahasitamadhurassaragehajanavicaritassa uḷārissarivibhavasobhitassa mahāgharassa sukhappavesanatthaṃ suvaṇṇarajatamaṇimuttapavāḷādijutivissaravijjotitasuppatiṭṭhitavisāladvārabāhaṃ mahādvāraṃ viya ca atthabyañjanasampannassa buddhaguṇānubhāvasaṃsūcakassa imassa suttassa sukhāvagahaṇatthaṃ kāladesadesakavatthuparisāpadesapaṭimaṇḍitaṃ nidānaṃ bhāsitaṃ, tassatthavaṇṇanā samattāti.
And by this much, the explanation of the meaning of the introduction—spoken by the Venerable Ānanda, which, for the easy comprehension of this sutta that is endowed with meaning and phrasing and which proclaims the power of the Buddha’s qualities, is adorned with reference to the time, place, speaker, subject, and assembly—is complete. It is like a landing place with a jewel staircase, splendid with the beauty of its flawless stone-slab construction, for the easy descent into a lotus pond with water of fine flavor, clear, brilliant with lotuses and water lilies, and with a ground of white sand strewn with particles resembling scattered pearls. And it is like a staircase, resplendent with the combined radiance of multitudes of gems interwoven with golden creepers on smooth, soft, ivory planks, for the easy ascent to an excellent palace of magnificent height, which appears as if stretching out of a desire to touch the path of the stars, enclosed by variegated railings on well-portioned walls. And it is like a great gateway with well-established, wide doorposts, illuminated by the radiating brilliance of gold, silver, gems, pearls, coral, and so forth, for the easy entry into a great house, resplendent with the wealth of noble opulence, where household members move about, their speech and laughter mingled with the sweet sounds of the clinking of golden bracelets, anklets, and other ornaments.
Cho đến đây, phần giải thích ý nghĩa của Nidāna (phần dẫn nhập) đã hoàn tất. Nidāna này được trang hoàng bằng thời gian, nơi chốn, người thuyết, sự việc và thính chúng, do Tôn giả Ānanda thuyết giảng, nhằm giúp dễ dàng thấu hiểu bản kinh này, vốn đầy đủ ý nghĩa và văn từ, thể hiện oai lực của các phẩm chất Phật Đà. Nó giống như một cầu thang quý báu được trang trí bằng những phiến đá sạch sẽ, tinh khiết, lấp lánh như ngọc, để dễ dàng xuống một hồ sen có nước trong sạch, ngọt ngào, lấp lánh với sen hồng, sen xanh, sen trắng và sen xanh đậm; giống như một cầu thang làm bằng ngà voi, mịn màng, mềm mại, với những tấm ván được gắn chặt bằng dây vàng và tỏa sáng rực rỡ với ánh ngọc quý, để dễ dàng lên một cung điện vĩ đại, cao vút như muốn chạm đến dải ngân hà, được bao quanh bởi những bức tường được phân chia rõ ràng và những lan can trang trí công phu; và giống như một cánh cổng lớn với những trụ cổng vững chắc, rộng lớn, tỏa sáng rực rỡ với ánh vàng, bạc, ngọc, châu báu, san hô, v.v., để dễ dàng bước vào một ngôi nhà lớn được trang hoàng lộng lẫy với sự giàu có và quyền uy, nơi mà những người trong gia đình đi lại với tiếng nói chuyện, tiếng cười và âm thanh ngọt ngào của vòng tay, vòng chân vàng, v.v. va chạm vào nhau.
5. Idāni – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’ntiādinā nayena bhagavatā nikkhittassa suttassa vaṇṇanāya okāso anuppatto.
5. Now, the occasion has arrived for the commentary on the sutta set forth by the Blessed One in the manner beginning, “Bhikkhus, should others speak in dispraise of me.”
5. Bây giờ, đã đến lúc giải thích bản kinh được Đức Thế Tôn thuyết giảng theo cách "Này các Tỳ-khưu, nếu người khác phỉ báng Ta," v.v.
Sā panesā suttavaṇṇanā.
And this is the commentary on the sutta.
Đây là phần giải thích bản kinh.
Yasmā suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hoti, tasmā suttanikkhepaṃ tāva vicārayissāma.
Since it becomes clear when explained after examining the setting forth of the sutta, we shall therefore first examine the setting forth of the sutta.
Vì việc giải thích bản kinh sẽ trở nên rõ ràng khi xem xét cách thức thuyết giảng, nên trước hết chúng ta sẽ xem xét cách thức thuyết giảng bản kinh.
Cattāro hi suttanikkhepā – attajjhāsayo, parajjhāsayo, pucchāvasiko, aṭṭhuppattikoti.
For there are four ways of setting forth a sutta: due to personal inclination, due to others’ inclination, due to a question, and due to an occasion.
Có bốn cách thức thuyết giảng bản kinh: do tự ý của bậc Đạo Sư (attajjhāsaya), do ý của người khác (parajjhāsaya), do câu hỏi (pucchāvasika), và do sự kiện phát sinh (aṭṭhuppattika).
Bhagavantaṃ pana upasaṅkamitvā catasso parisā, cattāro vaṇṇā, nāgā, supaṇṇā, gandhabbā, asurā, yakkhā, mahārājāno, tāvatiṃsādayo devā, mahābrahmāti evamādayo – ‘‘bojjhaṅgā bojjhaṅgā’’ti, bhante, vuccanti.
Furthermore, having approached the Blessed One, the four assemblies, the four castes, nāgas, supaṇṇas, gandhabbas, asuras, yakkhas, great kings, devas such as those of the Tāvatiṃsa realm, Mahābrahmā, and so on, ask questions in the manner of: “Venerable sir, they are called ‘factors of enlightenment, factors of enlightenment.’”
Nhưng khi bốn chúng hội, bốn giai cấp, chư Nāga, Supaṇṇa, Gandhabba, Asura, Yakkha, các Đại vương, chư thiên Tāvatiṃsa và các vị Đại Phạm thiên, v.v., đến gần Đức Thế Tôn và hỏi:
‘‘Nīvaraṇā nīvaraṇā’’ti, bhante, vuccanti; ‘‘ime nu kho, bhante, pañcupādānakkhandhā’’.
“Venerable sir, they are called ‘hindrances, hindrances’;” “Venerable sir, are these the five aggregates of clinging?”
"Bạch Thế Tôn, người ta nói về các chi phần giác ngộ (bojjhaṅga), các chi phần giác ngộ. Bạch Thế Tôn, người ta nói về các triền cái (nīvaraṇa), các triền cái. Bạch Thế Tôn, phải chăng đây là năm uẩn chấp thủ (pañcupādānakkhandhā)?"
‘‘Kiṃ sūdha vittaṃ purisassa seṭṭha’’ntiādinā nayena pañhaṃ pucchanti.
“What here is a person’s best wealth?” and so forth.
"Tài sản nào là tối thượng của người đời?" v.v., theo cách này, họ đặt câu hỏi.
Evaṃ puṭṭhena bhagavatā yāni kathitāni bojjhaṅgasaṃyuttādīni, yāni vā panaññānipi devatāsaṃyutta-mārasaṃyutta-brahmasaṃyutta-sakkapañha-cūḷavedalla-mahāvedalla-sāmaññaphala-āḷavaka-sūciloma-kharalomasuttādīni; tesaṃ pucchāvasiko nikkhepo.
The setting forth of those suttas spoken by the Blessed One when thus asked—such as the Bojjhaṅga Saṃyutta and so on, or any others like the Devatā Saṃyutta, Māra Saṃyutta, Brahma Saṃyutta, Sakkapañha Sutta, Cūḷavedalla Sutta, Mahāvedalla Sutta, Sāmaññaphala Sutta, Āḷavaka Sutta, Sūciloma Sutta, and Kharaloma Sutta—is due to a question.
Những bản kinh được Đức Thế Tôn thuyết giảng khi được hỏi như vậy, như Bojjhaṅgasaṃyutta và các kinh khác như Devatāsaṃyutta, Mārasaṃyutta, Brahmasaṃyutta, Sakkapañha, Cūḷavedalla, Mahāvedalla, Sāmaññaphala, Āḷavaka, Sūciloma, Kharaloma, v.v.; cách thức thuyết giảng của những kinh này là pucchāvasika.
Evametesu catūsu nikkhepesu imassa suttassa aṭṭhuppattiko nikkhepo.
Among these four ways of setting forth, the setting forth of this sutta is due to an occasion.
Trong bốn cách thức thuyết giảng này, cách thức thuyết giảng của bản kinh này là aṭṭhuppattika.
Aṭṭhuppattiyā hi idaṃ bhagavatā nikkhittaṃ.
For this was set forth by the Blessed One because of an occasion.
Bởi vì bản kinh này được Đức Thế Tôn thuyết giảng do một sự kiện phát sinh.
Katarāya aṭṭhuppattiyā?
Because of what occasion?
Sự kiện phát sinh nào?
Vaṇṇāvaṇṇe.
Praise and dispraise.
Liên quan đến việc khen ngợi và phỉ báng.
Ācariyo ratanattayassa avaṇṇaṃ abhāsi, antevāsī vaṇṇaṃ.
The teacher spoke in dispraise of the Triple Gem; the disciple spoke in its praise.
Vị thầy đã phỉ báng Tam Bảo, còn vị đệ tử thì tán thán.
Iti imaṃ vaṇṇāvaṇṇaṃ aṭṭhuppattiṃ katvā desanākusalo bhagavā – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’nti desanaṃ ārabhi.
Thus, making this praise and dispraise the occasion for the teaching, the Blessed One, skilled in teaching, began the discourse, "Monks, if others were to speak in dispraise of me..."
Như vậy, sau khi tạo ra sự việc khởi nguyên về khen và chê này, Đức Thế Tôn, bậc thiện xảo trong giáo pháp, đã bắt đầu bài thuyết pháp: ‘Này các Tỳ-khưu, nếu người khác nói lời chê bai Ta…’.
Tattha mamanti, sāmivacanaṃ, mamāti attho.
Therein, mamaṃ is in the genitive case, meaning "of me."
Trong đó, từ mama là thuộc cách (sāmivacanaṃ), có nghĩa là của Ta.
Vāsaddo vikappanattho.
The word vā has the meaning of alternation.
Từ vā có nghĩa là lựa chọn.
Pareti, paṭiviruddhā sattā.
Pare means opposing beings.
Pare là những chúng sanh đối nghịch.
Tatrāti ye avaṇṇaṃ vadanti tesu.
Tatra means among those who speak in dispraise.
Tatra là trong số những người nói lời chê bai đó.
Na āghātotiādīhi kiñcāpi tesaṃ bhikkhūnaṃ āghātoyeva natthi, atha kho āyatiṃ kulaputtānaṃ īdisesupi ṭhānesu akusaluppattiṃ paṭisedhento dhammanettiṃ ṭhapeti.
Although there was indeed no āghāta in those monks, with the words "there should be no āghāta," etc., the Blessed One establishes the method of the Dhamma, prohibiting the arising of the unwholesome for clansmen in the future in such situations.
Mặc dù các Tỳ-khưu đó không có sự oán giận (āghāta) như đã nói trong ‘na āghāto’ và các từ khác, nhưng Ngài thiết lập một nguyên tắc giáo pháp (dhammanetti) để ngăn chặn sự phát sinh các điều bất thiện (akusaluppatti) trong những trường hợp như vậy cho các thiện gia (kulaputta) trong tương lai.
Tattha āhanati cittanti ‘āghāto’; kopassetaṃ adhivacanaṃ.
Therein, it strikes the mind, thus it is ‘āghāta’; this is a synonym for anger.
Trong đó, điều làm cho tâm bị tổn hại (āhanati cittaṃ) là āghāto (oán giận); đây là từ đồng nghĩa với sân hận (kopa).
Appatītā honti tena atuṭṭhā asomanassikāti appaccayo; domanassassetaṃ adhivacanaṃ.
They are not pleased by it, are dissatisfied, are unhappy, thus it is appaccayo; this is a synonym for displeasure.
Không vui vẻ, không hài lòng, không hoan hỷ là appaccayo (không hài lòng); đây là từ đồng nghĩa với ưu phiền (domanassa).
Neva attano na paresaṃ hitaṃ abhirādhayatīti anabhiraddhi; kopassetaṃ adhivacanaṃ.
It accomplishes the welfare neither of oneself nor of others, thus it is anabhiraddhi; this is a synonym for anger.
Không làm lợi ích cho bản thân cũng như cho người khác là anabhiraddhi (không hoan hỷ); đây là từ đồng nghĩa với sân hận (kopa).
Evamettha dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandhoti dve khandhā vuttā.
Thus, herein, the aggregate of mental formations is mentioned by two terms, and the aggregate of feeling by one, so two aggregates are mentioned.
Như vậy, ở đây, hai từ chỉ sắc uẩn (saṅkhārakkhandha), và một từ chỉ thọ uẩn (vedanākkhandha) đã được nói đến.
Tesaṃ vasena sesānampi sampayuttadhammānaṃ kāraṇaṃ paṭikkhittameva.
By means of them, the causing of the remaining associated states is also rejected.
Theo đó, hành động của các pháp đồng sanh khác cũng bị phủ nhận.
Evaṃ paṭhamena nayena manopadosaṃ nivāretvā, dutiyena nayena tattha ādīnavaṃ dassento āha – ‘‘tatra ce tumhe assatha kupitā vā anattamanā vā, tumhaṃ yevassa tena antarāyo’’ti.
Having thus prevented mental corruption with the first method, he showed the danger in it with the second method, saying: "If you were to be angry or displeased on that account, that itself would be an obstacle for you."
Như vậy, sau khi ngăn chặn sự ô nhiễm tâm (manopadosa) bằng phương pháp thứ nhất, Đức Thế Tôn nói để chỉ ra sự nguy hiểm trong đó bằng phương pháp thứ hai: ‘‘tatra ce tumhe assatha kupitā vā anattamanā vā, tumhaṃ yevassa tena antarāyo’’ (Nếu các con tức giận hoặc không hài lòng, thì chính điều đó sẽ là chướng ngại cho các con).
Tattha ‘tatra ce tumhe assathā’ti tesu avaṇṇabhāsakesu, tasmiṃ vā avaṇṇe tumhe bhaveyyātha ce; yadi bhaveyyāthāti attho.
Therein, ‘tatra ce tumhe assatha’ means: if you were to be so, concerning those who speak in dispraise, or in that dispraise; the meaning is "if you were to be."
Trong đó, ‘tatra ce tumhe assathā’ có nghĩa là nếu các con ở trong những lời chê bai đó, hoặc nếu các con ở trong sự chê bai đó; tức là nếu các con có mặt.
‘Kupitā’ kopena, anattamanā domanassena.
‘Kupitā’ is through anger, ‘anattamanā’ is through displeasure.
‘Kupitā’ là do sân hận, ‘anattamanā’ là do ưu phiền.
‘Tumhaṃ yevassa tena antarāyo’ti tumhākaṃyeva tena kopena, tāya ca anattamanatāya paṭhamajjhānādīnaṃ antarāyo bhaveyya.
‘Tumhaṃ yevassa tena antarāyo’ means: for you yourselves, through that anger and that displeasure, there would be an obstacle to the first jhāna and so on.
‘Tumhaṃ yevassa tena antarāyo’ có nghĩa là chính do sự sân hận đó và sự không hài lòng đó mà chướng ngại sẽ xảy ra cho các con đối với các thiền định (jhāna) đầu tiên và các pháp khác.
Tattha tatra tumhehīti, tasmiṃ avaṇṇe tumhehi.
Therein, tatra tumhehi means, in that case of dispraise, by you.
Trong đó, tatra tumhehī có nghĩa là các con trong lời chê bai đó.
Abhūtaṃ abhūtato nibbeṭhetabbanti yaṃ abhūtaṃ, taṃ abhūtabhāveneva apanetabbaṃ.
Abhūtaṃ abhūtato nibbeṭhetabbaṃ means that which is untrue should be refuted by its very untruthfulness.
Abhūtaṃ abhūtato nibbeṭhetabbaṃ có nghĩa là điều không có thật, phải được loại bỏ như là không có thật.
Kathaṃ?
How?
Bằng cách nào?
Itipetaṃ abhūtantiādinā nayena.
By the method beginning with itipetaṃ abhūtaṃ.
Bằng phương pháp ‘‘itipetaṃ abhūta’’ và các từ khác.
Tatrāyaṃ yojanā – ‘‘tumhākaṃ satthā na sabbaññū, dhammo durakkhāto, saṅgho duppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ.
Herein, this is the application: upon hearing such things as, "Your teacher is not all-knowing, the Dhamma is badly proclaimed, the Sangha is of bad conduct," one should not remain silent.
Ở đây có sự kết nối như sau: Sau khi nghe những lời như ‘‘Bậc Đạo Sư của các con không phải là bậc Toàn Tri, Giáo Pháp bị thuyết giảng sai lệch, Tăng đoàn hành xử không đúng đắn’’, các con không nên im lặng.
Evaṃ pana vattabbaṃ – ‘‘iti petaṃ abhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena abhūtaṃ, imināpi kāraṇena atacchaṃ, ‘natthi cetaṃ amhesu’, ‘na ca panetaṃ amhesu saṃvijjati’, sabbaññūyeva amhākaṃ satthā, svākkhāto dhammo, suppaṭipanno saṅgho, tatra idañcidañca kāraṇa’’nti.
Rather, one should speak thus: "For this reason, this is untrue. What you have said is, for this reason, untrue and, for this reason, false. ‘This is not so in us,’ and ‘this is not found in us.’ Our teacher is indeed all-knowing, the Dhamma is well-proclaimed, the Sangha is of good conduct, and for that, this and that is the reason."
Mà phải nói rằng: ‘‘Điều các vị đã nói đó là không có thật, điều đó cũng không có thật vì lý do này, cũng không đúng vì lý do này, ‘điều đó không có ở chúng tôi’, ‘điều đó không tồn tại ở chúng tôi’, Bậc Đạo Sư của chúng tôi là bậc Toàn Tri, Giáo Pháp được thuyết giảng tốt đẹp, Tăng đoàn hành xử đúng đắn, và đây là những lý do cho điều đó’’.
Ettha ca dutiyaṃ padaṃ paṭhamassa, catutthañca tatiyassa vevacananti veditabbaṃ.
And here it should be understood that the second term is a synonym for the first, and the fourth for the third.
Và ở đây, từ thứ hai là từ đồng nghĩa của từ thứ nhất, và từ thứ tư là từ đồng nghĩa của từ thứ ba.
Idañca avaṇṇeyeva nibbeṭhanaṃ kātabbaṃ, na sabbattha.
And this refutation should be done only in cases of dispraise, not in every case.
Và sự giải thích này chỉ nên được thực hiện trong trường hợp bị chê bai, không phải trong mọi trường hợp.
Yadi hi ‘‘tvaṃ dussīlo, tavācariyo dussīlo, idañcidañca tayā kataṃ, tavācariyena kata’’nti vutte tuṇhībhūto adhivāseti, āsaṅkanīyo hoti.
For if, when it is said, "You are immoral, your teacher is immoral, and you have done this and that, your teacher has done this and that," he remains silent and endures it, he becomes an object of suspicion.
Thật vậy, nếu khi bị nói ‘‘Ngươi là người ác giới, thầy của ngươi là người ác giới, ngươi đã làm điều này điều nọ, thầy của ngươi đã làm điều này điều nọ’’, mà người đó im lặng chấp nhận, thì người đó sẽ bị nghi ngờ.
Tasmā manopadosaṃ akatvā avaṇṇo nibbeṭhetabbo.
Therefore, without giving rise to mental corruption, the dispraise should be refuted.
Do đó, phải giải thích lời chê bai mà không để tâm bị ô nhiễm.
‘‘Oṭṭhosi, goṇosī’’tiādinā pana nayena dasahi akkosavatthūhi akkosantaṃ puggalaṃ ajjhupekkhitvā adhivāsanakhantiyeva tattha kātabbā.
But when a person abuses with the ten grounds for abuse, in the manner of saying, "You are a camel, you are an ox," etc., one should just disregard him and practice patient endurance.
Tuy nhiên, đối với người mắng chửi bằng mười loại lời mắng chửi như ‘‘Ngươi là con lạc đà, ngươi là con bò’’ và các từ khác, thì chỉ nên thực hành nhẫn nại chấp nhận, bỏ qua người đó.
6. Evaṃ avaṇṇabhūmiyaṃ tādilakkhaṇaṃ dassetvā idāni vaṇṇabhūmiyaṃ dassetuṃ ‘‘mamaṃ vā, bhikkhave, pare vaṇṇaṃ bhāseyyu’’ntiādimāha.
6. Having thus shown the characteristic of a Tādi in the domain of dispraise, he now, in order to show it in the domain of praise, said: "Monks, if others were to speak in praise of me," etc.
6. Như vậy, sau khi chỉ ra đặc tính của bậc Như Lai trong trường hợp bị chê bai, bây giờ Đức Thế Tôn nói ‘‘mamaṃ vā, bhikkhave, pare vaṇṇaṃ bhāseyyu’’ và các từ khác để chỉ ra đặc tính đó trong trường hợp được khen ngợi.
Tattha pareti ye keci pasannā devamanussā.
Therein, pare means any faithful deities and human beings.
Trong đó, pare là bất kỳ chư thiên và loài người nào có niềm tin.
Ānandanti etenāti ānando, pītiyā etaṃ adhivacanaṃ.
One rejoices through it, thus it is ānando; this is a synonym for joy.
Niềm vui phát sinh từ điều này là ānando (hoan hỷ); đây là từ đồng nghĩa với hỷ (pīti).
Sumanassa bhāvo somanassaṃ, cetasikasukhassetaṃ adhivacanaṃ.
The state of a good mind is somanassaṃ; this is a synonym for mental pleasure.
Trạng thái tâm tốt đẹp là somanassaṃ (hoan hỷ); đây là từ đồng nghĩa với tâm lạc (cetasika sukha).
Uppilāvino bhāvo uppilāvitattaṃ.
The state of being elated is uppilāvitattaṃ.
Trạng thái trôi nổi là uppilāvitattaṃ (tâm trôi nổi).
Kassa uppilāvitattanti?
The elation of what?
Tâm trôi nổi của ai?
Cetasoti.
Of the mind.
Của tâm (cetaso).
Uddhaccāvahāya uppilāpanapītiyā etaṃ adhivacanaṃ.
This is a synonym for elating joy that brings about restlessness.
Đây là từ đồng nghĩa với hỷ làm cho tâm trôi nổi, dẫn đến phóng dật (uddhacca).
Idhāpi dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandho vutto.
Here too, the aggregate of mental formations is mentioned by two terms, and the aggregate of feeling by one.
Ở đây cũng vậy, hai từ chỉ sắc uẩn (saṅkhārakkhandha), và một từ chỉ thọ uẩn (vedanākkhandha) đã được nói đến.
‘‘Ye, bhikkhave, buddhe pasannā, agge te pasannā’’ti ca evamādīhi anekasatehi suttehi ratanattaye pītisomanassameva vaṇṇitanti.
"Monks, those who are faithful in the Buddha are faithful in the supreme," and in many hundreds of suttas such as these, has praised only joy and gladness concerning the Three Jewels?
Niềm hỷ lạc nào phát sinh trong thân người, khi người ấy tán thán ‘Tăng’; niềm hỷ lạc ấy còn cao quý hơn cả toàn bộ Jambudīpa. Và: ‘‘Này các Tỳ-khưu, những ai có niềm tin nơi Phật, những người ấy có niềm tin nơi điều tối thượng’’ và hàng trăm bài kinh khác như vậy đã tán thán niềm hỷ lạc và tâm lạc đối với Tam Bảo hay sao?
Saccaṃ vaṇṇitaṃ, taṃ pana nekkhammanissitaṃ.
It is true that it is praised, but that is based on renunciation.
Đúng vậy, đã được tán thán, nhưng điều đó là nương tựa vào sự xuất ly (nekkhammanissita).
Idha – ‘‘amhākaṃ buddho, amhākaṃ dhammo’’tiādinā nayena āyasmato channassa uppannasadisaṃ gehassitaṃ pītisomanassaṃ adhippetaṃ.
Here, what is meant is joy and gladness based on the household life, similar to that which arose in the venerable Channa in the manner of "Our Buddha, our Dhamma."
Ở đây, niềm hỷ lạc và tâm lạc được đề cập là loại nương tựa vào gia đình (gehassita), giống như niềm hỷ lạc đã phát sinh nơi Tôn giả Channa khi nói ‘‘Phật của chúng ta, Pháp của chúng ta’’ và các từ khác.
Idañhi jhānādipaṭilābhāya antarāyakaraṃ hoti.
For this becomes an obstacle to the attainment of jhāna and so on.
Điều này là chướng ngại cho việc đạt được các thiền định (jhāna) và các pháp khác.
Tenevāyasmā channopi yāva buddho na parinibbāyi, tāva visesaṃ nibbattetuṃ nāsakkhi, parinibbānakāle paññattena pana brahmadaṇḍena tajjito taṃ pītisomanassaṃ pahāya visesaṃ nibbattesi.
For that very reason, the venerable Channa, for as long as the Buddha had not attained Parinibbāna, was unable to bring about a special attainment. But, when admonished with the Brahmadaṇḍa prescribed at the time of the Parinibbāna, he abandoned that joy and gladness and brought about a special attainment.
Chính vì thế, Tôn giả Channa đã không thể đạt được sự đặc biệt nào cho đến khi Đức Phật nhập Niết-bàn; nhưng vào lúc Đức Phật nhập Niết-bàn, khi bị đe dọa bởi hình phạt Brahmadaṇḍa đã được ban hành, Ngài đã từ bỏ niềm hỷ lạc và tâm lạc đó và đạt được sự đặc biệt.
Tasmā antarāyakaraṃyeva sandhāya idaṃ vuttanti veditabbaṃ.
Therefore, it should be understood that this was said with reference only to what is an obstacle.
Do đó, phải hiểu rằng điều này được nói ra chỉ để đề cập đến điều gây chướng ngại.
Ayañhi lobhasahagatā pīti.
For this is joy associated with greed.
Thật vậy, niềm hỷ lạc này là niềm hỷ lạc đồng hành với tham ái (lobha).
Lobho ca kodhasadisova.
And greed is just like anger.
Và tham ái (lobha) cũng giống như sân hận (kopa).
Yathāha –
As it is said:
Như đã nói:
Paṭipajjitabbākāradassanavāre panāyaṃ yojanā – ‘‘tumhākaṃ satthā sabbaññū arahaṃ sammāsambuddho, dhammo svākkhāto, saṅgho suppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ.
Now, in the section showing the way it should be practiced, this is the connection: Having heard such things as, "Your Teacher is the Omniscient One, the Arahant, the Perfectly Enlightened One; the Dhamma is well-expounded; the Sangha is of good practice," one should not remain silent.
Hơn nữa, trong phần trình bày cách thực hành này, sự kết nối là: không nên im lặng sau khi nghe những điều như “Vị Đạo Sư của các ông là bậc Toàn Giác, A-la-hán, Chánh Đẳng Giác; Pháp được thuyết giảng khéo léo; Tăng chúng thực hành tốt.”
Evaṃ pana paṭijānitabbaṃ – ‘‘itipetaṃ bhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena bhūtaṃ, imināpi kāraṇena tacchaṃ.
Instead, one should acknowledge it thus: " For this reason, it is true. What you have said is true for this reason and correct for that reason.
Mà nên xác nhận như sau: “Quả thật là như vậy; điều các ông nói là đúng, là chân thật vì lý do này, và cũng chân thật vì lý do này.
So hi bhagavā itipi arahaṃ, itipi sammāsambuddho; dhammo itipi svākkhāto, itipi sandiṭṭhiko; saṅgho itipi suppaṭipanno, itipi ujuppaṭipanno’’ti.
For the Blessed One is an Arahant for this reason, a Perfectly Enlightened One for that reason; the Dhamma is well-expounded for this reason, directly visible for that reason; the Sangha is of good practice for this reason, of upright practice for that reason."
Vì Đức Thế Tôn là bậc A-la-hán vì lý do này, và là bậc Chánh Đẳng Giác vì lý do này; Pháp được thuyết giảng khéo léo vì lý do này, và là Pháp thiết thực hiện tại vì lý do này; Tăng chúng thực hành tốt vì lý do này, và thực hành ngay thẳng vì lý do này.”
‘‘Tvaṃ sīlavā’’ti pucchitenāpi sace sīlavā, ‘‘sīlavāhamasmī’’ti paṭijānitabbameva.
Even when asked, "Are you virtuous?", if one is virtuous, one should indeed acknowledge, "I am virtuous."
Nếu được hỏi “Ông có giới hạnh không?” và nếu có giới hạnh, thì nên xác nhận “Tôi có giới hạnh.”
‘‘Tvaṃ paṭhamassa jhānassa lābhī…pe… arahā’’ti puṭṭhenāpi sabhāgānaṃ bhikkhūnaṃyeva paṭijānitabbaṃ.
Even when asked, "Are you an attainer of the first jhana... and so on... an Arahant?", one should acknowledge it only to bhikkhus of a similar nature.
Nếu được hỏi “Ông có đắc sơ thiền không?... cho đến... là bậc A-la-hán không?”, thì chỉ nên xác nhận với các Tỳ-khưu đồng hạnh.
Evañhi pāpicchatā ceva parivajjitā hoti, sāsanassa ca amoghatā dīpitā hotīti.
In this way, evil desire is avoided, and the non-futility of the teaching is demonstrated.
Vì làm như vậy sẽ tránh được ác dục, và làm sáng tỏ sự không vô ích của giáo pháp.
Sesaṃ vuttanayeneva veditabbaṃ.
The rest should be understood in the manner already stated.
Phần còn lại nên được hiểu theo cách đã nói.
7. Appamattakaṃ kho panetaṃ, bhikkhaveti ko anusandhi?
7. This, bhikkhus, is but a trifling matter. What is the connection?
7. Này các Tỳ-khưu, điều này thật nhỏ bé — sự kết nối là gì?
Idaṃ suttaṃ dvīhi padehi ābaddhaṃ vaṇṇena ca avaṇṇena ca.
This sutta is bound by two terms: praise and dispraise.
Kinh này được kết nối bởi hai phần: tán thán (vaṇṇa) và không tán thán (avaṇṇa).
Tattha avaṇṇo – ‘‘iti petaṃ abhūtaṃ iti petaṃ ataccha’’nti, ettheva udakantaṃ patvā aggiviya nivatto.
Therein, the dispraise—"For this reason it is untrue, for this reason it is incorrect"—stops right there, like a fire that has reached the water's edge and is extinguished.
Trong đó, phần không tán thán — “Điều này không đúng, điều này không chân thật” — đã dừng lại như lửa gặp nước.
Vaṇṇo pana bhūtaṃ bhūtato paṭijānitabbaṃ – ‘‘iti petaṃ bhūta’’nti evaṃ anuvattatiyeva.
Praise, however—that what is true should be acknowledged as true with "For this reason it is true"—continues on.
Còn phần tán thán thì tiếp tục xác nhận sự thật là chân thật — “Điều này là chân thật” — như vậy.
So pana duvidho brahmadattena bhāsitavaṇṇo ca bhikkhusaṅghena acchariyaṃ āvusotiādinā nayena āraddhavaṇṇo ca.
It is twofold: the praise spoken by Brahmadatta, and the praise initiated by the Saṅgha of bhikkhus in the manner of "It is wonderful, friends," and so on.
Phần đó lại có hai loại: sự tán thán do thanh niên Brahmadatta nói, và sự tán thán do Tăng chúng khởi xướng với lời “Thật kỳ diệu thay, thưa Tôn giả!” và tương tự.
Tesu bhikkhusaṅghena vuttavaṇṇassa upari suññatāpakāsane anusandhiṃ dassessati.
Of these, he will show the connection regarding the praise spoken by the Saṅgha of bhikkhus later, in the exposition of emptiness.
Trong số đó, sự kết nối đối với lời tán thán của Tăng chúng sẽ được trình bày ở phần trên về sự hiển lộ của tánh không.
Idha pana brahmadattena vuttavaṇṇassa anusandhiṃ dassetuṃ ‘‘appamattakaṃ kho panetaṃ, bhikkhave’’ti desanā āraddhā.
Here, however, the discourse beginning with "This, bhikkhus, is but a trifling matter" was initiated to show the connection to the praise spoken by Brahmadatta.
Còn ở đây, để trình bày sự kết nối đối với lời tán thán của Brahmadatta, bài thuyết pháp “Này các Tỳ-khưu, điều này thật nhỏ bé” đã được khởi xướng.
Tattha appamattakanti parittassa nāmaṃ.
Therein, trifling matter is a name for what is insignificant.
Trong đó, appamattakaṃ là tên gọi của cái nhỏ bé.
Oramattakanti tasseva vevacanaṃ.
A minor matter is a synonym for the same.
Oramattakaṃ là từ đồng nghĩa của nó.
Mattāti vuccati pamāṇaṃ.
Measure is said of quantity.
Mattā được gọi là thước đo.
Appaṃ mattā etassāti appamattakaṃ. Oraṃ mattā etassāti oramattakaṃ. Sīlameva sīlamattakaṃ. Idaṃ vuttaṃ hoti – ‘appamattakaṃ kho, panetaṃ bhikkhave, oramattakaṃ sīlamattakaṃ’ nāma yena ‘‘tathāgatassa vaṇṇaṃ vadāmī’’ti ussāhaṃ katvāpi vaṇṇaṃ vadamāno puthujjano vadeyyāti.
That which has a trifling measure is a trifling matter. That which has a minor measure is a minor matter. Morality itself is a mere matter of morality. This is what is meant: ‘This, bhikkhus, is but a trifling matter, a minor matter, a mere matter of morality,’ by which a worldling, even after making an effort to ‘speak the praise of the Tathāgata,’ might speak his praise.
Appaṃ mattā etassāti appamattakaṃ. Oraṃ mattā etassāti oramattakaṃ. Sīlameva sīlamattakaṃ. Điều này có nghĩa là: ‘Này các Tỳ-khưu, đây là một điều nhỏ bé, tầm thường, chỉ là giới hạnh’ mà một phàm phu có thể nói khi cố gắng tán thán Đức Như Lai.
Tattha siyā – nanu idaṃ sīlaṃ nāma yogino aggavibhūsanaṃ?
Regarding this, it might be said: Is not this thing called morality the supreme adornment of a yogī?
Ở đây có thể có câu hỏi: Chẳng phải giới hạnh này là trang sức tối thượng của hành giả sao?
Yathāhu porāṇā –
As the ancients have said:
Như các bậc cổ xưa đã nói:
‘‘Seyyathāpi, bhikkhave, ye keci bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti, sabbe te pathaviṃ nissāya, pathaviyaṃ patiṭṭhāya; evamete bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti.
“Bhikkhus, just as whatever kinds of seed-growth and plant-growth achieve growth, increase, and abundance, they all do so in dependence on the earth, established on the earth; in that way those kinds of seed-growth and plant-growth achieve growth, increase, and abundance.
“Này các Tỳ-khưu, ví như tất cả các loại hạt giống và cây cối đều phát triển, tăng trưởng, và đạt đến sự sung mãn nhờ nương tựa vào đất, đứng vững trên đất; cũng vậy, các loại hạt giống và cây cối này phát triển, tăng trưởng, và đạt đến sự sung mãn.
Evameva kho, bhikkhave, bhikkhu sīlaṃ nissāya sīle patiṭṭhāya sattabojjhaṅge bhāvento sattabojjhaṅge bahulīkaronto vuḍḍhiṃ virūḷhiṃ vepullaṃ pāpuṇāti dhammesū’’ti (saṃ. ni. 5.150) ca.
So too, bhikkhus, a bhikkhu, in dependence on morality, established in morality, by developing the seven factors of enlightenment and cultivating them, attains growth, increase, and abundance in the dhammas.” and
Cũng vậy, này các Tỳ-khưu, một Tỳ-khưu nương tựa vào giới, đứng vững trên giới, tu tập bảy chi phần giác ngộ, làm cho bảy chi phần giác ngộ trở nên sung mãn, sẽ đạt đến sự phát triển, tăng trưởng, và sung mãn trong các pháp.”
Evaṃ aññānipi anekāni suttāni daṭṭhabbāni.
Thus, many other suttas should be seen.
Và nhiều bài kinh khác cũng nên được xem xét.
Evamanekesu suttasatesu sīlaṃ mahantameva katvā kathitaṃ.
In this way, in many hundreds of suttas, morality has been spoken of as something great.
Như vậy, trong hàng trăm bài kinh, giới hạnh đã được nói là điều vĩ đại.
Taṃ ‘‘kasmā imasmiṃ ṭhāne appamattaka’’nti āhāti?
So "Why in this place did he say it is a 'trifling matter'?"
Vậy tại sao ở đây lại nói “nhỏ bé”?
Upari guṇe upanidhāya.
In comparison with higher qualities.
Là để so sánh với các phẩm chất cao hơn.
Sīlañhi samādhiṃ na pāpuṇāti, samādhi paññaṃ na pāpuṇāti, tasmā uparimaṃ upanidhāya heṭṭhimaṃ oramattakaṃ nāma hoti.
For morality does not attain to concentration; concentration does not attain to wisdom. Therefore, in comparison with what is higher, what is lower is called a minor matter.
Giới hạnh không đạt đến định, định không đạt đến tuệ; do đó, so với cái cao hơn, cái thấp hơn được gọi là tầm thường.
Kathaṃ sīlaṃ samādhiṃ na pāpuṇāti?
How is it that morality does not attain to concentration?
Giới hạnh không đạt đến định như thế nào?
Bhagavā hi abhisambodhito sattame saṃvacchare sāvatthinagara – dvāre kaṇḍambarukkhamūle dvādasayojane ratanamaṇḍape yojanappamāṇe ratanapallaṅke nisīditvā tiyojanike dibbasetacchatte dhāriyamāne dvādasayojanāya parisāya attādānaparidīpanaṃ titthiyamaddanaṃ – ‘‘uparimakāyato aggikkhandho pavattati, heṭṭhimakāyato udakadhārā pavattati…pe… ekekalomakūpato aggikkhandho pavattati, ekekalomakūpato udakadhārā pavattati, channaṃ vaṇṇāna’’ntiādinayappavattaṃ yamakapāṭihāriyaṃ dasseti.
In the seventh year after his full enlightenment, the Blessed One, at the foot of the Kaṇḍamba tree near the gate of the city of Sāvatthī, seated on a jeweled throne one yojana in size within a jeweled pavilion of twelve yojanas, while a divine white parasol of three yojanas was being held over him, in front of an assembly of twelve yojanas, displayed the Twin Miracle—which demonstrates the taking up of a challenge and crushes the heretics—in the manner beginning: “A mass of fire proceeds from the upper part of his body, a stream of water proceeds from the lower part of his body... and so on... a mass of fire proceeds from each and every hair follicle, a stream of water proceeds from each and every hair follicle, of the six colors.”
Đức Thế Tôn, vào năm thứ bảy sau khi thành đạo, tại cổng thành Sāvatthī, dưới gốc cây xoài Kaṇḍamba, đã ngồi trên bảo tọa bằng ngọc rộng một dojana trong bảo tháp bằng ngọc rộng mười hai dojana, trong khi chiếc lọng trắng thần diệu ba dojana được giữ, và trước hội chúng mười hai dojana, Ngài đã trình bày thần thông song đôi (yamaka-pāṭihāriya) để chứng tỏ sự tự chủ của mình và trấn áp các ngoại đạo — “Từ phần thân trên, lửa bốc lên; từ phần thân dưới, dòng nước chảy ra... cho đến... từ mỗi lỗ chân lông, lửa bốc lên; từ mỗi lỗ chân lông, dòng nước chảy ra, với sáu màu sắc,” và tương tự.
Tassa suvaṇṇavaṇṇasarīrato suvaṇṇavaṇṇā rasmiyo uggantvā yāva bhavaggā gacchanti, sakaladasasahassacakkavāḷassa alaṅkaraṇakālo viya hoti, dutiyā dutiyā rasmiyo purimāya purimāya yamakayamakā viya ekakkhaṇe viya pavattanti.
From his golden-colored body, golden-colored rays emanate, extending up to the highest state of existence. It is like a time of adornment for the entire ten-thousand-fold world system. Successive rays proceed like pairs upon pairs of the preceding ones, as if in a single moment.
Từ thân Ngài có màu vàng kim, các tia sáng màu vàng kim phóng ra, bay lên đến tận Bhavagga, giống như thời điểm trang hoàng toàn bộ mười ngàn thế giới. Các tia sáng thứ hai, thứ hai, dường như song đôi với các tia sáng trước, trước, xuất hiện như thể trong cùng một khoảnh khắc.
Nīlarasmiatthāya hi bhagavā nīlakasiṇaṃ samāpajjati, pītarasmiatthāya pītakasiṇaṃ, lohitaodātarasmiatthāya lohitaodātakasiṇaṃ, aggikkhandhatthāya tejokasiṇaṃ, udakadhāratthāya āpokasiṇaṃ samāpajjati.
For a blue ray, the Blessed One enters the blue kasiṇa; for a yellow ray, the yellow kasiṇa; for a red and white ray, the red and white kasiṇas; for a mass of fire, the fire kasiṇa; for a stream of water, he enters the water kasiṇa.
Để có tia sáng màu xanh, Đức Thế Tôn nhập vào kasiṇa màu xanh; để có tia sáng màu vàng, Ngài nhập vào kasiṇa màu vàng; để có tia sáng màu đỏ và trắng, Ngài nhập vào kasiṇa màu đỏ và trắng; để có khối lửa, Ngài nhập vào kasiṇa lửa; để có dòng nước, Ngài nhập vào kasiṇa nước.
Satthā caṅkamati, nimmito tiṭṭhati vā nisīdati vā seyyaṃ vā kappetīti sabbaṃ vitthāretabbaṃ.
The Teacher walks, while a created image stands, sits, or lies down—all this should be elaborated.
Vị Đạo Sư đi kinh hành, hóa thân đứng, hoặc ngồi, hoặc nằm — tất cả đều nên được giải thích chi tiết.
Ettha ekampi sīlassa kiccaṃ natthi, sabbaṃ samādhikiccameva.
Herein, there is not a single function of morality; it is all the function of concentration.
Ở đây, giới hạnh không có vai trò gì, tất cả đều là vai trò của định.
Evaṃ sīlaṃ samādhiṃ na pāpuṇāti.
In this way, morality does not attain to concentration.
Như vậy, giới hạnh không đạt đến định.
Yaṃ pana bhagavā kappasatasahassādhikāni cattāri asaṅkhyeyyāni pāramiyo pūretvā, ekūnatiṃsavassakāle cakkavattisirīnivāsabhūtā bhavanā nikkhamma anomānadītīre pabbajitvā, chabbassāni padhānayogaṃ katvā, visākhapuṇṇamāyaṃ uruvelagāme sujātāya dinnaṃ pakkhittadibbojaṃ madhupāyāsaṃ paribhuñjitvā, sāyanhasamaye dakkhiṇuttarena bodhimaṇḍaṃ pavisitvā assatthadumarājānaṃ tikkhattuṃ padakkhiṇaṃ katvā, pubbuttarabhāge ṭhito tiṇasanthāraṃ santharitvā, tisandhipallaṅkaṃ ābhujitvā, caturaṅgasamannāgataṃ mettākammaṭṭhānaṃ pubbaṅgamaṃ katvā, vīriyādhiṭṭhānaṃ adhiṭṭhāya, cuddasahatthapallaṅkavaragato suvaṇṇapīṭhe ṭhapitaṃ rajatakkhandhaṃ viya paññāsahatthaṃ bodhikkhandhaṃ piṭṭhito katvā, upari maṇichattena viya bodhisākhāya dhāriyamāno, suvaṇṇavaṇṇe cīvare pavāḷasadisesu bodhiaṅkuresu patamānesu, sūriye atthaṃ upagacchante mārabalaṃ vidhamitvā, paṭhamayāme pubbenivāsaṃ anussaritvā, majjhimayāme dibbacakkhuṃ visodhetvā, paccūsakāle sabbabuddhānamāciṇṇe paccayākāre ñāṇaṃ otāretvā, ānāpānacatutthajjhānaṃ nibbattetvā, tadeva pādakaṃ katvā vipassanaṃ vaḍḍhetvā, maggapaṭipāṭiyā adhigatena catutthamaggena sabbakilese khepetvā sabbabuddhaguṇe paṭivijjhi, idamassa paññākiccaṃ.
Furthermore, the Blessed One—having fulfilled the perfections for four incalculables and over one hundred thousand aeons; having, at the age of twenty-nine, gone forth from the palace that was the abode of a universal monarch's splendor and become a renunciant on the bank of the Anomā river; having engaged in the great striving for six years; on the full moon day of Visākha, in the village of Uruvelā, having consumed the milk-rice mixed with divine essence given by Sujātā; in the evening, having entered the Bodhimaṇḍa by the south-north path and circumambulated the king of the Assattha trees three times; standing in the northeast quarter, having spread out the grass mat; having formed the cross-legged posture with its three points of contact; having made the meditation subject of loving-kindness endowed with four factors the forerunner; having made the resolution of energy; seated on the excellent fourteen-cubit throne, having placed the fifty-cubit Bodhi tree trunk at his back like a silver trunk set on a golden pedestal; being canopied by the Bodhi branches as if by a jeweled umbrella, while Bodhi shoots like coral fell upon his golden-hued robes; as the sun was setting, having vanquished the forces of Māra; in the first watch, having recollected past lives; in the middle watch, having purified the divine eye; at dawn, having directed his knowledge to the conditional relations practiced by all Buddhas; having produced the fourth jhāna of mindfulness of breathing, and having made that very jhāna the basis for developing insight; having, by means of the fourth path attained in sequence with the other paths, destroyed all defilements—that he penetrated all the qualities of a Buddha, this is the function of his wisdom.
Tuy nhiên, Đức Thế Tôn đã viên mãn Bốn A-tăng-kỳ và một trăm ngàn đại kiếp Ba-la-mật, vào năm hai mươi chín tuổi, Ngài rời bỏ cung điện là nơi trú ngụ của vinh quang Chuyển Luân Vương, xuất gia bên bờ sông Anomā, thực hành khổ hạnh trong sáu năm, vào ngày trăng tròn tháng Visākha, thọ thực món sữa gạo mật ong có thần vị do nàng Sujātā cúng dường tại làng Uruvelā, vào buổi chiều, Ngài đi vào Bồ-đề-mạn-đala từ phía nam và phía bắc, nhiễu quanh cây Bồ-đề vương ba lần, đứng ở phía đông bắc, trải tọa cụ cỏ, kiết già ba khớp, lấy thiền định từ bi (mettākammaṭṭhāna) có bốn chi làm tiền đạo, phát nguyện tinh tấn (vīriyādhiṭṭhāna), ngồi trên tòa kim cương cao mười bốn khuỷu tay, lưng tựa vào thân cây Bồ-đề cao năm mươi khuỷu tay như một trụ bạc đặt trên ngai vàng, được cành Bồ-đề che chở như một lọng ngọc, trong khi những chồi Bồ-đề màu san hô rơi xuống y phục vàng óng, khi mặt trời lặn, Ngài đã đánh bại quân Ma-vương, trong canh đầu nhớ lại các kiếp sống quá khứ, trong canh giữa làm thanh tịnh thiên nhãn (dibbacakkhu), vào lúc rạng đông, Ngài đã đưa trí tuệ vào duyên khởi (paccayākāra) mà tất cả các vị Phật đều thực hành, thành tựu thiền thứ tư về hơi thở vào ra (ānāpāna), lấy đó làm nền tảng phát triển tuệ quán (vipassanā), và bằng Tứ Thánh Đạo đã đạt được theo thứ tự của đạo lộ, Ngài đã diệt trừ tất cả phiền não và chứng đạt tất cả các công đức của chư Phật; đây là công việc của trí tuệ Ngài.
Evaṃ samādhi paññaṃ na pāpuṇāti.
In this way, concentration does not attain to wisdom.
Như vậy, định không đạt đến tuệ.
Tattha yathā hatthe udakaṃ pātiyaṃ udakaṃ na pāpuṇāti, pātiyaṃ udakaṃ ghaṭe udakaṃ na pāpuṇāti, ghaṭe udakaṃ kolambe udakaṃ na pāpuṇāti, kolambe udakaṃ cāṭiyaṃ udakaṃ na pāpuṇāti, cāṭiyaṃ udakaṃ mahākumbhiyaṃ udakaṃ na pāpuṇāti, mahākumbhiyaṃ udakaṃ kusobbhe udakaṃ na pāpuṇāti, kusobbhe udakaṃ kandare udakaṃ na pāpuṇāti, kandare udakaṃ kunnadiyaṃ udakaṃ na pāpuṇāti, kunnadiyaṃ udakaṃ pañcamahānadiyaṃ udakaṃ na pāpuṇāti, pañcamahānadiyaṃ udakaṃ cakkavāḷamahāsamudde udakaṃ na pāpuṇāti, cakkavāḷamahāsamudde udakaṃ sinerupādake mahāsamudde udakaṃ na pāpuṇāti.
Herein, just as the water in the hand does not attain to the water in the drinking cup, the water in the drinking cup does not attain to the water in the pot, the water in the pot does not attain to the water in the small water jar, the water in the small water jar does not attain to the water in the large water jar, the water in the large water jar does not attain to the water in the great storage jar, the water in the great storage jar does not attain to the water in the pond, the water in the pond does not attain to the water in the mountain gorge, the water in the mountain gorge does not attain to the water in the small river, the water in the small river does not attain to the water in the five great rivers, the water in the five great rivers does not attain to the water in the great ocean of the Cakkavāḷa, the water in the great ocean of the Cakkavāḷa does not attain to the water in the great ocean at the foot of Sineru.
Ở đây, ví như nước trong lòng bàn tay không đạt đến nước trong chén, nước trong chén không đạt đến nước trong bình, nước trong bình không đạt đến nước trong vại, nước trong vại không đạt đến nước trong chum, nước trong chum không đạt đến nước trong vạc lớn, nước trong vạc lớn không đạt đến nước trong ao nhỏ, nước trong ao nhỏ không đạt đến nước trong khe núi, nước trong khe núi không đạt đến nước trong sông nhỏ, nước trong sông nhỏ không đạt đến nước trong năm con sông lớn, nước trong năm con sông lớn không đạt đến nước trong đại dương bao quanh thế giới, nước trong đại dương bao quanh thế giới không đạt đến nước trong đại dương dưới chân núi Sineru.
Pātiyaṃ udakaṃ upanidhāya hatthe udakaṃ parittaṃ…pe… sinerupādakamahāsamudde udakaṃ upanidhāya cakkavāḷamahāsamudde udakaṃ parittaṃ.
Compared to the water in the drinking cup, the water in the hand is little… and so on… compared to the water in the great ocean at the foot of Sineru, the water in the great ocean of the Cakkavāḷa is little.
So với nước trong chén, nước trong lòng bàn tay thì ít ỏi… cho đến so với nước trong đại dương dưới chân núi Sineru, nước trong đại dương bao quanh thế giới thì ít ỏi.
Iti uparūpari udakaṃ bahukaṃ upādāya heṭṭhā heṭṭhā udakaṃ parittaṃ hoti.
Thus, by considering the greater amounts of water in the higher categories, the water in the lower categories is found to be little.
Như vậy, lấy nước ở trên cao hơn thì nhiều, còn nước ở dưới thấp hơn thì ít ỏi.
‘‘Puthu kilese janentīti puthujjanā, puthu avihatasakkāyadiṭṭhikāti puthujjanā, puthu satthārānaṃ mukhullokikāti puthujjanā, puthu sabbagatīhi avuṭṭhitāti puthujjanā, puthu nānābhisaṅkhāre abhisaṅkharontīti puthujjanā, puthu nānāoghehi vuyhanti, puthu santāpehi santappanti, puthu pariḷāhehi pariḍayhanti, puthu pañcasu kāmaguṇesu rattā giddhā gathitā mucchitā ajjhopannā laggā laggitā palibuddhāti puthujjanā, puthu pañcahi nīvaraṇehi āvutā nivutā ovutā pihitā paṭicchannā paṭikujjitāti puthujjanā’’ti.
“They generate (janenti) many (puthu) defilements, thus they are puthujjanas. They have many (puthu) identity views that have not been abandoned. They look up (ullokika) to the faces of many (puthu) teachers. They have not risen out of all (sabba) the many (puthu) destinies. They concoct (abhisaṅkharonti) many (puthu) diverse concoctions (nānābhisaṅkhāre). They are swept away by many (puthu) diverse floods (nānāoghehi). They are afflicted by many (puthu) torments (santāpehi). They are consumed by many (puthu) fevers (pariḷāhehi). They are impassioned, greedy, attached, infatuated, clinging, stuck, bound to the five strands of sensual pleasure in many ways (puthu). They are obstructed, hindered, enmeshed, blocked, covered, and overturned by the five hindrances in many ways (puthu), thus they are puthujjanas.”
“Vì sinh ra nhiều phiền não nên gọi là phàm phu; vì có tà kiến thân kiến (sakkāyadiṭṭhi) chưa bị diệt trừ nên gọi là phàm phu; vì nhìn mặt nhiều bậc Đạo Sư nên gọi là phàm phu; vì chưa thoát khỏi mọi nẻo luân hồi nên gọi là phàm phu; vì tạo tác nhiều loại hành (saṅkhāra) khác nhau nên gọi là phàm phu; vì bị cuốn trôi bởi nhiều dòng nước lũ (ogha) khác nhau; vì bị nung đốt bởi nhiều sự khổ đau (santāpa) khác nhau; vì bị thiêu đốt bởi nhiều sự nóng bức (pariḷāha) khác nhau; vì bị tham đắm, ham muốn, chấp trước, say mê, chìm đắm, dính mắc, ràng buộc vào năm dục lạc nên gọi là phàm phu; vì bị che chắn, bao phủ, bao bọc, đóng kín, che giấu, vùi lấp bởi năm triền cái nên gọi là phàm phu.”
Puthūnaṃ gaṇanapathamatītānaṃ ariyadhammaparammukhānaṃ nīcadhammasamācārānaṃ janānaṃ antogadhattāpi puthujjano, puthuvāyaṃ visuṃyeva saṅkhyaṃ gato visaṃsaṭṭho sīlasutādiguṇayuttehi ariyehi janehīti puthujjanoti.
He is also a puthujjana from being included among the many folk who have surpassed enumeration, who have turned away from the noble Dhamma, and who practice base conduct. Or, this folk (jano) is separate (puthu), that is, accounted for separately, unmixed with the noble folk endowed with virtues such as morality and learning; thus, he is a puthujjana.
Cũng là phàm phu vì nằm trong số đông những người vượt quá số đếm, quay lưng lại với các pháp cao thượng (ariyadhamma), và có hành vi thấp kém; hoặc người này là phàm phu vì được tính riêng biệt, không hòa lẫn với những bậc Thánh nhân có các đức tính như giới, tuệ, v.v.
Kathaṃ bhagavā tathā āgatoti tathāgato? Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā, yathā vipassī bhagavā āgato, yathā sikhī bhagavā, yathā vessabhū bhagavā, yathā kakusandho bhagavā, yathā koṇāgamano bhagavā, yathā kassapo bhagavā āgato.
How is the Blessed One a Tathāgata in the sense of having come in such a way (tathā āgato)? Just as the Perfectly Enlightened Ones of the past, who were intent on the welfare of all the world, came—as the Blessed One Vipassī came, as the Blessed One Sikhī, as the Blessed One Vessabhū, as the Blessed One Kakusandha, as the Blessed One Koṇāgamana, as the Blessed One Kassapa came.
Đức Thế Tôn đến như vậy nên là Như Lai (Tathā āgato) như thế nào? Như các vị Chánh Đẳng Giác đời trước đã đến vì lợi ích của tất cả chúng sanh, như Đức Thế Tôn Vipassī đã đến, như Đức Thế Tôn Sikhī, như Đức Thế Tôn Vessabhū, như Đức Thế Tôn Kakusandha, như Đức Thế Tôn Koṇāgamana, như Đức Thế Tôn Kassapa đã đến.
Kiṃ vuttaṃ hoti?
What is meant by this?
Điều đó có nghĩa là gì?
Yena abhinīhārena ete bhagavanto āgatā, teneva amhākampi bhagavā āgato.
By that same aspiration by which those Blessed Ones came, by that very same way our Blessed One also came.
Bằng sự phát nguyện mà các vị Thế Tôn ấy đã đến, Đức Thế Tôn của chúng ta cũng đã đến bằng sự phát nguyện ấy.
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā dānapāramiṃ pūretvā, sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramiṃ pūretvā, imā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsapāramiyo pūretvā aṅgapariccāgaṃ, nayanadhanarajjaputtadārapariccāganti ime pañca mahāpariccāge pariccajitvā pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā buddhicariyāya koṭiṃ patvā āgato; tathā amhākampi bhagavā āgato.
Or else, just as the Blessed One Vipassī… and so on… as the Blessed One Kassapa came, having fulfilled the perfection of giving, having fulfilled the perfections of morality, renunciation, wisdom, energy, patience, truth, resolve, loving-kindness, and equanimity—having fulfilled these ten perfections, ten subsidiary perfections, and ten ultimate perfections, thus thirty perfections in total; having made the five great relinquishments, namely, the relinquishment of limbs, eyes, wealth, kingdom, and wife and children; having fulfilled the former practices, former conducts, teaching of the Dhamma, conduct for the welfare of relatives, and so on; and having reached the pinnacle of the conduct for wisdom; in such a way our Blessed One also came.
Hoặc, như Đức Thế Tôn Vipassī… cho đến Đức Thế Tôn Kassapa đã viên mãn mười Ba-la-mật là bố thí Ba-la-mật, giới Ba-la-mật, xuất ly Ba-la-mật, trí tuệ Ba-la-mật, tinh tấn Ba-la-mật, nhẫn nại Ba-la-mật, chân thật Ba-la-mật, quyết định Ba-la-mật, từ bi Ba-la-mật, xả Ba-la-mật, mười Ba-la-mật phụ (upapāramī), mười Ba-la-mật tối thượng (paramatthapāramī), tổng cộng ba mươi Ba-la-mật; đã thực hành năm đại hy sinh là hy sinh thân thể, hy sinh mắt, hy sinh tài sản, hy sinh vương quốc, hy sinh vợ con; đã viên mãn các hạnh như hạnh tu tập trước, hạnh hành trì trước, hạnh thuyết pháp, hạnh vì lợi ích người thân, v.v., đạt đến đỉnh cao của hạnh Bồ-đề và đã đến; Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Atha vā yathā vipassī bhagavā…pe… kassapo bhagavā cattāro satipaṭṭhāne, cattāro sammappadhāne, cattāro iddhipāde, pañcindriyāni, pañca balāni, satta bojjhaṅge, ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvetvā brūhetvā āgato, tathā amhākampi bhagavā āgato.
Or else, just as the Blessed One Vipassī… and so on… the Blessed One Kassapa came, having developed and cultivated the four foundations of mindfulness, the four right strivings, the four bases of psychic power, the five faculties, the five powers, the seven factors of enlightenment, and the Noble Eightfold Path, in such a way our Blessed One also came.
Hoặc, như Đức Thế Tôn Vipassī… cho đến Đức Thế Tôn Kassapa đã tu tập và phát triển Tứ Niệm Xứ (cattāro satipaṭṭhāne), Tứ Chánh Cần (cattāro sammappadhāne), Tứ Như Ý Túc (cattāro iddhipāde), Ngũ Căn (pañcindriyāni), Ngũ Lực (pañca balāni), Thất Giác Chi (satta bojjhaṅge), Bát Chánh Đạo (ariyaṃ aṭṭhaṅgikaṃ maggaṃ) và đã đến; Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Evaṃ tathā āgatoti tathāgato.
Thus, he has come in such a way (tathā āgato), so he is a Tathāgata.
Như vậy, đến như vậy nên là Như Lai.
Kathañca so bhagavā gato?
And how did that Blessed One go?
Và Đức Thế Tôn ấy đã đi như thế nào?
So hi sampati jātova samehi pādehi pathaviyaṃ patiṭṭhāya uttarābhimukho sattapadavītihārena gato.
For he, just after being born, having stood on the earth with even feet, went with a stride of seven steps facing north.
Quả thật, Ngài vừa mới đản sinh, đã đứng vững bằng đôi chân bằng phẳng trên mặt đất, hướng về phía Bắc và đi bảy bước.
Yathāha – ‘‘sampatijāto kho, ānanda, bodhisatto samehi pādehi patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati, setamhi chatte anudhāriyamāne sabbā ca disā anuviloketi, āsabhiṃ vācaṃ bhāsati – ‘aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthidāni punabbhavo’ti’’ (dī. ni. 2.31).
As it is said: “Indeed, Ānanda, the Bodhisatta, just after being born, having stood with even feet, goes with a stride of seven steps facing north, while a white parasol is being held over him, and he surveys all the directions and utters a bull-like utterance: ‘I am the chief in the world, I am the eldest in the world, I am the foremost in the world. This is my last birth. Now there is no more renewed existence.’”
Như đã nói: “Này Ānanda, Bồ Tát vừa mới đản sinh, đứng vững bằng đôi chân bằng phẳng, hướng về phía Bắc, đi bảy bước, trong khi lọng trắng được che, Ngài nhìn khắp các phương, và Ngài nói lời hùng tráng: ‘Ta là tối thượng của thế gian, Ta là trưởng thượng của thế gian, Ta là tối thắng của thế gian. Đây là kiếp cuối cùng, không còn tái sinh nữa.’”
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ pahāya gato, abyāpādena byāpādaṃ, ālokasaññāya thinamiddhaṃ, avikkhepena uddhaccakukkuccaṃ, dhammavavatthānena vicikicchaṃ pahāya ñāṇena avijjaṃ padāletvā, pāmojjena aratiṃ vinodetvā, paṭhamajjhānena nīvaraṇakavāṭaṃ ugghāṭetvā, dutiyajjhānena vitakkavicāraṃ vūpasametvā, tatiyajjhānena pītiṃ virājetvā, catutthajjhānena sukhadukkhaṃ pahāya, ākāsānañcāyatanasamāpattiyā rūpasaññāpaṭighasaññānānattasaññāyo samatikkamitvā, viññāṇañcāyatanasamāpattiyā ākāsānañcāyatanasaññaṃ, ākiñcaññāyatanasamāpattiyā viññāṇañcāyatanasaññaṃ, nevasaññānāsaññāyatanasamāpattiyā ākiñcaññāyatanasaññaṃ samatikkamitvā gato.
Or else, just as the Blessed One Vipassī... and so on... just as the Blessed One Kassapa, so too this Blessed One has gone: by renunciation, abandoning sensual desire; by non-ill-will, ill-will; by the perception of light, sloth and torpor; by non-distraction, restlessness and worry; by the determination of dhammas, doubt; by knowledge, having shattered ignorance; by joy, having dispelled discontent; by the first jhānic state, having opened the door of the hindrances; by the second jhānic state, having calmed applied and sustained thought; by the third jhānic state, having become dispassionate towards rapture; by the fourth jhānic state, abandoning pleasure and pain; by the attainment of the base of the infinity of space, having transcended perceptions of form, perceptions of resistance, and perceptions of diversity; by the attainment of the base of the infinity of consciousness, the perception of the base of the infinity of space; by the attainment of the base of nothingness, the perception of the base of the infinity of consciousness; by the attainment of the base of neither-perception-nor-non-perception, having transcended the perception of the base of nothingness, he has gone.
Hoặc là, như Đức Thế Tôn Vipassī… (tương tự)… như Đức Thế Tôn Kassapa, Đức Thế Tôn này cũng đã đi như thế, Ngài đã từ bỏ dục ái bằng sự xuất ly (nekkhammena), đã từ bỏ sân hận bằng sự vô sân (abyāpādena), đã từ bỏ hôn trầm thụy miên bằng tưởng ánh sáng (ālokasaññāya), đã từ bỏ trạo cử hối hận bằng sự không phóng dật (avikkhepena), đã từ bỏ nghi ngờ bằng sự phân biệt pháp (dhammavavatthānena), đã phá tan vô minh bằng trí tuệ (ñāṇena), đã xua tan sự bất mãn bằng niềm hoan hỷ (pāmojjena), đã mở cánh cửa che chướng ngại bằng sơ thiền (paṭhamajjhānena), đã làm lắng dịu tầm tứ bằng nhị thiền (dutiyajjhānena), đã ly hỷ bằng tam thiền (tatiyajjhānena), đã từ bỏ lạc khổ bằng tứ thiền (catutthajjhānena), đã vượt qua sắc tưởng, chướng ngại tưởng, dị biệt tưởng bằng định Không Vô Biên Xứ (ākāsānañcāyatanasamāpattiyā), đã vượt qua Không Vô Biên Xứ tưởng bằng định Thức Vô Biên Xứ (viññāṇañcāyatanasamāpattiyā), đã vượt qua Thức Vô Biên Xứ tưởng bằng định Vô Sở Hữu Xứ (ākiñcaññāyatanasamāpattiyā), đã vượt qua Vô Sở Hữu Xứ tưởng bằng định Phi Tưởng Phi Phi Tưởng Xứ (nevasaññānāsaññāyatanasamāpattiyā).
Aniccānupassanāya niccasaññaṃ pahāya, dukkhānupassanāya sukhasaññaṃ, anattānupassanāya attasaññaṃ, nibbidānupassanāya nandiṃ, virāgānupassanāya rāgaṃ, nirodhānupassanāya samudayaṃ, paṭinissaggānupassanāya ādānaṃ, khayānupassanāya ghanasaññaṃ, vayānupassanāya āyūhanaṃ, vipariṇāmānupassanāya dhuvasaññaṃ, animittānupassanāya nimittaṃ, appaṇihitānupassanāya paṇidhiṃ, suññatānupassanāya abhinivesaṃ, adhipaññādhammavipassanāya sārādānābhinivesaṃ, yathābhūtañāṇadassanena sammohābhinivesaṃ, ādīnavānupassanāya ālayābhinivesaṃ, paṭisaṅkhānupassanāya appaṭisaṅkhaṃ, vivaṭṭānupassanāya saṃyogābhinivesaṃ, sotāpattimaggena diṭṭhekaṭṭhe kilese bhañjitvā, sakadāgāmimaggena oḷārike kilese pahāya, anāgāmimaggena aṇusahagate kilese samugghāṭetvā, arahattamaggena sabbakilese samucchinditvā gato.
By contemplation of impermanence, abandoning the perception of permanence; by contemplation of suffering, the perception of pleasure; by contemplation of non-self, the perception of self; by contemplation of disenchantment, delight; by contemplation of dispassion, passion; by contemplation of cessation, the origin; by contemplation of relinquishment, grasping; by contemplation of destruction, the perception of solidity; by contemplation of vanishing, accumulation; by contemplation of change, the perception of stability; by contemplation of the signless, the sign; by contemplation of the desireless, desire; by contemplation of emptiness, adherence; by insight into things through higher wisdom, the adherence of grasping at a core; by the knowledge and vision of things as they really are, the adherence of delusion; by contemplation of danger, the adherence of attachment; by contemplation of reflection, non-reflection; by contemplation of turning away, the adherence of fetters, he has gone. By the path of stream-entry, having destroyed the defilements that are of the same station as views; by the path of a once-returner, abandoning the gross defilements; by the path of a non-returner, uprooting the subtle defilements; by the path of Arahantship, having completely cut off all defilements, he has gone.
Ngài đã từ bỏ thường tưởng bằng quán vô thường (aniccānupassanāya), đã từ bỏ lạc tưởng bằng quán khổ (dukkhānupassanāya), đã từ bỏ ngã tưởng bằng quán vô ngã (anattānupassanāya), đã từ bỏ sự hoan hỷ bằng quán yếm ly (nibbidānupassanāya), đã từ bỏ tham ái bằng quán ly tham (virāgānupassanāya), đã từ bỏ sự sinh khởi bằng quán diệt (nirodhānupassanāya), đã từ bỏ sự chấp thủ bằng quán xả ly (paṭinissaggānupassanāya), đã từ bỏ kiên cố tưởng bằng quán hoại diệt (khayānupassanāya), đã từ bỏ sự tích lũy bằng quán tiêu vong (vayānupassanāya), đã từ bỏ thường hằng tưởng bằng quán biến hoại (vipariṇāmānupassanāya), đã từ bỏ tướng bằng quán vô tướng (animittānupassanāya), đã từ bỏ sự ước muốn bằng quán vô nguyện (appaṇihitānupassanāya), đã từ bỏ sự chấp trước bằng quán không (suññatānupassanāya), đã từ bỏ sự chấp trước vào việc nắm giữ tinh túy bằng quán pháp tuệ quán ưu việt (adhipaññādhammavipassanāya), đã từ bỏ sự chấp trước vào sự si mê bằng trí tuệ thấy biết như thật (yathābhūtañāṇadassanena), đã từ bỏ sự chấp trước vào sự bám víu bằng quán nguy hiểm (ādīnavānupassanāya), đã từ bỏ sự không suy xét bằng quán suy xét (paṭisaṅkhānupassanāya), đã từ bỏ sự chấp trước vào sự ràng buộc bằng quán thoát ly (vivaṭṭānupassanāya), đã phá tan các phiền não gắn liền với tà kiến bằng Sơ quả Tu-đà-hoàn (sotāpattimaggena), đã từ bỏ các phiền não thô thiển bằng Nhị quả Tư-đà-hàm (sakadāgāmimaggena), đã nhổ tận gốc các phiền não vi tế bằng Tam quả A-na-hàm (anāgāmimaggena), đã đoạn trừ tất cả các phiền não bằng Tứ quả A-la-hán (arahattamaggena) và đã đi đến giải thoát.
Evampi tathā gatoti tathāgato.
In this way too, “thus gone” is Tathāgata.
Như vậy là “đã đi như thế” nên gọi là Tathāgata.
Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ.
by restlessness, of the power of concentration; the characteristic of being unshakable by ignorance, of the power of wisdom.
Tướng an trú của niệm giác chi (satisambojjhaṅga).
Dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ.
The characteristic of establishment of the enlightenment factor of mindfulness.
Tướng phân tích của trạch pháp giác chi (dhammavicayasambojjhaṅga).
Vīriyasambojjhaṅgassa paggahalakkhaṇaṃ.
The characteristic of investigation of the enlightenment factor of investigation of dhammas.
Tướng tinh tấn của cần giác chi (vīriyasambojjhaṅga).
Pītisambojjhaṅgassa pharaṇalakkhaṇaṃ.
The characteristic of exertion of the enlightenment factor of energy.
Tướng lan tỏa của hỷ giác chi (pītisambojjhaṅga).
Passaddhisambojjhaṅgassa vūpasamalakkhaṇaṃ.
The characteristic of pervading of the enlightenment factor of rapture.
Tướng lắng dịu của khinh an giác chi (passaddhisambojjhaṅga).
Samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ.
The characteristic of calming of the enlightenment factor of tranquility.
Tướng không tán loạn của định giác chi (samādhisambojjhaṅga).
Upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.
The characteristic of non-distraction of the enlightenment factor of concentration.
Tướng suy xét của xả giác chi (upekkhāsambojjhaṅga).
Sammādiṭṭhiyā dassanalakkhaṇaṃ.
The characteristic of reflection of the enlightenment factor of equanimity.
Tướng thấy biết của chánh kiến (sammādiṭṭhi).
Sammāsaṅkappassa abhiniropanalakkhaṇaṃ.
The characteristic of seeing of Right View.
Tướng đặt tâm vào đối tượng của chánh tư duy (sammāsaṅkappa).
Sammāvācāya pariggahalakkhaṇaṃ.
The characteristic of directing the mind of Right Thought.
Tướng gìn giữ của chánh ngữ (sammāvācā).
Sammākammantassa samuṭṭhānalakkhaṇaṃ.
The characteristic of embracing of Right Speech.
Tướng sinh khởi của chánh nghiệp (sammākammanta).
Sammāājīvassa vodānalakkhaṇaṃ.
The characteristic of originating of Right Action.
Tướng thanh tịnh của chánh mạng (sammāājīva).
Sammāvāyāmassa paggahalakkhaṇaṃ.
The characteristic of cleansing of Right Livelihood.
Tướng tinh tấn của chánh tinh tấn (sammāvāyāma).
Sammāsatiyā upaṭṭhānalakkhaṇaṃ.
The characteristic of exertion of Right Effort.
Tướng an trú của chánh niệm (sammāsati).
Sammāsamādhissa avikkhepalakkhaṇaṃ.
The characteristic of establishment of Right Mindfulness.
Tướng không tán loạn của chánh định (sammāsamādhi).
Avijjāya aññāṇalakkhaṇaṃ.
The characteristic of non-distraction of Right Concentration.
Tướng không biết của vô minh (avijjā).
Saṅkhārānaṃ cetanālakkhaṇaṃ.
The characteristic of ignorance of ignorance.
Tướng tư tác của hành (saṅkhāra).
Viññāṇassa vijānanalakkhaṇaṃ.
The characteristic of volition of formations.
Tướng nhận biết của thức (viññāṇa).
Nāmassa namanalakkhaṇaṃ.
The characteristic of cognizing of consciousness.
Tướng nghiêng về đối tượng của danh (nāma).
Rūpassa ruppanalakkhaṇaṃ.
The characteristic of bending of name.
Tướng biến hoại của sắc (rūpa).
Saḷāyatanassa āyatanalakkhaṇaṃ.
The characteristic of being afflicted of form.
Tướng sinh khởi của sáu xứ (saḷāyatana).
Phassassa phusanalakkhaṇaṃ.
The characteristic of being a base of the six sense bases.
Tướng xúc chạm của xúc (phassa).
Vedanāya vedayitalakkhaṇaṃ.
The characteristic of touching of contact.
Tướng cảm thọ của thọ (vedanā).
Taṇhāya hetulakkhaṇaṃ.
The characteristic of feeling of feeling.
Tướng nguyên nhân của ái (taṇhā).
Upādānassa gahaṇalakkhaṇaṃ.
The characteristic of being a cause of craving.
Tướng chấp thủ của thủ (upādāna).
Bhavassa āyūhanalakkhaṇaṃ.
The characteristic of grasping of clinging.
Tướng tạo tác của hữu (bhava).
Jātiyā nibbattilakkhaṇaṃ.
The characteristic of accumulating of existence.
Tướng sinh khởi của sinh (jāti).
Jarāya jīraṇalakkhaṇaṃ.
The characteristic of being produced of birth.
Tướng già nua của lão (jarā).
Maraṇassa cutilakkhaṇaṃ.
The characteristic of aging of aging.
Tướng hoại diệt của tử (maraṇa).
Dhātūnaṃ suññatālakkhaṇaṃ.
The characteristic of passing away of death.
Tướng không của các giới (dhātu).
Āyatanānaṃ āyatanalakkhaṇaṃ.
The characteristic of emptiness of the elements.
Tướng sinh khởi của các xứ (āyatana).
Satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ.
The characteristic of being a base of the sense bases.
Tướng an trú của các niệm xứ (satipaṭṭhāna).
Sammappadhānānaṃ padahanalakkhaṇaṃ.
The characteristic of establishment of the foundations of mindfulness.
Tướng tinh tấn của các chánh cần (sammappadhāna).
Iddhipādānaṃ ijjhanalakkhaṇaṃ.
The characteristic of striving of the right strivings.
Tướng thành tựu của các thần túc (iddhipāda).
Indriyānaṃ adhipatilakkhaṇaṃ.
The characteristic of success of the bases of spiritual power.
Tướng làm chủ của các căn (indriya).
Balānaṃ akampiyalakkhaṇaṃ.
Of the powers, the characteristic is unshakability.
Đặc tính của các Ba-la (Lực) là không bị lay chuyển.
Bojjhaṅgānaṃ niyyānalakkhaṇaṃ.
Of the factors of enlightenment, the characteristic is leading out.
Đặc tính của các Bojjhaṅga (Giác chi) là đưa đến sự giải thoát.
Maggassa hetulakkhaṇaṃ.
Of the path, the characteristic is being a cause.
Đặc tính của Magga (Đạo) là nhân tố dẫn đến Niết Bàn.
Chandassa mūlalakkhaṇaṃ.
Of zeal, the characteristic is being the root.
Đặc tính của Chanda (Dục) là gốc rễ.
Manasikārassa samuṭṭhāpanalakkhaṇaṃ.
Of attention, the characteristic is arousing.
Đặc tính của Manasikāra (Tác ý) là sự khởi lên.
Phassassa samodhānalakkhaṇaṃ.
Of contact, the characteristic is coordinating.
Đặc tính của Phassa (Xúc) là sự hội tụ.
Vedanāya samosaraṇalakkhaṇaṃ.
Of feeling, the characteristic is being what is converged upon.
Đặc tính của Vedanā (Thọ) là sự quy tụ.
Samādhissa pamukhalakkhaṇaṃ.
Of concentration, the characteristic is being foremost.
Đặc tính của Samādhi (Định) là sự đứng đầu.
Satiyā ādhipateyyalakkhaṇaṃ.
Of mindfulness, the characteristic is sovereignty.
Đặc tính của Sati (Niệm) là sự thống trị.
Paññāya tatuttariyalakkhaṇaṃ.
Of wisdom, the characteristic is being superior to them.
Đặc tính của Paññā (Tuệ) là sự vượt trội hơn thế.
Vimuttiyā sāralakkhaṇaṃ… amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ.
Of liberation, the characteristic is being the essence… of Nibbāna, which is the immersion in the deathless, the characteristic is being the culmination—this is true and not otherwise.
Đặc tính của Vimutti (Giải thoát) là tinh túy... Đặc tính của Nibbāna (Niết Bàn) là sự chấm dứt của Brahma-cariya (phạm hạnh) - Niết Bàn, nơi bất tử (amata) được đạt đến, là chân thật, không sai lạc.
Evaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato.
Thus, having come to the true characteristic by the way of knowledge, having reached and attained it without error, he is the Tathāgata.
Như vậy, Ngài đã đến với sự vận hành của trí tuệ đến các đặc tính chân thật này, không sai lệch mà đạt được, nên gọi là Tathāgata.
Evaṃ tathalakkhaṇaṃ āgatoti tathāgato.
Thus, because he has gone to the true characteristic, he is the Tathāgata.
Như vậy, Ngài đã đến với các đặc tính chân thật này, nên gọi là Tathāgata.
Kathaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato? Tathadhammā nāma cattāri ariyasaccāni.
How is he the Tathāgata because he has perfectly awakened to true dhammas as they really are? True dhammas are the Four Noble Truths.
Làm thế nào mà Ngài là Tathāgata vì đã giác ngộ đúng như thật các pháp chân thật? Các pháp chân thật là Tứ Diệu Đế.
Yathāha – ‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni.
As it is said: “Bhikkhus, these four things are true, not false, not otherwise.
Như đã nói – “Này các Tỳ-khưu, có bốn điều này là chân thật, không sai lạc, không khác biệt.
Katamāni cattāri?
What four?
Bốn điều nào?
‘Idaṃ dukkha’nti bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1090) vitthāro.
‘This is suffering,’ bhikkhus, this is true, this is not false, this is not otherwise,” and so on in detail.
Này các Tỳ-khưu, ‘Đây là Khổ’ – điều này là chân thật, điều này không sai lạc, điều này không khác biệt” – và cứ thế (Saṃ. Ni. 5.1090) là phần mở rộng.
Tāni ca bhagavā abhisambuddho, tasmā tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati.
The Blessed One has perfectly awakened to these; therefore, because of having perfectly awakened to true dhammas, he is called the Tathāgata.
Và Thế Tôn đã giác ngộ các điều đó, do đó, vì đã giác ngộ các pháp chân thật, Ngài được gọi là Tathāgata.
Abhisambuddhattho hettha gatasaddo.
Here, the word ‘gata’ has the meaning of ‘perfectly awakened’.
Ở đây, từ "gata" có nghĩa là "abhisambuddha" (đã giác ngộ).
Api ca jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, tathā avijjāya saṅkhārānaṃ paccayaṭṭho, saṅkhārānaṃ viññāṇassa paccayaṭṭho…pe…, jātiyā jarāmaraṇassa paccayaṭṭho tatho avitatho anaññatho.
Moreover, the state of old age and death, being well-produced and arisen from birth as its condition, is true, not false, not otherwise… The state of formations, being well-produced and arisen from ignorance as their condition, is true, not false, not otherwise… Likewise, the state of ignorance as a condition for formations, the state of formations as a condition for consciousness… the state of birth as a condition for old age and death, is true, not false, not otherwise.
Hơn nữa, sự sanh khởi và tập khởi của già chết do duyên sanh là chân thật, không sai lạc, không khác biệt… (cứ thế)… sự sanh khởi và tập khởi của các hành do duyên vô minh là chân thật, không sai lạc, không khác biệt… (cứ thế)… cũng vậy, vô minh là duyên cho các hành, các hành là duyên cho thức… (cứ thế)… sanh là duyên cho già chết là chân thật, không sai lạc, không khác biệt.
Taṃ sabbaṃ bhagavā abhisambuddho, tasmāpi tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati.
The Blessed One has perfectly awakened to all of that; therefore, too, because of having perfectly awakened to true dhammas, he is called the Tathāgata.
Thế Tôn đã giác ngộ tất cả những điều đó, do đó, vì đã giác ngộ các pháp chân thật, Ngài cũng được gọi là Tathāgata.
Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.
Thus, he is the Tathāgata because he has perfectly awakened to true dhammas as they really are.
Như vậy, Ngài là Tathāgata vì đã giác ngộ đúng như thật các pháp chân thật.
Kathaṃ tathadassitāya tathāgato? Bhagavā yaṃ sadevake loke…pe…, sadevamanussāya pajāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthamāgacchantaṃ rūpārammaṇaṃ nāma atthi, taṃ sabbākārato jānāti passati.
How is he the Tathāgata because of seeing what is true? Whatever visible object there is in the world with its devas… for the generation with its devas and humans, that comes into the range of the eye-door of innumerable beings in innumerable world systems, the Blessed One knows and sees it in all its aspects.
Làm thế nào mà Ngài là Tathāgata vì đã thấy biết đúng như thật? Thế Tôn biết và thấy tất cả các sắc cảnh giới khả kiến hiện hữu trong thế gian này cùng với chư thiên… (cứ thế)… trong vô số thế giới của vô số chúng sanh cùng với chư thiên và loài người, hiện ra trước nhãn căn.
Evaṃ jānatā passatā ca, tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā.
And by him who knows and sees thus, that visible object—whether by way of being desirable, undesirable, etc., or by way of the term applicable among what is seen, heard, sensed, and cognized—
Khi biết và thấy như vậy, dù là theo ý muốn hay không muốn, hoặc theo các từ ngữ có thể tìm thấy trong những gì đã thấy, đã nghe, đã cảm nhận, đã biết.
‘‘Katamaṃ taṃ rūpaṃ rūpāyatanaṃ?
“What is that form which is the form base?
“Sắc đó, sắc xứ đó là gì?
Yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītaka’’ntiādinā (dha. sa. 616) nayena anekehi nāmehi terasahi vārehi dvepaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi.
That form derived from the four great elements, which is of the nature of color, visible and impinging, blue, yellow,” and so on, when analyzed by way of many names, thirteen sections, and fifty-two methods, is just so, and there is nothing false.
Sắc nương vào bốn đại chủng, có vẻ ngoài và màu sắc, có thể thấy, có thể chạm, màu xanh, màu vàng,” v.v. (Dhamma. Sa. 616) theo cách này, được phân loại bằng nhiều tên gọi, mười ba lần, năm mươi hai cách, thì nó vẫn là như vậy, không có gì sai khác.
Esa nayo sotadvārādīsupi āpāthaṃ āgacchantesu saddādīsu.
This is the method also for sounds and so on that come into the range of the ear-door and so on.
Nguyên tắc này cũng áp dụng cho âm thanh và các đối tượng khác xuất hiện ở nhĩ căn, v.v.
Vuttañcetaṃ bhagavatā – ‘‘yaṃ bhikkhave, sadevakassa lokassa…pe… sadevamanussāya pajāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi.
And this was said by the Blessed One: “Bhikkhus, whatever in the world with its devas… for the generation with its devas and humans, is seen, heard, sensed, cognized, attained, sought, and mentally pondered upon, that I know.
Và điều này đã được Thế Tôn nói: “Này các Tỳ-khưu, những gì đã được thấy, đã được nghe, đã được cảm nhận, đã được biết, đã được đạt tới, đã được tìm kiếm, đã được suy xét bằng tâm của thế gian này cùng với chư thiên… (cứ thế)… của loài người cùng với chư thiên, Ta đều biết.
Tamahaṃ abbhaññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ti (a. ni. 4.24).
That I have fully understood. That is known to the Tathāgata, but the Tathāgata has not clung to it.”
Ta đã giác ngộ điều đó, điều đó đã được Tathāgata biết rõ, Tathāgata không bám víu vào điều đó” (A. Ni. 4.24).
Evaṃ tathadassitāya tathāgato.
Thus, he is the Tathāgata because of seeing what is true.
Như vậy, Ngài là Tathāgata vì đã thấy biết đúng như thật.
Tattha tathadassī atthe tathāgatoti padasambhavo veditabbo.
Therein, the derivation of the term ‘Tathāgata’ should be understood in the sense of one who sees what is true.
Ở đây, cần hiểu rằng sự hình thành từ "Tathāgata" là từ nghĩa "Tathādassī" (người thấy biết đúng như thật).
Kathaṃ tathavāditāya tathāgato? Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno tiṇṇaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ – suttaṃ, geyyaṃ…pe… vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anupavajjaṃ, anūnamanadhikaṃ, sabbākāraparipuṇṇaṃ, rāgamadanimmadanaṃ, dosamohamadanimmadanaṃ.
How is he the Tathāgata because of speaking what is true? On the night the Blessed One, sitting on the unconquered throne at the Bodhi-maṇḍa, having crushed the heads of the three Māras, perfectly awakened to the supreme, perfect enlightenment, and on the night he attained final Nibbāna with the Nibbāna-element that has no residue remaining, between these two, during the period of forty-five years, whatever was spoken by the Blessed One in the first, middle, and final periods of awakening—Sutta, Geyya… Vedalla—all of it is blameless in meaning and phrasing, neither deficient nor excessive, completely perfect in every aspect, subduing the intoxication of lust, subduing the intoxication of hatred and delusion.
Làm thế nào mà Ngài là Tathāgata vì đã nói đúng như thật? Trong đêm mà Thế Tôn ngồi trên bồ đoàn bất bại tại Bồ Đề Đạo Tràng, đã chế ngự ba ma, và đã giác ngộ Vô Thượng Chánh Đẳng Giác; và đêm mà Ngài nhập Niết Bàn vô dư y giới giữa hai cây sālā song thọ, trong khoảng thời gian bốn mươi lăm năm đó, những gì Thế Tôn đã thuyết giảng – kinh, kệ… (cứ thế)… vedalla – dù là trong thời kỳ giác ngộ đầu tiên, giữa hay cuối, tất cả đều không có lỗi lầm về nghĩa và văn tự, không thiếu không thừa, hoàn hảo về mọi phương diện, làm tiêu tan sự say đắm của tham, sân, si.
Natthi tattha vālaggamattampi avakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷiyā mitaṃ viya, ekatulāya tulitaṃ viya ca, tathameva hoti avitathaṃ anaññathaṃ.
Therein, there is not even a hair’s tip of error; all of it is as if stamped with a single seal, as if measured with a single nāḷi, as if weighed with a single scale; it is just so, not false, not otherwise.
Không có một lời nào dù nhỏ như đầu sợi lông bị sai sót, tất cả đều giống như được đóng một con dấu, như được đo bằng một ống, như được cân bằng một cái cân, đều là như vậy, không sai lạc, không khác biệt.
Tenāha – ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tatheva hoti, no aññathā.
Therefore he said: “Cunda, on the night the Tathāgata perfectly awakens to the supreme, perfect enlightenment, and on the night he attains final Nibbāna with the Nibbāna-element that has no residue remaining, whatever he speaks, utters, and points out in between, all of it is just so and not otherwise.
Do đó, Ngài nói: “Này Cunda, đêm mà Như Lai giác ngộ Vô Thượng Chánh Đẳng Giác, và đêm mà Ngài nhập Niết Bàn vô dư y giới, những gì Ngài thuyết giảng, nói ra, chỉ dạy trong khoảng thời gian đó, tất cả đều là như vậy, không khác.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore he is called ‘Tathāgata’.”
Do đó, Ngài được gọi là ‘Tathāgata’” (A. Ni. 4.23).
Gadattho hettha gatasaddo.
Here, the word ‘gata’ has the meaning of ‘spoken’.
Ở đây, từ "gata" có nghĩa là "gadā" (đã nói).
Evaṃ tathavāditāya tathāgato.
Thus, he is the Tathāgata because of speaking what is true.
Như vậy, Ngài là Tathāgata vì đã nói đúng như thật.
Kathaṃ tathākāritāya tathāgato? Bhagavato hi vācāya kāyo anulometi, kāyassapi vācā, tasmā yathāvādī tathākārī, yathākārī tathāvādī ca hoti.
How is he the Tathāgata because he acts in that way? Indeed, the Blessed One's body conforms to his speech, and his speech to his body; therefore, as he speaks, so he acts, and as he acts, so he speaks.
Làm thế nào mà Ngài là Tathāgata vì đã hành động đúng như thật? Đối với Thế Tôn, thân Ngài phù hợp với lời nói, và lời nói Ngài cũng phù hợp với thân. Do đó, Ngài nói sao làm vậy, làm sao nói vậy.
Evaṃbhūtassa cassa yathāvācā, kāyopi tathā gato pavattoti attho.
For him who is thus, the meaning is: as his speech proceeded, so also his body proceeded and occurred.
Đối với một vị như vậy, lời nói như thế nào, thân cũng vận hành như thế đó.
Yathā ca kāyo, vācāpi tathā gatā pavattāti tathāgato.
And as his body, so also his speech proceeded and occurred; thus, he is the Tathāgata.
Và thân như thế nào, lời nói cũng vận hành như thế đó, nên gọi là Tathāgata.
Tenevāha – ‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī.
Therefore he said: “Bhikkhus, as the Tathāgata speaks, so he acts; as he acts, so he speaks.
Do đó, Ngài nói: “Này các Tỳ-khưu, Như Lai nói sao làm vậy, làm sao nói vậy.
Iti yathāvādī tathākārī yathākārī tathāvādī.
Thus, as he speaks, so he acts; as he acts, so he speaks.
Như vậy, nói sao làm vậy, làm sao nói vậy.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore he is called ‘Tathāgata’.”
Do đó, Ngài được gọi là ‘Tathāgata’” (A. Ni. 4.23).
Evaṃ tathākāritāya tathāgato.
Thus, he is the Tathāgata because he acts in that way.
Như vậy, Ngài là Tathāgata vì đã hành động đúng như thật.
Kathaṃ abhibhavanaṭṭhena tathāgato? Upari bhavaggaṃ heṭṭhā avīciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati sīlenapi samādhināpi paññāyapi vimuttiyāpi, vimuttiñāṇadassanenapi na tassa tulā vā pamāṇaṃ vā atthi; atulo appameyyo anuttaro rājātirājā devadevo sakkānaṃ atisakko brahmānaṃ atibrahmā.
How is he the Tathāgata in the sense of overcoming? Having set the highest existence above and the Avīci hell below as the limits, across innumerable world systems, he overcomes all beings by virtue, by concentration, by wisdom, by liberation, and by the knowledge and vision of liberation. There is no equal or measure for him; he is unequaled, immeasurable, supreme, king of kings, deva of devas, supreme among Sakkas, supreme among Brahmās.
Làm thế nào mà Ngài là Tathāgata vì đã vượt trội? Ngài vượt trội hơn tất cả chúng sanh về giới, định, tuệ, giải thoát và giải thoát tri kiến, từ Bhavagga (đỉnh hữu) ở trên đến Avīci (địa ngục Vô gián) ở dưới, và ở các thế giới vô biên theo chiều ngang; không có ai sánh bằng hay đo lường được với Ngài; Ngài là vô song, vô lượng, vô thượng, vua của các vua, thiên của các thiên, Sakka (Đế Thích) của các Sakka, Brahma của các Brahma.
Tenāha – ‘‘sadevake, bhikkhave, loke…pe… sadevamanussāya pajāya tathāgato abhibhū anabhibhūto aññadatthudaso vasavattī, tasmā ‘tathāgato’ti vuccatī’’ti.
Therefore he said: “Bhikkhus, in the world with its devas… for the generation with its devas and humans, the Tathāgata is the overcomer, the unconquered, the all-seeing, the wielder of power. Therefore, he is called ‘Tathāgata’.”
Do đó, Ngài nói: “Này các Tỳ-khưu, trong thế gian này cùng với chư thiên… (cứ thế)… trong loài người cùng với chư thiên, Tathāgata là người vượt trội, không bị ai vượt trội, thấy biết tất cả, làm chủ mọi thứ, do đó, Ngài được gọi là ‘Tathāgata’.”
Tatrevaṃ padasiddhi veditabbā.
Therein, the formation of the term should be understood thus.
Ở đây, sự hình thành từ ngữ cần được hiểu như sau:
Agado viya agado.
Like a medicine, he is an agada (antidote).
Agado giống như agado.
Ko panesa?
What is this?
Vậy cái gì là điều này?
Desanāvilāsamayo ceva puññussayo ca.
It consists of the splendor of his teaching and the accumulation of his merit.
Đó là sự phong phú của giáo pháp và sự tích lũy công đức.
Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati.
For he, this physician of great power, overcomes all holders of other views and the world with its devas with the divine antidote, just as one overcomes snakes.
Do đó, vị thầy thuốc vĩ đại này, với thần dược, đã vượt trội hơn tất cả các giáo phái khác và thế gian cùng với chư thiên, giống như người chữa rắn độc.
Iti sabbālokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññussayo ca agado assāti.
Thus, in overcoming all the world, this is the true, uncorrupted medicine, which consists of the grace of the teaching and an abundance of merit.
Do đó, trong việc chế ngự tất cả các thế gian, Pháp thoại huy hoàng và công đức tích lũy của Ngài là một loại thuốc thần kỳ chân thật, không sai lệch.
Da-kārassa ta-kāraṃ katvā tathāgatoti veditabbo.
By changing the letter 'da' to the letter 'ta', it should be understood as tathāgata.
Bằng cách biến âm chữ ‘da’ thành ‘ta’, nên hiểu là Tathāgata.
Evaṃ abhibhavanaṭṭhena tathāgato.
Thus, by the meaning of 'overcoming', he is the Tathāgata.
Như vậy, theo nghĩa chế ngự, Ngài là Tathāgata.
‘‘Loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto.
"Bhikkhus, the world has been fully understood by the Tathāgata; the Tathāgata is disjoined from the world.
“Này các Tỳ-khưu, thế gian đã được Như Lai giác ngộ hoàn toàn; Như Lai đã thoát ly khỏi thế gian.
Lokasamudayo, bhikkhave, tathāgatena abhisambuddho, lokasamudayo tathāgatassa pahīno.
Bhikkhus, the origin of the world has been fully understood by the Tathāgata; the origin of the world has been abandoned by the Tathāgata.
Này các Tỳ-khưu, nguồn gốc của thế gian đã được Như Lai giác ngộ hoàn toàn; nguồn gốc của thế gian đã được Như Lai đoạn trừ.
Lokanirodho, bhikkhave, tathāgatena abhisambuddho, lokanirodho tathāgatassa sacchikato.
Bhikkhus, the cessation of the world has been fully understood by the Tathāgata; the cessation of the world has been realized by the Tathāgata.
Này các Tỳ-khưu, sự diệt tận của thế gian đã được Như Lai giác ngộ hoàn toàn; sự diệt tận của thế gian đã được Như Lai chứng ngộ.
Lokanirodhagāminī paṭipadā, bhikkhave, tathāgatena abhisambuddhā, lokanirodhagāminī paṭipadā tathāgatassa bhāvitā.
Bhikkhus, the path leading to the cessation of the world has been fully understood by the Tathāgata; the path leading to the cessation of the world has been developed by the Tathāgata.
Này các Tỳ-khưu, con đường dẫn đến sự diệt tận của thế gian đã được Như Lai giác ngộ hoàn toàn; con đường dẫn đến sự diệt tận của thế gian đã được Như Lai tu tập.
Yaṃ bhikkhave, sadevakassa lokassa…pe… sabbaṃ taṃ tathāgatena abhisambuddhaṃ.
Bhikkhus, whatever in the world with its devas... and so on... all that has been fully understood by the Tathāgata.
Này các Tỳ-khưu, bất cứ điều gì thuộc về thế gian có chư thiên…pe… tất cả những điều đó đã được Như Lai giác ngộ hoàn toàn.
Tasmā, tathāgatoti vuccatī’’ti (a. ni. 4.23).
Therefore, he is called the Tathāgata."
Vì vậy, Ngài được gọi là Như Lai.”
Iti imāsu pañcasu pucchāsu adiṭṭhassa tāva kassaci dhammassa abhāvato tathāgatassa adiṭṭhajotanā pucchā natthi.
Among these five questions, since there is no dhamma whatsoever that is unseen by the Tathāgata, there is no question to illuminate the unseen for him.
Như vậy, trong năm loại câu hỏi này, không có câu hỏi để làm sáng tỏ điều chưa biết đối với Như Lai, vì không có bất kỳ pháp nào chưa được Ngài thấy biết.
‘‘Idaṃ nāma aññehi paṇḍitehi samaṇabrāhmaṇehi saddhiṃ saṃsanditvā desessāmī’’ti samannāhārasseva anuppajjanato diṭṭhasaṃsandanā pucchāpi natthi.
Since the thought, "I will teach this after comparing it with other wise ascetics and brahmins," never arises, there is also no question to compare the seen.
Cũng không có câu hỏi để so sánh điều đã biết, vì ý nghĩ “Ta sẽ giảng giải điều này sau khi so sánh với các bậc hiền trí, các Sa-môn, Bà-la-môn khác” không hề khởi lên.
Yasmā pana buddhānaṃ ekadhammepi āsappanā parisappanā natthi, bodhimaṇḍeyeva sabbā kaṅkhā chinnā; tasmā vimaticchedanā pucchāpi natthiyeva.
And since for Buddhas there is no wavering or vacillation regarding even a single dhamma, as all doubt was cut off at the seat of Awakening itself, there is also no question to cut off uncertainty.
Vì chư Phật không có sự nghi ngờ hay do dự dù chỉ về một pháp, tất cả mọi nghi ngờ đều đã được đoạn trừ ngay tại Bồ-đề đạo tràng; do đó, câu hỏi để đoạn trừ nghi ngờ cũng không có.
Avasesā pana dve pucchā buddhānaṃ atthi, tāsu ayaṃ kathetukamyatā pucchā nāma.
However, the remaining two questions do exist for Buddhas. Among them, this is a question out of a desire to speak.
Tuy nhiên, hai loại câu hỏi còn lại thì có đối với chư Phật. Trong số đó, đây là câu hỏi để mong muốn giảng giải.
Tattha pāṇassa atipāto pāṇātipāto, pāṇavadho, pāṇaghātoti vuttaṃ hoti.
Therein, the destruction of a living being's life is pāṇātipāta; it means the slaying of a living being, the killing of a living being.
Trong đó, sự sát hại sinh mạng là pāṇātipāta, tức là giết hại sinh mạng, làm hại sinh mạng.
Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ, tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto.
Here, a living being (pāṇo) conventionally means a creature; in the ultimate sense, it means the life-faculty. When there is perception of a living being as a living being, the murderous volition—arising from an effort that brings about the cutting off of the life-faculty and occurring through one of the two doors of body or speech—is pāṇātipāta.
Ở đây, sinh mạng (pāṇa) theo cách gọi thông thường là chúng sinh, theo nghĩa tối hậu là sinh mạng căn (jīvitindriya). Hành vi sát sinh (pāṇātipāta) là ý muốn giết hại khởi lên từ một trong hai cửa thân hoặc khẩu, nhằm mục đích cắt đứt sinh mạng căn của một chúng sinh mà người đó nhận thức là một chúng sinh.
So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo, kasmā?
This is slightly blameworthy in the case of small beings, such as animals, which are devoid of special qualities, and very blameworthy in the case of large-bodied beings. Why?
Hành vi sát sinh đó, đối với các loài vật không có phẩm hạnh như súc sinh, nếu là sinh vật nhỏ thì tội nhẹ, nếu là sinh vật lớn thì tội nặng. Tại sao?
Payogamahantatāya.
Because of the greatness of the effort.
Vì hành động có mức độ lớn.
Payogasamattepi vatthumahantatāya.
Even if the effort is the same, it is due to the greatness of the object.
Ngay cả khi hành động có mức độ tương đương, thì cũng do đối tượng lớn.
Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.
In the case of virtuous beings, such as humans, it is slightly blameworthy in the case of a being with few virtues and very blameworthy in the case of one with great virtues.
Đối với loài người có phẩm hạnh, nếu là người ít phẩm hạnh thì tội nhẹ, nếu là người có nhiều phẩm hạnh thì tội nặng.
Sarīraguṇānaṃ pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
However, it should be understood that when the body and virtues are equal, it is slightly blameworthy if the defilements and effort are gentle, and very blameworthy if they are intense.
Tuy nhiên, khi phẩm chất thân thể và phẩm hạnh tương đương, thì tội nhẹ do phiền não và hành động yếu ớt, và tội nặng do phiền não và hành động mãnh liệt.
Tassa pañca sambhārā honti – pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti.
It has five constituents: a living being, the perception of it as a living being, a murderous thought, the effort, and its death as a result.
Hành vi sát sinh có năm yếu tố cấu thành: chúng sinh (pāṇa), nhận thức về chúng sinh (pāṇasaññitā), ý định giết hại (vadhakacittaṃ), hành động giết hại (upakkamo), và cái chết do hành động đó (tena maraṇaṃ).
Cha payogā – sāhatthiko, āṇattiko, nissaggiyo, thāvaro, vijjāmayo, iddhimayoti.
There are six kinds of effort: by one's own hand, by command, by releasing, by establishing a permanent trap, by magical incantation, and by psychic power.
Có sáu phương thức hành động: tự tay giết (sāhatthiko), sai khiến giết (āṇattiko), ném vật để giết (nissaggiyo), cố định vật để giết (thāvaro), dùng bùa chú để giết (vijjāmayo), và dùng thần thông để giết (iddhimayo).
Imasmiṃ panatthe vitthāriyamāne ativiya papañco hoti, tasmā taṃ na vitthārayāma, aññañca evarūpaṃ.
If this matter were to be elaborated, it would become very diffuse; therefore, we will not elaborate on it, nor on other similar matters.
Nếu mở rộng ý nghĩa này thì sẽ rất dài dòng, do đó chúng ta sẽ không giải thích chi tiết, cũng như những trường hợp tương tự khác.
Atthikehi pana samantapāsādikaṃ vinayaṭṭhakathaṃ oloketvā gahetabbaṃ.
Those who are interested should look it up and grasp it from the Samantapāsādikā, the commentary on the Vinaya.
Những ai quan tâm có thể tham khảo từ chú giải Vinaya tên là Samantapāsādikā.
Nihitadaṇḍo nihitasatthoti parūpaghātatthāya daṇḍaṃ vā satthaṃ vā ādāya avattanato nikkhittadaṇḍo ceva nikkhittasattho cāti attho.
He has laid down the rod, laid down the weapon: Because he does not act with a rod or a weapon for the purpose of harming others, he has put down the rod and put down the weapon—this is the meaning.
Nihitadaṇḍo nihitasattho có nghĩa là đã đặt xuống gậy và vũ khí, tức là không dùng gậy hay vũ khí để làm hại người khác.
Ettha ca ṭhapetvā daṇḍaṃ sabbampi avasesaṃ upakaraṇaṃ sattānaṃ viheṭhanabhāvato satthanti veditabbaṃ.
Here, it should be known that, apart from a rod, any remaining instrument is a "weapon" (sattha) because it is a means of harassing beings.
Ở đây, cần hiểu rằng tất cả các dụng cụ còn lại, ngoại trừ gậy, đều được gọi là vũ khí nếu chúng có khả năng gây hại cho chúng sinh.
Yaṃ pana bhikkhū kattaradaṇḍaṃ vā dantakaṭṭhaṃ vā vāsiṃ pipphalikaṃ vā gahetvā vicaranti, na taṃ parūpaghātatthāya.
But when bhikkhus go about carrying a cutting-stick, a tooth-stick, an adze, or a small axe, it is not for the purpose of harming others.
Tuy nhiên, khi các Tỳ-khưu mang theo gậy cắt cỏ, tăm xỉa răng, dao hoặc cái đục, thì đó không phải là để làm hại người khác.
Tasmā nihitadaṇḍo nihitasattho tveva saṅkhyaṃ gacchati.
Therefore, he is reckoned only as one who has laid down the rod, one who has laid down the weapon.
Do đó, chỉ có người đã đặt gậy xuống, đã đặt vũ khí xuống mới được xem là như vậy.
Lajjīti pāpajigucchanalakkhaṇāya lajjāya samannāgato.
Conscientious: he is endowed with a sense of shame, which has the characteristic of despising evil.
Lajjī (tàm) có nghĩa là người có sự tàm quý, với đặc tính ghê tởm tội lỗi.
Dayāpannoti dayaṃ mettacittataṃ āpanno.
Compassionate: he has attained compassion, a mind of loving-kindness.
Dayāpanno (bi mẫn) có nghĩa là người đã đạt được lòng bi mẫn, tâm từ ái.
Sabbapāṇabhūtahitānukampīti; sabbe pāṇabhūte hitena anukampako.
Sympathetic for the welfare of all living beings: he is one who has sympathy for the welfare of all living beings.
Sabbapāṇabhūtahitānukampī (thương xót vì lợi ích của tất cả chúng sinh hữu tình) có nghĩa là người thương xót tất cả chúng sinh hữu tình vì lợi ích của họ.
Tāya dayāpannatāya sabbesaṃ pāṇabhūtānaṃ hitacittakoti attho.
The meaning is that, because he has attained that compassion, his mind is intent on the welfare of all living beings.
Nghĩa là, do lòng bi mẫn đó, vị ấy có tâm mong cầu lợi ích cho tất cả chúng sinh hữu tình.
Viharatīti iriyati yapeti yāpeti pāleti.
Dwells: he maintains his posture, he sustains himself, he carries on, he preserves.
Viharatī (an trú) có nghĩa là sống, duy trì, tiếp tục tồn tại.
Iti vā hi, bhikkhaveti evaṃ vā bhikkhave.
Or again, monks: or in this way, monks.
Iti vā hi, bhikkhave (này các Tỳ-khưu, hoặc là như vậy) —
Vā saddo upari ‘‘adinnādānaṃ pahāyā’’tiādīni apekkhitvā vikappattho vutto, evaṃ sabbattha purimaṃ vā pacchimaṃ vā apekkhitvā vikappabhāvo veditabbo.
The word 'or' is spoken with an alternative meaning in anticipation of the following phrases, such as "having abandoned taking what is not given." Thus, in every case, the alternative sense should be understood in relation to what comes before or after.
Từ vā ở đây được nói với nghĩa lựa chọn, liên quan đến các điều như “từ bỏ sự lấy của không cho” (adinnādānaṃ pahāya) ở trên; tương tự, ở mọi nơi, ý nghĩa lựa chọn nên được hiểu bằng cách liên hệ với điều trước hoặc điều sau.
Ayaṃ panettha saṅkhepo – bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno evaṃ vadeyya – ‘‘samaṇo gotamo pāṇaṃ na hanati, na ghāteti, na tattha samanuñño hoti, virato imasmā dussīlyā; aho, vata re buddhaguṇā mahantā’’ti, iti mahantaṃ ussāhaṃ katvā vaṇṇaṃ vattukāmopi appamattakaṃ oramattakaṃ ācārasīlamattakameva vakkhati.
Herein, this is the summary: monks, a worldling, when speaking in praise of the Tathāgata, would speak thus: "The ascetic Gotama does not kill living beings, does not cause them to be killed, and does not approve of it; he is abstinent from this immorality. Ah, indeed, the virtues of the Buddha are great!" In this way, even if he wishes to speak praise with great effort, he will speak only of the small and inferior matter of conduct-based virtue.
Đây là tóm tắt về vấn đề này: Này các Tỳ-khưu, một phàm nhân khi tán thán Thế Tôn có thể nói như sau: “Sa-môn Gotama không sát sinh, không khiến người khác sát sinh, không hoan hỷ trong việc đó, đã từ bỏ sự ác hạnh này; ôi, thật vĩ đại thay những đức tính của bậc Phật!” Dù rất cố gắng để tán thán, vị ấy cũng chỉ có thể nói về một chút, một phần nhỏ của giới hạnh và hành vi đạo đức.
Upari asādhāraṇabhāvaṃ nissāya vaṇṇaṃ vattuṃ na sakkhissati.
He will not be able to speak praise based on the higher, uncommon qualities.
Vị ấy sẽ không thể tán thán những phẩm chất phi thường ở cấp độ cao hơn.
Na kevalañca puthujjanova sotāpannasakadāgāmianāgāmiarahantopi paccekabuddhāpi na sakkontiyeva; tathāgatoyeva pana sakkoti, taṃ vo upari vakkhāmīti, ayamettha sādhippāyā atthavaṇṇanā.
And it is not only a worldling who is unable; even stream-enterers, once-returners, non-returners, arahants, and paccekabuddhas are unable. Only the Tathāgata himself is able. I will explain this to you further on. This is the meaningful explanation here.
Không chỉ phàm nhân, mà cả các bậc Dự Lưu, Nhất Lai, Bất Hoàn, A-la-hán và cả các vị Độc Giác Phật cũng không thể làm được; chỉ có Thế Tôn mới có thể, điều mà ta sẽ nói với các con ở phần trên – đây là lời giải thích ý nghĩa có chủ đích ở đây.
Ito paraṃ pana apubbapadameva vaṇṇayissāma.
From here on, we will explain only the new terms.
Từ đây trở đi, chúng ta sẽ chỉ giải thích những từ chưa được giải thích trước đó.
Adinnādānaṃ pahāyāti ettha adinnassa ādānaṃ adinnādānaṃ, parasaṃharaṇaṃ, theyyaṃ, corikāti vuttaṃ hoti.
Having abandoned taking what is not given: here, the taking of what is not given is adinnādāna. This is called carrying away what belongs to another, theft, or larceny.
Trong cụm từ Adinnādānaṃ pahāya (từ bỏ sự lấy của không cho), adinnādāna (lấy của không cho) có nghĩa là lấy của người khác, trộm cắp, hành vi trộm cắp.
Tattha adinnanti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti.
Therein, what is not given is what is possessed by another, regarding which the owner, in acting as he pleases, is not liable to punishment and is blameless.
Trong đó, adinna (của không cho) là vật thuộc sở hữu của người khác, mà đối với vật đó, người chủ có quyền tùy ý sử dụng mà không bị phạt hay bị khiển trách.
Tasmiṃ parapariggahite parapariggahitasaññino, tadādāyakaupakkamasamuṭṭhāpikā theyyacetanā adinnādānaṃ.
Regarding that which is possessed by another, the thievish intention—of one who perceives it as possessed by another and which gives rise to the effort of taking it—is adinnādāna.
Adinnādāna là ý muốn trộm cắp, phát sinh từ hành vi chiếm đoạt vật thuộc sở hữu của người khác, khi người đó nhận thức rằng đó là vật thuộc sở hữu của người khác.
Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ, kasmā?
It is a minor offense with regard to another's inferior property, and a grave offense with regard to superior property. Why?
Hành vi này ít tội lỗi nếu vật thuộc sở hữu của người khác là thấp kém, và rất tội lỗi nếu vật đó là cao quý, tại sao?
Vatthupaṇītatāya.
Because of the superiority of the object.
Vì sự cao quý của vật.
Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ.
When the objects are equal, it is a grave offense regarding property belonging to those of superior virtue.
Khi các vật có giá trị tương đương, hành vi này rất tội lỗi nếu vật đó thuộc về những người có phẩm hạnh cao hơn.
Taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
Depending on that person of superior virtue, it is a minor offense regarding property belonging to a person of inferior virtue.
Tùy thuộc vào phẩm hạnh cao hơn đó, hành vi này ít tội lỗi hơn nếu vật đó thuộc về người có phẩm hạnh thấp hơn.
Tassa pañca sambhārā honti – parapariggahitaṃ, parapariggahitasaññitā, theyyacittaṃ, upakkamo, tena haraṇanti.
It has five constituents: property possessed by another, perception that it is possessed by another, a thievish mind, effort, and the taking of it through that effort.
Có năm yếu tố cấu thành của hành vi này: vật thuộc sở hữu của người khác, nhận thức rằng đó là vật thuộc sở hữu của người khác, ý muốn trộm cắp, hành vi trộm cắp, và việc lấy đi vật đó.
Cha payogā – sāhatthikādayova.
There are six modes of application, namely, sāhatthika and so on.
Có sáu phương pháp: chỉ là tự tay thực hiện, v.v.
Te ca kho yathānurūpaṃ theyyāvahāro, pasayhāvahāro, paṭicchannāvahāro, parikappāvahāro, kusāvahāroti imesaṃ avahārānaṃ vasena pavattā, ayamettha saṅkhepo.
And these occur, as is appropriate, by way of these types of taking: taking by stealth, taking by force, taking what is concealed, taking by stratagem, and taking by means of a lot.
Và chúng được thực hiện theo các loại trộm cắp tương ứng như: trộm cắp bằng cách giấu giếm, trộm cắp bằng vũ lực, trộm cắp bằng cách che đậy, trộm cắp bằng mưu mẹo, trộm cắp bằng cách đánh tráo (thẻ bài) – đây là tóm tắt về vấn đề này.
Vitthāro pana samantapāsādikāyaṃ vutto.
A detailed account is given in the Samantapāsādikā.
Phần mở rộng đã được trình bày trong Samantapāsādikā.
Dinnameva ādiyatīti dinnādāyī. Cittenapi dinnameva paṭikaṅkhatīti dinnapāṭikaṅkhī. Thenetīti theno.
He takes only what is given, thus he is a taker of what is given. He expects only what is given even in his mind, thus he is one who waits for what is given. One who steals is a thief.
Dinnādāyī (chỉ lấy những gì được cho) có nghĩa là chỉ nhận những gì đã được cho. Dinnapāṭikaṅkhī (chỉ mong cầu những gì được cho) có nghĩa là ngay cả trong tâm cũng chỉ mong cầu những gì đã được cho. Theneti (trộm cắp) có nghĩa là kẻ trộm.
Na thenena athenena. Athenattāyeva sucibhūtena.
Not by a thief, thus not by thievishness. Because of not being a thief, he is pure.
Athenena (không phải kẻ trộm) có nghĩa là không phải kẻ trộm. Chính vì không phải kẻ trộm mà sucibhūtena (trong sạch).
Attanāti attabhāvena.
With himself: means with his own being.
Attanā (tự thân) có nghĩa là với thân này.
Athenaṃ sucibhūtaṃ attānaṃ katvā viharatīti vuttaṃ hoti.
It is said that he dwells having made himself not thievish and pure.
Nghĩa là, vị ấy sống bằng cách giữ cho thân mình không trộm cắp và trong sạch.
Sesaṃ paṭhamasikkhāpade vuttanayeneva yojetabbaṃ.
The rest should be connected in the same way as was explained in the first training rule.
Phần còn lại nên được liên kết theo cách đã nói trong giới thứ nhất.
Yathā ca idha, evaṃ sabbattha.
And as it is here, so it is everywhere else.
Và như ở đây, cũng vậy ở mọi nơi.
Aparo nayo, ‘musā’ti abhūtaṃ atacchaṃ vatthu.
Another method: falsehood is a non-existent, untrue matter.
Một cách khác, ‘musā’ (dối trá) là một sự việc không có thật, không đúng sự thật.
‘Vādo’ti tassa bhūtato tacchato viññāpanaṃ.
Speech is making that known as if it were existent and true.
‘Vādo’ (lời nói) là việc làm cho người khác biết sự việc đó là có thật, là đúng sự thật.
Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo.
By its characteristic, however, the volition of one who desires to make another know an untrue matter as true, which gives rise to that communication, is false speech.
Tuy nhiên, theo định nghĩa, musāvāda là ý muốn phát sinh sự thông báo như vậy, của người muốn làm cho người khác biết một sự việc không đúng sự thật là có thật.
So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
In accordance with the welfare it destroys, it is a minor offense if the welfare is small, and a grave offense if it is great.
Lời nói dối đó ít tội lỗi nếu nó phá hoại một lợi ích nhỏ, và rất tội lỗi nếu nó phá hoại một lợi ích lớn.
Tassa cattāro sambhārā honti – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti.
It has four constituents: an untrue matter, a mind set on deceiving, the corresponding effort, and another's understanding of that meaning.
Có bốn yếu tố cấu thành của hành vi này: sự việc không đúng sự thật, ý muốn lừa dối, nỗ lực tương ứng, và việc người khác hiểu được ý nghĩa đó.
Eko payogo sāhatthikova.
There is one mode of application: the personal one (sāhatthika).
Chỉ có một phương pháp: tự tay thực hiện.
So kāyena vā kāyapaṭibaddhena vā vācāya vā paravisaṃvādanakiriyākaraṇena daṭṭhabbo.
It should be understood as the act of deceiving another through the body, something connected to the body, or speech.
Và điều đó nên được hiểu là việc lừa dối người khác bằng thân, bằng vật liên quan đến thân, hoặc bằng lời nói.
Tāya ce kiriyāya paro tamatthaṃ jānāti, ayaṃ kiriyasamuṭṭhāpikacetanākkhaṇeyeva musāvādakammunā bajjhati.
If, by that action, the other person understands that meaning, then this person is bound by the kamma of false speech at the very moment of the volition that gave rise to the action.
Nếu người khác hiểu được ý nghĩa đó thông qua hành động đó, người này bị ràng buộc bởi nghiệp nói dối ngay tại khoảnh khắc ý muốn phát sinh hành động đó.
Yasmā pana yathā kāyakāyapaṭibaddhavācāhi paraṃ visaṃvādeti, tathā ‘‘idamassa bhaṇāhī’’ti āṇāpentopi paṇṇaṃ likhitvā purato nissajjantopi, ‘‘ayamattho evaṃ daṭṭhabbo’’ti kuḍḍādīsu likhitvā ṭhapentopi.
However, just as one deceives another by body, things connected to the body, and speech, so too does one who gives an order, saying, "Tell him this," or who writes a letter and places it before another, or who writes on a wall, "This matter is to be understood thus," and leaves it there.
Tuy nhiên, vì một người có thể lừa dối người khác bằng thân, bằng vật liên quan đến thân, bằng lời nói, cũng như bằng cách ra lệnh “hãy nói điều này cho người đó”, hoặc bằng cách viết thư và đặt trước mặt, hoặc bằng cách viết và đặt trên tường, v.v., rằng “ý nghĩa này nên được hiểu như thế này” –
Tasmā ettha āṇattikanissaggiyathāvarāpi payogā yujjanti, aṭṭhakathāsu pana anāgatattā vīmaṃsitvā gahetabbā.
Therefore, the modes of application by command, by relinquishment, and by permanent fixture are also appropriate here. However, as they are not found in the commentaries, they should be accepted after careful examination.
Do đó, ở đây, các phương pháp như āṇattika (ra lệnh), nissaggiya (từ bỏ), thāvara (ổn định) cũng phù hợp, nhưng vì chúng không được đề cập trong các chú giải, nên cần phải xem xét và chấp nhận.
Saccaṃ vadatīti saccavādī. Saccena saccaṃ sandahati ghaṭetīti saccasandho. Na antarantarā musā vadatīti attho.
He speaks the truth, thus he is a truth-speaker. He joins truth with truth, he connects them, thus he is one who joins with truth. The meaning is that he does not lie in between.
Saccavādī (người nói sự thật) có nghĩa là người nói sự thật. Saccasandho (người gắn kết sự thật) có nghĩa là người gắn kết sự thật với sự thật. Nghĩa là, vị ấy không nói dối xen kẽ.
Yo hi puriso kadāci musā vadati, kadāci saccaṃ, tassa musāvādena antaritattā saccaṃ saccena na ghaṭīyati; tasmā so na saccasandho.
Indeed, for a person who sometimes lies and sometimes speaks the truth, his truth is not connected with truth, being interrupted by falsehood; therefore, he is not one who joins with truth.
Vì một người nào đó đôi khi nói dối, đôi khi nói sự thật, thì sự thật của người đó không gắn kết với sự thật vì bị lời nói dối xen vào; do đó, người đó không phải là saccasandho.
Ayaṃ pana na tādiso, jīvitahetupi musā avatvā saccena saccaṃ sandahati yevāti saccasandho.
But this one is not like that; not telling a lie even for the sake of his life, he joins truth with truth, and so he is one who joins with truth.
Nhưng vị này không như vậy, ngay cả vì mạng sống cũng không nói dối, mà luôn gắn kết sự thật với sự thật, nên được gọi là saccasandho.
Paccayikoti pattiyāyitabbako, saddhāyitabbakoti attho.
Trustworthy: means one who can be believed, one who can be trusted.
Paccayiko (đáng tin cậy) có nghĩa là người đáng tin cậy, đáng tin tưởng.
Ekacco hi puggalo na paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘mā tassa vacanaṃ saddahathā’’ti vattabbataṃ āpajjati.
Indeed, a certain person is not trustworthy; when it is said, "Who said this? So-and-so," he becomes one of whom it should be said, "Do not believe his words."
Một số người không đáng tin cậy, khi được hỏi “điều này ai nói?”, và trả lời “người kia”, thì người ta sẽ nói “đừng tin lời người đó”.
Eko paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘yadi tena vuttaṃ, idameva pamāṇaṃ, idāni upaparikkhitabbaṃ natthi, evameva ida’’nti vattabbataṃ āpajjati, ayaṃ vuccati paccayiko.
One person is trustworthy (paccayiko). When asked, "Who said this?" and it is answered, "So-and-so," he becomes one who should be told, "If it was said by him, this itself is the standard. There is nothing to investigate now. This is exactly so." This person is called trustworthy (paccayiko).
Một người đáng tin cậy là người mà khi được hỏi, "Điều này ai nói?", và được trả lời, "Người kia nói", thì người đó nói rằng, "Nếu người kia đã nói, thì đây chính là chuẩn mực, không cần phải xem xét thêm nữa, sự việc là như vậy." Người như vậy được gọi là paccayiko (đáng tin cậy).
Avisaṃvādako lokassāti tāya saccavāditāya lokaṃ na visaṃvādetīti attho.
Not deceptive to the world means he does not deceive the world because of that truthfulness.
Không lừa dối thế gian có nghĩa là, do sự nói lời chân thật ấy, người đó không lừa dối thế gian.
Bhinnānaṃ vā sandhātāti dvinnaṃ mittānaṃ vā samānupajjhāyakādīnaṃ vā kenacideva kāraṇena bhinnānaṃ ekamekaṃ upasaṅkamitvā ‘‘tumhākaṃ īdise kule jātānaṃ evaṃ bahussutānaṃ idaṃ na yutta’’ntiādīni vatvā sandhānaṃ kattā anukattā.
Or a reconciler of those who are divided: One who, by approaching each of two friends or those with the same preceptor who have been divided by some cause and saying things like, "This is not proper for you who are born in such a family and are so learned," becomes a creator and facilitator of reconciliation.
Hoặc là người hòa giải những người đã chia rẽ có nghĩa là người đi đến từng người trong hai người bạn hoặc những người cùng thầy, v.v., đã chia rẽ vì một lý do nào đó, và nói những lời như "điều này không phù hợp với những người sinh ra trong gia đình như các bạn, những người có nhiều học vấn như vậy", rồi làm cho họ hòa giải, là người khuyến khích hòa giải.
Anuppadātāti sandhānānuppadātā.
A promoter: a promoter of reconciliation.
Anuppadātā có nghĩa là người khuyến khích hòa giải.
Dve jane samagge disvā – ‘‘tumhākaṃ evarūpe kule jātānaṃ evarūpehi guṇehi samannāgatānaṃ anucchavikameta’’ntiādīni vatvā daḷhīkammaṃ kattāti attho.
The meaning is that, upon seeing two people in harmony, one strengthens their bond by saying such things as, "This is fitting for you, who are born in such a family and endowed with such virtues."
Nghĩa là, khi thấy hai người hòa hợp, người ấy nói những lời như "điều này phù hợp với các bạn, những người sinh ra trong gia đình như vậy, có những đức tính như vậy", và làm cho sự hòa hợp đó vững chắc.
Samaggo ārāmo assāti samaggārāmo. Yattha samaggā natthi, tattha vasitumpi na icchatīti attho.
One who delights in harmony is samaggārāmo. The meaning is that where there are no harmonious people, he does not wish even to dwell.
Samaggārāmo có nghĩa là nơi trú ngụ của sự hòa hợp. Nghĩa là, nơi nào không có sự hòa hợp, người ấy cũng không muốn ở.
Samaggarāmotipi pāḷi, ayamevettha attho.
The reading is also samaggarāmo; this is the very same meaning here.
Pāḷi cũng có Samaggarāmo, nghĩa ở đây cũng vậy.
Samaggaratoti samaggesu rato, te pahāya aññattha gantumpi na icchatīti attho.
Delighting in harmony means he delights in those who are harmonious; he does not wish to leave them and go elsewhere.
Samaggarato có nghĩa là hoan hỷ với những người hòa hợp, nghĩa là người ấy không muốn rời bỏ họ để đi nơi khác.
Samagge disvāpi sutvāpi nandatīti samagganandī, samaggakaraṇiṃ vācaṃ bhāsitāti yā vācā satte samaggeyeva karoti, taṃ sāmaggiguṇaparidīpikameva vācaṃ bhāsati, na itaranti.
He rejoices upon seeing or hearing of the harmonious, thus he is samagganandī; one who speaks words that create harmony means he speaks only that speech which makes beings harmonious, which illuminates the quality of concord, and no other.
Samagganandī có nghĩa là hoan hỷ khi thấy hoặc nghe về những người hòa hợp, nói lời làm cho hòa hợp có nghĩa là người ấy nói lời chỉ làm cho chúng sinh hòa hợp, lời chỉ làm nổi bật đức tính hòa hợp, chứ không nói lời khác.
Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusacetanā pharusāvācā.
The completely harsh volition (cetanā) that originates bodily and verbal effort that cuts to the quick of another is harsh speech.
Lời nói thô ác (pharusāvācā) là ý chí thô ác tuyệt đối, phát sinh từ hành động thân và khẩu gây tổn thương sâu sắc cho người khác.
Tassā āvibhāvatthamidaṃ vatthu – eko kira dārako mātuvacanaṃ anādiyitvā araññaṃ gacchati, taṃ mātā nivattetumasakkontī – ‘‘caṇḍā taṃ mahiṃsī anubandhatū’’ti akkosi.
To illustrate this, there is this story: A certain boy, not heeding his mother's word, goes to the forest. His mother, unable to make him return, cursed him, saying, "May a fierce buffalo chase you."
Để làm rõ điều này, có một câu chuyện: Một cậu bé nọ không vâng lời mẹ mà đi vào rừng. Người mẹ không thể ngăn cản được cậu, bèn nguyền rủa: "Mong cho con bị một con trâu cái hung dữ đuổi theo!"
Athassa tatheva araññe mahiṃsī uṭṭhāsi.
Then, just so, a buffalo rose up against him in the forest.
Thế rồi, một con trâu cái xuất hiện trong rừng đúng như lời mẹ cậu đã nguyền rủa.
Dārako ‘‘yaṃ mama mātā mukhena kathesi, taṃ mā hotu, yaṃ cittena cintesi taṃ hotū’’ti, saccakiriyamakāsi.
The boy made an act of truth, saying, "What my mother spoke with her mouth, let that not be; what she thought with her mind, let that be."
Cậu bé lập lời chân thật rằng: "Mong cho lời mẹ con nói bằng miệng đừng thành hiện thực, mong cho ý mẹ con nghĩ trong lòng được thành hiện thực!"
Mahiṃsī tattheva baddhā viya aṭṭhāsi.
The buffalo stood right there as if bound.
Con trâu cái liền đứng yên như bị trói.
Evaṃ mammacchedakopi payogo cittasaṇhatāya na pharusā vācā hoti.
Thus, even an effort that cuts to the quick is not harsh speech if the mind is gentle.
Như vậy, ngay cả một hành động gây tổn thương sâu sắc cũng không phải là lời nói thô ác nếu tâm ý dịu dàng.
Mātāpitaro hi kadāci puttake evaṃ vadanti – ‘‘corā vo khaṇḍākhaṇḍaṃ karontū’’ti, uppalapattampi ca nesaṃ upari patantaṃ na icchanti.
Indeed, parents sometimes say to their children, "May thieves cut you to pieces," but they do not wish even a lotus petal to fall upon them.
Cha mẹ đôi khi nói với con cái rằng: "Mong cho bọn cướp chặt các con thành từng mảnh!", nhưng họ không muốn ngay cả một chiếc lá sen rơi trên người con.
Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti – ‘‘kiṃ ime ahirīkā anottappino caranti, niddhamatha ne’’ti, atha ca nesaṃ āgamādhigamasampattiṃ icchanti.
And teachers and preceptors sometimes say this to their dependents: "Why do these shameless and reckless ones wander about? Expel them!" yet they desire their accomplishment in learning and realization.
Các vị thầy và thầy tế lễ đôi khi nói với các đệ tử của mình: "Tại sao những người vô liêm sỉ, không hổ thẹn này lại đi lang thang? Hãy đuổi chúng đi!", nhưng họ lại mong muốn sự thành tựu về học vấn và chứng đắc cho các đệ tử.
Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācā na hoti.
And just as it is not harsh speech due to the gentleness of the mind, so it is not non-harsh speech due to the gentleness of the words.
Cũng như lời nói thô ác không phải là thô ác do tâm ý dịu dàng, thì lời nói không thô ác cũng không phải là không thô ác do lời nói dịu dàng.
Na hi mārāpetukāmassa – ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusā vācā hoti, cittapharusatāya panesā pharusā vācāva.
Indeed, for one who wishes to have someone killed, the words, "Let this person sleep comfortably," do not constitute non-harsh speech; rather, because of the harshness of the mind, this is harsh speech indeed.
Lời nói của người muốn giết người khác rằng "Hãy cho người này ngủ yên vui" không phải là lời nói không thô ác; do tâm ý thô ác, đó vẫn là lời nói thô ác.
Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It is of little fault if the person toward whom it is directed is of little virtue, and of great fault if he is of great virtue.
Lời nói ấy được phát ra nhằm vào ai, thì nếu người đó có ít đức hạnh thì tội lỗi ít, nếu có nhiều đức hạnh thì tội lỗi lớn.
Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.
Its three components are: another person to be reviled, an angry mind, and the reviling.
Có ba yếu tố cấu thành của lời nói thô ác: người bị mắng chửi (paro akkositabbo); tâm sân hận (kupitacittaṃ); và hành động mắng chửi (akkosanā).
Nelāti elaṃ vuccati doso, nāssā elanti nelā, niddosāti attho.
Faultless (nelā): Ela is said to be a fault; for this speech, there is no ela, thus it is nelā, meaning faultless.
Nelā có nghĩa là không có lỗi (niddosā), vì "ela" có nghĩa là lỗi, và "nāssā elaṃ" có nghĩa là không có lỗi.
‘‘Nelaṅgo setapacchādo’’ti, (udā. 65) ettha vuttanelaṃ viya.
It is like the word nela spoken in the passage, "nelaṅgo setapacchādo".
Giống như "nela" được nói đến trong câu "Nelaṅgo setapacchādo".
Kaṇṇasukhāti byañjanamadhuratāya kaṇṇānaṃ sukhā, sūcivijjhanaṃ viya kaṇṇasūlaṃ na janeti.
Pleasing to the ear: It is pleasant to the ears due to the sweetness of its phrasing; it does not cause ear-pain like the piercing of a needle.
Kaṇṇasukhā có nghĩa là êm tai do sự ngọt ngào của âm điệu, không gây đau tai như kim châm.
Atthamadhuratāya sakalasarīre kopaṃ ajanetvā pemaṃ janetīti pemanīyā. Hadayaṃ gacchati, appaṭihaññamānā sukhena cittaṃ pavisatīti hadayaṅgamā. Guṇaparipuṇṇatāya pure bhavāti porī pure saṃvaḍḍhanārī viya sukumārātipi porī. Purassa esātipi porī. Nagaravāsīnaṃ kathāti attho.
Because of the sweetness of its meaning, it generates affection throughout the entire body instead of generating anger, thus it is endearing (pemanīyā). It goes to the heart, it enters the mind easily without being obstructed, thus it is heart-touching (hadayaṅgamā). Because of being complete in virtues, it is excellent in the city, thus it is urbane (porī); like a well-bred woman in the city, it is very refined, thus it is urbane (porī). It is of the city, thus it is urbane (porī). The meaning is, it is the speech of city-dwellers.
Pemanīyā có nghĩa là dễ thương, vì sự ngọt ngào của ý nghĩa, nó không gây ra sự giận dữ mà tạo ra tình yêu thương trong toàn bộ cơ thể. Hadayaṅgamā có nghĩa là đi vào lòng, vì nó dễ dàng đi vào tâm mà không bị cản trở. Porī có nghĩa là cổ xưa (pure bhavā) do sự đầy đủ của các đức tính; hoặc porī cũng có nghĩa là mềm mại như một người phụ nữ được nuôi dưỡng trong thành phố; hoặc porī cũng có nghĩa là của thành phố (purassa esā), tức là lời nói của những người sống trong thành phố.
Nagaravāsino hi yuttakathā honti.
City-dwellers indeed have proper speech.
Thật vậy, những người sống trong thành phố thường có lời nói hợp lý.
Pitimattaṃ pitāti vadanti, bhātimattaṃ bhātāti vadanti, mātimattaṃ mātāti vadanti.
They call someone the age of a father, "father"; someone the age of a brother, "brother"; someone the age of a mother, "mother."
Họ gọi người ngang hàng với cha là cha, người ngang hàng với anh là anh, người ngang hàng với mẹ là mẹ.
Evarūpī kathā bahuno janassa kantā hotīti bahujanakantā. Kantabhāveneva bahuno janassa manāpā cittavuḍḍhikarāti bahujanamanāpā.
Speech of this kind is dear to many people, thus it is dear to many people (bahujanakantā). By its very dearness, it is pleasing to many people and brings growth to the mind, thus it is pleasing to many people (bahujanamanāpā).
Lời nói như vậy được nhiều người yêu thích (kantā), nên được gọi là bahujanakantā. Do được yêu thích, nó làm cho nhiều người hài lòng, làm tăng trưởng tâm ý (cittavuḍḍhikarā), nên được gọi là bahujanamanāpā.
Nidhānaṃ vuccati ṭhapanokāso, nidhānamassā atthīti nidhānavatī. Hadaye nidhātabbayuttakaṃ vācaṃ bhāsitāti attho.
A treasure means a place for storing; her speech has a treasure, thus it is containing a treasure (nidhānavatī). The meaning is that he speaks words that are worthy of being treasured in the heart.
Nidhāna có nghĩa là nơi cất giữ; nidhānavatī có nghĩa là có nơi cất giữ. Nghĩa là, người nói lời đáng được cất giữ trong lòng.
Kālenāti evarūpiṃ bhāsamānopi ca – ‘‘ahaṃ nidhānavatiṃ vācaṃ bhāsissāmī’’ti na akālena bhāsati, yuttakālaṃ pana apekkhitvāva bhāsatīti attho.
At the right time: And even when speaking such speech, he does not speak at an improper time thinking, "I will speak words containing a treasure," but rather he speaks only after considering the proper time. This is the meaning.
Kālenā có nghĩa là ngay cả khi nói những lời như vậy, người ấy không nói "Tôi sẽ nói lời đáng cất giữ" một cách không đúng lúc, mà chỉ nói khi đã cân nhắc thời điểm thích hợp.
Sāpadesanti saupamaṃ, sakāraṇanti attho.
With a reason (sāpadesa): with a simile, with a cause. This is the meaning.
Sāpadesaṃ có nghĩa là có ví dụ, có lý do.
Pariyantavatinti paricchedaṃ dassetvā yathāssā paricchedo paññāyati, evaṃ bhāsatīti attho.
With a limit (pariyantavati): By showing the limit, he speaks in such a way that its boundary is understood. This is the meaning.
Pariyantavatiṃ có nghĩa là nói lời có giới hạn, để giới hạn của lời nói được hiểu rõ.
Atthasaṃhitanti anekehipi nayehi vibhajantena pariyādātuṃ asakkuṇeyyatāya atthasampannaṃ bhāsati.
Connected with the goal (atthasaṃhita): He speaks what is endowed with meaning, which cannot be fully grasped even by analyzing it in many ways.
Atthasaṃhitaṃ có nghĩa là nói lời đầy đủ ý nghĩa, đến mức không thể phân tích hết bằng nhiều cách.
Yaṃ vā so atthavādī atthaṃ vadati, tena atthena sahitattā atthasaṃhitaṃ vācaṃ bhāsati, na aññaṃ nikkhipitvā aññaṃ bhāsatīti vuttaṃ hoti.
Or, it means that whatever benefit that speaker on benefits speaks of, he speaks speech connected with that benefit because it is accompanied by that benefit; he does not set aside one thing and speak of another.
Hoặc, điều lợi ích mà vị thuyết pháp về lợi ích ấy nói ra, vì lời nói ấy phù hợp với điều lợi ích đó, nên Ngài nói lời có liên hệ đến lợi ích, không phải bỏ điều này mà nói điều khác, là ý đã được nói đến.
Mālādīsu mālāti yaṃ kiñci pupphaṃ.
Among garlands and so on, garland means any kind of flower.
Trong các loại trang sức như vòng hoa, v.v., mālā (vòng hoa) là bất cứ loại hoa nào.
Gandhanti yaṃ kiñci gandhajātaṃ.
Scent means any kind of fragrant substance.
Gandha (hương) là bất cứ loại hương liệu nào.
Vilepananti chavirāgakaraṇaṃ.
Ointment means that which beautifies the complexion.
Vilepana (xoa thoa) là việc làm cho da có màu sắc.
Tattha piḷandhanto dhāreti nāma, ūnaṭṭhānaṃ pūrento maṇḍeti nāma, gandhavasena chavirāgavasena ca sādiyanto vibhūseti nāma.
In this context, one who wears them is said to ‘bear’ them; one who fills a deficient spot is said to ‘adorn’ them; one who delights in them through scent and beautifying the complexion is said to ‘embellish’ them.
Trong đó, người đeo trang sức được gọi là dhāreti (đeo), người lấp đầy chỗ trống được gọi là maṇḍeti (trang điểm), và người thích thú với hương thơm và màu sắc của da được gọi là vibhūseti (làm đẹp).
Ṭhānaṃ vuccati kāraṇaṃ.
Occasion is said to mean the cause.
Ṭhānaṃ được gọi là nguyên nhân.
Tasmā yāya dussīlyacetanāya tāni mālādhāraṇādīni mahājano karoti, tato paṭiviratoti attho.
Therefore, the meaning is that he refrains from that immoral volition with which the populace engages in wearing garlands and so on.
Vì vậy, ý nghĩa là vị ấy từ bỏ những hành vi đeo vòng hoa, v.v., mà đại chúng thường làm với tâm ý bất thiện.
Āmakadhaññapaṭiggahaṇāti, sālivīhiyavagodhūmakaṅguvarakakudrūsakasaṅkhātassa sattavidhassāpi āmakadhaññassa paṭiggahaṇā.
From accepting uncooked grain means from accepting the seven kinds of uncooked grain, identified as sāli rice, vīhi rice, barley, wheat, millet, varaka, and kudrūsaka.
Āmakadhaññapaṭiggahaṇā là từ bỏ việc nhận các loại ngũ cốc thô chưa được chế biến, gồm bảy loại: lúa (sāli), lúa mạch (vīhi), yava (lúa mì/đại mạch), godhūma (lúa mì), kaṅgu (kê), varaka (hạt kê nhỏ), kudrūsaka (lúa mì dại).
Na kevalañca etesaṃ paṭiggahaṇameva, āmasanampi bhikkhūnaṃ na vaṭṭatiyeva.
And not only is the acceptance of these not allowed for monks, but even touching them is not allowed.
Không chỉ việc nhận những thứ này, mà ngay cả việc chạm vào chúng cũng không thích hợp cho các tỳ-khưu.
Āmakamaṃsapaṭiggahaṇāti ettha aññatra odissa anuññātā āmakamaṃsamacchānaṃ paṭiggahaṇameva bhikkhūnaṃ na vaṭṭati, no āmasanaṃ.
Regarding from accepting uncooked meat, except for what is specifically allowed, the acceptance of uncooked meat and fish is not allowed for monks, but touching them is.
Āmakamaṃsapaṭiggahaṇā: Trong trường hợp này, ngoại trừ những trường hợp được phép đặc biệt, việc nhận thịt và cá sống là không thích hợp cho các tỳ-khưu, nhưng việc chạm vào thì không sao.
Ajeḷakādīsu khettavatthupariyosānesu kappiyākappiyanayo vinayavasena upaparikkhitabbo.
Regarding goats and sheep up to fields and lands, the rule of what is proper and improper should be examined according to the Vinaya.
Đối với các loại động vật như dê, cừu, v.v., cho đến ruộng đất, cần phải xem xét quy tắc thích hợp và không thích hợp theo Vinaya.
Tattha khettaṃ nāma yasmiṃ pubbaṇṇaṃ ruhati.
Therein, a field is where early-ripening grain grows.
Trong đó, khettaṃ là nơi trồng các loại ngũ cốc chính (lúa).
Vatthu nāma yasmiṃ aparaṇṇaṃ ruhati.
A plot of land is where late-ripening grain grows.
Vatthu là nơi trồng các loại đậu (aparaṇṇa).
Yattha vā ubhayampi ruhati, taṃ khettaṃ.
Or, where both grow, that is a field.
Hoặc nơi cả hai đều có thể trồng, đó là khetta.
Tadatthāya akatabhūmibhāgo vatthu. Khettavatthusīsena cettha vāpitaḷākādīnipi saṅgahitāneva.
An unprepared piece of ground for that purpose is a plot of land. And here, under the heading of fields and plots of land, reservoirs, tanks, and so on are also included.
Phần đất chưa được chuẩn bị cho mục đích đó là vatthu. Ở đây, dưới tiêu đề khetta và vatthu, các loại ao hồ, kênh mương, v.v., cũng được bao gồm.
Kayavikkayāti kayā ca vikkayā ca.
From buying and selling means from buying and from selling.
Kayavikkayā là mua và bán.
Tulākūṭādīsu kūṭanti vañcanaṃ.
Among false weights and so on, false means deception.
Trong các loại cân gian lận, v.v., kūṭaṃ là sự lừa dối.
Tattha tulākūṭaṃ nāma rūpakūṭaṃ aṅgakūṭaṃ, gahaṇakūṭaṃ, paṭicchannakūṭanti catubbidhaṃ hoti.
Therein, false scales are of four kinds: deception by appearance, deception by limb, deception by handling, and hidden deception.
Trong đó, cân gian lận (tulākūṭaṃ) có bốn loại: rūpakūṭaṃ (gian lận hình thức), aṅgakūṭaṃ (gian lận bằng tay), gahaṇakūṭaṃ (gian lận cách cầm), paṭicchannakūṭaṃ (gian lận che giấu).
Tattha rūpakūṭaṃ nāma dve tulā samarūpā katvā gaṇhanto mahatiyā gaṇhāti, dadanto khuddikāya deti.
Therein, deception by appearance is when, having made two scales of the same appearance, one takes with the larger one and gives with the smaller one.
Trong đó, rūpakūṭaṃ là làm hai cái cân có hình dạng giống nhau, khi nhận thì dùng cái cân lớn, khi cho thì dùng cái cân nhỏ.
Aṅgakūṭaṃ nāma gaṇhanto pacchābhāge hatthena tulaṃ akkamati, dadanto pubbabhāge.
Deception by limb is when taking, one presses down on the back part of the scale with the hand, and when giving, on the front part.
Aṅgakūṭaṃ là khi nhận thì dùng tay đè lên phần sau của cân, khi cho thì đè lên phần trước.
Gahaṇakūṭaṃ nāma gaṇhanto mūle rajjuṃ gaṇhāti, dadanto agge.
Deception by handling is when taking, one holds the string at the base, and when giving, at the tip.
Gahaṇakūṭaṃ là khi nhận thì cầm dây ở gốc, khi cho thì cầm ở ngọn.
Paṭicchannakūṭaṃ nāma tulaṃ susiraṃ katvā anto ayacuṇṇaṃ pakkhipitvā gaṇhanto taṃ pacchābhāge karoti, dadanto aggabhāge.
Hidden deception is when, having made the scale hollow, one puts iron powder inside; when taking, one puts it in the back part, and when giving, in the front part.
Paṭicchannakūṭaṃ là làm cho cân rỗng ruột, bỏ bột sắt vào trong, khi nhận thì để phần có bột sắt ở phía sau, khi cho thì để ở phía trước.
Kaṃso vuccati suvaṇṇapāti, tāya vañcanaṃ kaṃsakūṭaṃ. Kathaṃ?
A kaṃsa is said to be a golden bowl; deception with it is deception with a kaṃsa. How?
Kaṃso được gọi là chén vàng, sự lừa dối bằng chén đó là kaṃsakūṭaṃ (gian lận bằng chén). Như thế nào?
Ekaṃ suvaṇṇapātiṃ katvā aññā dve tisso lohapātiyo suvaṇṇavaṇṇe karoti, tato janapadaṃ gantvā kiñcideva aḍḍhaṃ kulaṃ pavisitvā – ‘‘suvaṇṇabhājanāni kiṇathā’’ti vatvā agghe pucchite samagghataraṃ dātukāmā honti.
Having made one golden bowl, one makes two or three other copper bowls of a golden color. Then, going to the countryside and entering a certain wealthy household, one says, "Will you buy golden vessels?" When asked the price, they are willing to give it for a very reasonable price.
Làm một chén vàng, rồi làm hai ba chén đồng khác có màu vàng giống như vàng, sau đó đi đến một vùng quê, vào một gia đình giàu có nào đó và nói: "Ông bà có muốn mua chén vàng không?", khi được hỏi về giá, họ muốn bán với giá rẻ hơn.
Tato tehi – ‘‘kathaṃ imesaṃ suvaṇṇabhāvo jānitabbo’’ti vutte, ‘‘vīmaṃsitvā gaṇhathā’’ti suvaṇṇapātiṃ pāsāṇe ghaṃsitvā sabbā pātiyo datvā gacchati.
Then, when they say, "How can we know that these are gold?" one replies, "Examine them and take them." Having rubbed the golden bowl on a touchstone, one gives them all the bowls and leaves.
Sau đó, khi những người đó hỏi: "Làm sao để biết đây là vàng thật?", người bán nói: "Hãy kiểm tra rồi lấy", rồi mài chén vàng thật lên đá thử vàng, sau đó đưa tất cả các chén (vàng và đồng) rồi bỏ đi.
Mānakūṭaṃ nāma hadayabhedasikhābhedarajjubhedavasena tividhaṃ hoti.
Deception with measures is of three kinds: by way of heart-breaking, peak-breaking, and rope-breaking.
Mānakūṭaṃ (gian lận bằng đo lường) có ba loại: hadayabheda (gian lận bên trong), sikhābheda (gian lận trên ngọn), rajjubheda (gian lận bằng dây).
Tattha hadayabhedo sappitelādiminanakāle labbhati.
Therein, heart-breaking occurs when measuring ghee, oil, and so on.
Trong đó, hadayabhedo được dùng khi đong dầu bơ, dầu, v.v.
Tāni hi gaṇhanto heṭṭhāchiddena mānena – ‘‘saṇikaṃ āsiñcā’’ti vatvā antobhājane bahuṃ paggharāpetvā gaṇhāti, dadanto chiddaṃ pidhāya sīghaṃ pūretvā deti.
When taking these, using a measure with a hole at the bottom, one says, "Pour it in slowly," and lets a large amount flow into a container underneath while taking it. When giving, one closes the hole, fills it up quickly, and gives it.
Khi nhận những thứ đó, người gian lận dùng cái đo có lỗ ở đáy, nói: "Hãy đổ từ từ", rồi để chảy nhiều vào trong vật chứa rồi nhận; khi cho thì bịt lỗ lại, đổ đầy nhanh chóng rồi đưa đi.
Ukkoṭanādīsu ukkoṭananti assāmike sāmike kātuṃ lañjaggahaṇaṃ.
Among bribery and so on, bribery is taking a bribe to make a non-owner the owner.
Trong các loại gian lận như ukkoṭana, v.v., ukkoṭana là nhận hối lộ để biến tài sản vô chủ thành có chủ.
Vañcananti tehi tehi upāyehi paresaṃ vañcanaṃ.
Deception is the deceiving of others by various means.
Vañcana là lừa dối người khác bằng nhiều thủ đoạn khác nhau.
Tatridamekaṃ vatthu – eko kira luddako migañca migapotakañca gahetvā āgacchati, tameko dhutto – ‘‘kiṃ bho, migo agghati, kiṃ migapotako’’ti āha.
Here is one story on this: A certain hunter was coming along, having caught a deer and a fawn. A rogue said to him, "Hey, what is the price of the deer, and what is the price of the fawn?"
Đây là một câu chuyện về một trường hợp: Có một người thợ săn bắt được một con nai và một con nai con, rồi mang về. Một tên lừa đảo hỏi: "Này anh, con nai này giá bao nhiêu, con nai con giá bao nhiêu?".
‘‘Migo dve kahāpaṇe, migapotako eka’’nti ca vutte ekaṃ kahāpaṇaṃ datvā migapotakaṃ gahetvā thokaṃ gantvā nivatto – ‘‘na me bho, migapotakena attho, migaṃ me dehī’’ti āha.
When it was said, “The deer is two kahāpaṇas, the fawn is one,” he gave one kahāpaṇa, took the fawn, and after going a short distance, returned and said, “Sir, I have no use for the fawn. Give me the deer.”
Khi được nói rằng ‘con hươu giá hai đồng kahāpaṇa, hươu con giá một đồng’, người ấy đã đưa một đồng kahāpaṇa, bắt hươu con, đi một đoạn ngắn rồi quay lại nói: ‘Này bạn, tôi không cần hươu con, hãy đưa con hươu lớn cho tôi’.
Tena hi – dve kahāpaṇe dehīti.
“In that case, give me two kahāpaṇas.”
Vậy thì, hãy đưa hai đồng kahāpaṇa.
So āha – ‘‘nanu te bho, mayā paṭhamaṃ eko kahāpaṇo dinno’’ti?
He said, “Sir, did I not already give you one kahāpaṇa before?”
Người ấy nói: ‘Này bạn, chẳng phải tôi đã đưa cho bạn một đồng kahāpaṇa trước rồi sao?’
‘‘Āma, dinno’’ti.
“Yes, you did.”
‘Vâng, đã đưa rồi’.
‘‘Idaṃ migapotakaṃ gaṇha, evaṃ so ca kahāpaṇo, ayañca kahāpaṇagghanako migapotakoti dve kahāpaṇā bhavissantī’’ti.
“Then take this fawn. In this way, that kahāpaṇa and this fawn, which is worth one kahāpaṇa, will make two kahāpaṇas.”
‘Hãy bắt hươu con này, như vậy đồng kahāpaṇa đó và hươu con giá trị một đồng kahāpaṇa này sẽ thành hai đồng kahāpaṇa’.
So ‘‘kāraṇaṃ vadatī’’ti sallakkhetvā migapotakaṃ gahetvā migaṃ adāsīti.
Thinking, “He speaks reasonably,” the hunter took the fawn and gave him the deer.
Người ấy nhận thấy ‘người này nói có lý’ và sau khi bắt hươu con, đã đưa con hươu lớn.
Nikatīti yogavasena vā māyāvasena vā apāmaṅgaṃ pāmaṅganti, amaṇiṃ maṇinti, asuvaṇṇaṃ suvaṇṇanti katvā patirūpakena vañcanaṃ.
Nikatī is deception with a counterfeit item, by means of spells or illusion, making what is not a sacred thread appear to be a sacred thread, what is not a gem appear to be a gem, and what is not gold appear to be gold.
Nikatī (lừa dối) là sự lừa gạt bằng cách giả mạo, hoặc bằng cách sử dụng các phương pháp ma thuật hoặc ảo thuật, biến cái không phải dây đeo vai thành dây đeo vai, cái không phải ngọc thành ngọc, cái không phải vàng thành vàng.
Sāciyogoti kuṭilayogo, etesaṃyeva ukkoṭanādīnametaṃ nāmaṃ.
Sāciyoga is crooked practice; it is a name for these very things, such as bribery and so on.
Sāciyogo (hành vi gian xảo) là hành vi gian xảo, đây là tên gọi của những hành vi như hối lộ, lừa gạt, v.v.
Tasmā – ukkoṭanasāciyogo, vañcanasāciyogo, nikatisāciyogoti, evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as: the crooked practice of bribery, the crooked practice of deception, and the crooked practice of fraud.
Do đó, ở đây cần hiểu ý nghĩa là: hối lộ gian xảo, lừa gạt gian xảo, lừa dối gian xảo.
Keci aññaṃ dassetvā aññassa parivattanaṃ sāciyogoti vadanti.
Some say that sāciyoga is exchanging one thing for another after having shown something different.
Một số người nói rằng sāciyogo là việc đổi một vật khác sau khi đã cho xem một vật khác.
Taṃ pana vañcaneneva saṅgahitaṃ.
But that is included under deception.
Tuy nhiên, điều đó đã được bao gồm trong sự lừa gạt.
Chedanādīsu chedananti hatthacchedanādi.
In the section on cutting and so on, chedana refers to the cutting off of hands and the like.
Trong các hành vi cắt xẻ, v.v., chedana (cắt xẻ) là cắt tay, v.v.
Vadhoti māraṇaṃ.
Vadha is killing.
Vadho (sát hại) là giết chết.
Bandhoti rajjubandhanādīhi bandhanaṃ.
Bandha is binding with ropes and other such bonds.
Bandho (trói buộc) là trói buộc bằng dây thừng, v.v.
Viparāmosoti himaviparāmoso, gumbaviparāmosoti duvidho.
Viparāmoso is of two kinds: highway robbery in the mist and highway robbery from a thicket.
Viparāmoso (cướp đoạt) có hai loại: cướp đoạt do tuyết và cướp đoạt do bụi cây.
Yaṃ himapātasamaye himena paṭicchannā hutvā maggappaṭipannaṃ janaṃ musanti, ayaṃ himaviparāmoso.
When, during the season of falling mist, robbers conceal themselves in the mist and plunder people traveling on the road, this is highway robbery in the mist.
Khi tuyết rơi, những kẻ ẩn mình trong tuyết cướp bóc những người đi đường, đó là cướp đoạt do tuyết.
Yaṃ gumbādīhi paṭicchannā musanti, ayaṃ gumbaviparāmoso.
When they conceal themselves in thickets and the like to plunder, this is highway robbery from a thicket.
Những kẻ ẩn mình trong bụi cây, v.v., cướp bóc, đó là cướp đoạt do bụi cây.
Ālopo vuccati gāmanigamādīnaṃ vilopakaraṇaṃ.
Ālopo is the plundering of villages, towns, and the like.
Ālopo (cướp phá) được gọi là việc cướp phá làng mạc, thị trấn, v.v.
Sahasākāroti sāhasikakiriyā.
Sahasākāro is a violent act.
Sahasākāro (hành vi bạo lực) là hành vi bạo lực.
Gehaṃ pavisitvā manussānaṃ ure satthaṃ ṭhapetvā icchitabhaṇḍānaṃ gahaṇaṃ.
It is entering a house, placing a weapon on the chests of the occupants, and taking whatever goods one desires.
Vào nhà, đặt dao vào ngực người rồi lấy đi những tài sản mong muốn.
Evametasmā chedana…pe… sahasākārā paṭivirato samaṇo gotamoti.
Thus, the recluse Gotama abstains from this cutting... and so on... up to violent acts.
Như vậy, Sa-môn Gotama đã từ bỏ việc cắt xẻ... và hành vi bạo lực.
Iti vā hi, bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyyāti.
In this way, bhikkhus, should an ordinary person speak when speaking in praise of the Tathāgata.
Này các Tỳ-khưu, phàm phu khi tán thán Đức Như Lai có thể tán thán như vậy.
11. Idāni majjhimasīlaṃ vitthārento ‘‘yathā vā paneke bhonto’’tiādimāha.
11. Now, to expound upon the Middle Section on Virtue, he began with, “Or just as some good...” and so on.
Giờ đây, để giải thích Trung Giới, Đức Phật đã nói câu ‘‘yathā vā paneke bhonto’’ và những câu tiếp theo.
Tatrāyaṃ anuttānapadavaṇṇanā.
Herein is the explanation of the non-obvious terms.
Đây là phần giải thích các từ ngữ không rõ ràng trong đó.
Saddhādeyyānīti kammañca phalañca idhalokañca paralokañca saddahitvā dinnāni.
Saddhādeyyāni means things given with faith in kamma and its fruit, in this world and the next world.
Saddhādeyyānī (vật cúng dường do lòng tin) là những vật được cúng dường do tin vào nghiệp và quả của nghiệp, tin vào đời này và đời sau.
‘Ayaṃ me ñātī’ti vā, ‘mitto’ti vā, idaṃ paṭikarissati, idaṃ vā tena katapubbanti vā, evaṃ na dinnānīti attho.
The meaning is that they are not given with such thoughts as, ‘This is my relative,’ or ‘my friend,’ or ‘he will repay this,’ or ‘this was done by him before.’
Ý nghĩa là không phải những vật được cúng dường với ý nghĩ ‘người này là bà con của tôi’ hoặc ‘bạn bè của tôi’, ‘người này sẽ đền đáp lại điều này’, hoặc ‘người này đã làm điều đó trước đây’.
Evaṃ dinnāni hi na saddhādeyyāni nāma honti.
Indeed, things given in such a way are not called saddhādeyyāni.
Thật vậy, những vật được cúng dường như vậy không được gọi là saddhādeyya.
Bhojanānīti desanāsīsamattametaṃ, atthato pana saddhādeyyāni bhojanāni bhuñjitvā cīvarāni pārupitvā senāsanāni sevamānā gilānabhesajjaṃ paribhuñjamānāti sabbametaṃ vuttameva hoti.
Bhojanāni is merely the heading of the discourse. In terms of meaning, however, it is to be understood that all of the following is stated: having eaten food given in faith, having worn robes, while using lodgings, and while consuming medicine for the sick.
Bhojanānī (các món ăn) ở đây chỉ là tiêu đề của bài giảng; nhưng về ý nghĩa, tất cả những điều này đều được nói đến: thọ dụng các món ăn do lòng tin cúng dường, đắp y, sử dụng các chỗ ở, và thọ dụng thuốc men khi bệnh.
Seyyathidanti nipāto.
Seyyathidaṃ is a particle.
Seyyathidaṃ là một giới từ.
Tassattho katamo so bījagāmabhūtagāmo, yassa samārambhaṃ anuyuttā viharantīti.
Its meaning is: What are that bījagāma and bhūtagāma, the destruction of which they are engaged in?
Ý nghĩa của nó là: loại cây giống và thực vật nào mà họ đang bận rộn phá hoại?
Tato taṃ dassento mūlabījantiādimāha.
Then, to show this, he said, “Mūlabīja,” and so on.
Để chỉ ra điều đó, Đức Phật đã nói câu mūlabījaṃ (hạt giống gốc) và những câu tiếp theo.
Tattha mūlabījaṃ nāma haliddi, siṅgiveraṃ, vacā, vacattaṃ, ativisā, kaṭukarohiṇī, usīraṃ, bhaddamuttakanti evamādi.
Therein, mūlabījaṃ refers to turmeric, ginger, sweet flag, vacattaṃ, ativisā, kaṭukarohiṇī, vetiver grass, bhaddamuttaka, and so on.
Trong đó, mūlabījaṃ là nghệ, gừng, xương bồ, vacatta, ativisā, kaṭukarohiṇī, cỏ hương bài, bhaddamuttaka, v.v.
Khandhabījaṃ nāma assattho, nigrodho, pilakkho, udumbaro, kacchako, kapitthanoti evamādi.
Khandhabījaṃ refers to the sacred fig tree, the banyan tree, the waved-leaf fig tree, the cluster fig tree, kacchaka, kapitthano, and so on.
Khandhabījaṃ là cây bồ đề, cây đa, cây pilakkha, cây sung, cây kacchaka, cây mộc qua, v.v.
Phaḷubījaṃ nāma ucchu, naḷo, veḷūti evamādi.
Phaḷubījaṃ refers to sugarcane, reed, bamboo, and so on.
Phaḷubījaṃ là cây mía, cây sậy, cây tre, v.v.
Aggabījaṃ nāma ajjakaṃ, phaṇijjakaṃ, hiriveranti evamādi.
Aggabījaṃ refers to basil, phaṇijjakaṃ, hirivera, and so on.
Aggabījaṃ là húng quế, húng tây, hirivera, v.v.
Bījabījaṃ nāma pubbaṇṇaṃ aparaṇṇanti evamādi.
Bījabījaṃ refers to early grain, late grain, and so on.
Bījabījaṃ là ngũ cốc mùa sớm, ngũ cốc mùa muộn, v.v.
Sabbañhetaṃ rukkhato viyojitaṃ viruhanasamatthameva ‘‘bījagāmo’’ti vuccati.
All of these, when separated from the plant but still capable of sprouting, are called bījagāma.
Tất cả những thứ này, khi được tách ra khỏi cây và có khả năng nảy mầm, được gọi là ‘‘bījagāmo’’ (cây giống).
Rukkhato pana aviyojitaṃ asukkhaṃ ‘‘bhūtagāmo’’ti vuccati.
However, that which is not separated from the plant and is not dried out is called bhūtagāma.
Còn cái chưa tách ra khỏi cây và chưa khô thì được gọi là ‘‘bhūtagāmo’’ (thực vật).
Tattha bhūtagāmasamārambho pācittiyavatthu, bījagāmasamārambho dukkaṭavatthūti veditabbo.
Therein, it should be understood that the destruction of bhūtagāma is a matter for a pācittiya offense, and the destruction of bījagāma is a matter for a dukkaṭa offense.
Trong đó, việc phá hoại bhūtagāmo là một vấn đề liên quan đến pācittiya, còn việc phá hoại bījagāmo là một vấn đề liên quan đến dukkaṭa.
12. Sannidhikāraparibhoganti sannidhikatassa paribhogaṃ.
12. Sannidhikāraparibhogaṃ means the partaking of what has been stored up.
Sannidhikāraparibhogaṃ là việc thọ dụng những thứ đã được tích trữ.
Tattha duvidhā kathā, vinayavasena ca sallekhavasena ca.
In this regard, the discussion is twofold: from the perspective of the Vinaya and from the perspective of austere practice (sallekha).
Trong đó, có hai cách nói: theo Vinaya và theo hạnh thiểu dục (sallekha).
Vinayavasena tāva yaṃ kiñci annaṃ ajja paṭiggahitaṃ aparajju sannidhikārakaṃ hoti, tassa paribhoge pācittiyaṃ.
First, from the perspective of the Vinaya, any food received today becomes stored food (sannidhikārakaṃ) on the following day; partaking of it incurs a pācittiya offense.
Theo Vinaya, bất kỳ món ăn nào được thọ nhận hôm nay mà được tích trữ đến ngày hôm sau, việc thọ dụng nó sẽ phạm pācittiya.
Attanā laddhaṃ pana sāmaṇerānaṃ datvā, tehi laddhaṃ ṭhapāpetvā dutiyadivase bhuñjituṃ vaṭṭati, sallekho pana na hoti.
However, it is permissible to give what one has received to novices, have them store what they have received, and then eat it on the second day; but this is not austere practice (sallekha).
Tuy nhiên, nếu một Tỳ-khưu tự mình nhận được thức ăn, rồi đưa cho các Sa-di, và nhờ họ giữ lại để ăn vào ngày thứ hai thì được phép, nhưng điều đó không phải là hạnh thiểu dục.
Vatthasannidhimhi anadhiṭṭhitaṃ avikappitaṃ sannidhi ca hoti, sallekhañca kopeti, ayaṃ pariyāyakathā.
Vatthasannidhimhi, in the matter of storing cloth, that which has not been determined (anadhiṭṭhita) and not been shared (avikappita) is both a stored item (sannidhi) and corrupts austere practice (sallekha). This is the discussion in terms of convention.
Đối với vatthasannidhi (tích trữ y phục), y phục chưa được adhiṭṭhāna (tuyên bố sở hữu) hoặc avikappita (trao cho người khác để dùng chung) sẽ trở thành đồ tích trữ và phá hoại hạnh thiểu dục; đây là cách nói gián tiếp.
Nippariyāyato pana ticīvarasantuṭṭhena bhavitabbaṃ, catutthaṃ labhitvā aññassa dātabbaṃ.
In a direct sense, however, one should be content with the three robes. Upon receiving a fourth, it should be given to another.
Tuy nhiên, theo cách nói trực tiếp, một Tỳ-khưu phải bằng lòng với ba y, nếu nhận được y thứ tư thì phải cho người khác.
Sace yassa kassaci dātuṃ na sakkoti, yassa pana dātukāmo hoti, so uddesatthāya vā paripucchatthāya vā gato, āgatamatte dātabbaṃ, adātuṃ na vaṭṭati.
If one is unable to give it to just anyone, but there is someone to whom one wishes to give it, and that person has gone for the purpose of recitation or inquiry, it should be given as soon as he returns; it is not proper not to give it.
Nếu không thể cho bất cứ ai, và người muốn cho đi đang đi vì mục đích học hỏi hoặc hỏi han, thì phải cho ngay khi người đó trở về, không được giữ lại.
Cīvare pana appahonte satiyā paccāsāya anuññātakālaṃ ṭhapetuṃ vaṭṭati.
However, if the robe-material is insufficient, it is permissible to keep it for the allowed period out of need.
Tuy nhiên, nếu y phục không đủ, và có hy vọng sẽ có thêm, thì được phép giữ lại trong thời gian đã được cho phép.
Sūcisuttacīvarakārakānaṃ alābhena tato parampi vinayakammaṃ katvā ṭhapetuṃ vaṭṭati.
Due to the unavailability of a needle, thread, or a robe-maker, it is permissible to keep it even beyond that period after performing a Vinaya act.
Nếu không tìm được kim, chỉ, hoặc người may y, thì được phép giữ lại sau thời gian đó bằng cách thực hiện một hành vi Vinaya.
‘‘Imasmiṃ jiṇṇe puna īdisaṃ kuto labhissāmī’’ti pana ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
But it is not permissible to keep it thinking, “When this one is worn out, from where will I get another like it?” This is both storing (sannidhi) and it corrupts austere practice (sallekha).
Nhưng nếu giữ lại với ý nghĩ ‘‘khi y này cũ nát, làm sao tôi có thể tìm được một cái tương tự?’’, thì không được phép, điều đó sẽ trở thành đồ tích trữ và phá hoại hạnh thiểu dục.
Yānasannidhimhi yānaṃ nāma vayhaṃ, ratho, sakaṭaṃ, sandamānikā, sivikā, pāṭaṅkīti; netaṃ pabbajitassa yānaṃ.
Yānasannidhimhi, in the matter of storing vehicles, yāna refers to a carriage, a chariot, a cart, a palanquin, a litter, and a pāṭaṅkī; these are not vehicles for one who has gone forth.
Đối với yānasannidhi (tích trữ phương tiện đi lại), yāna là kiệu, xe ngựa, xe bò, cáng, ghế võng; đây không phải là phương tiện đi lại của người xuất gia.
Upāhanā pana pabbajitassa yānaṃyeva.
However, sandals are indeed a vehicle for one who has gone forth.
Tuy nhiên, dép lại là phương tiện đi lại của người xuất gia.
Ekabhikkhussa hi eko araññatthāya, eko dhotapādakatthāyāti, ukkaṃsato dve upāhanasaṅghāṭā vaṭṭanti.
For a single bhikkhu, one pair for the forest and one pair for when the feet are washed are permissible; thus, at most, two sets of sandals are allowed.
Đối với một Tỳ-khưu, tối đa hai đôi dép được phép: một đôi để đi rừng, một đôi để rửa chân.
Tatiyaṃ labhitvā aññassa dātabbo.
Upon receiving a third, it should be given to another.
Nếu nhận được đôi thứ ba, phải cho người khác.
‘‘Imasmiṃ jiṇṇe aññaṃ kuto labhissāmī’’ti hi ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
Indeed, it is not permissible to keep it thinking, “When this one is worn out, from where will I get another?” This is both storing (sannidhi) and it corrupts austere practice (sallekha).
Nếu giữ lại với ý nghĩ ‘‘khi đôi này cũ nát, làm sao tôi có thể tìm được đôi khác?’’, thì không được phép, điều đó sẽ trở thành đồ tích trữ và phá hoại hạnh thiểu dục.
Gandhasannidhimhi bhikkhuno kaṇḍukacchuchavidosādiābādhe sati gandhā vaṭṭanti.
Gandhasannidhimhi, in the matter of storing perfumes, if a bhikkhu has an ailment such as itching, scabies, skin disease, and so on, perfumes are permissible.
Đối với gandhasannidhi (tích trữ hương liệu), khi Tỳ-khưu bị các bệnh như ghẻ lở, bệnh da, v.v., thì hương liệu được phép dùng.
Te gandhe āharāpetvā tasmiṃ roge vūpasante aññesaṃ vā ābādhikānaṃ dātabbā, dvāre pañcaṅguligharadhūpanādīsu vā upanetabbā.
Having had those perfumes brought, when that disease has subsided, they should be given to other sick persons, or they may be applied at a doorway for such purposes as making five-fingered handprints or fumigating a house.
Những hương liệu đó sau khi được mang đến, khi bệnh đã khỏi, phải được cho những người bệnh khác, hoặc được dùng để xông hương cửa ra vào, xông hương nhà có năm ngón tay, v.v.
‘‘Puna roge sati bhavissantī’’ti pana ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
However, it is not permissible to keep them thinking, “They will be useful if the disease returns.” This is both storing (sannidhi) and it corrupts austere practice (sallekha).
Nếu giữ lại với ý nghĩ ‘‘sẽ có khi bệnh lại’’, thì không được phép, điều đó sẽ trở thành đồ tích trữ và phá hoại hạnh thiểu dục.
Āmisanti vuttāvasesaṃ daṭṭhabbaṃ.
Āmisa should be understood as what remains after what has been mentioned.
Āmisa (vật chất) cần được hiểu là những thứ còn lại chưa được nói đến.
Seyyathidaṃ, idhekacco bhikkhu – ‘‘tathārūpe kāle upakārāya bhavissatī’’ti tilataṇḍulamuggamāsanāḷikeraloṇamacchamaṃsavallūrasappitelaguḷabhājanādīni āharāpetvā ṭhapeti.
For instance, a certain bhikkhu here has items such as sesame seeds, rice, mung beans, māsa beans, coconuts, salt, fish, meat, dried meat, ghee, oil, jaggery, and jars brought and stored, thinking, “They will be useful at such and such a time.”
Chẳng hạn, một số Tỳ-khưu mang đến và tích trữ hạt mè, gạo, đậu xanh, đậu đen, dừa, muối, cá, thịt khô, dầu, mật đường, v.v., với ý nghĩ ‘‘những thứ này sẽ hữu ích vào lúc thích hợp’’.
So vassakāle kālasseva sāmaṇerehi yāguṃ pacāpetvā paribhuñjitvā ‘‘sāmaṇera, udakakaddame dukkhaṃ gāmaṃ pavisituṃ, gaccha asukaṃ kulaṃ gantvā mayhaṃ vihāre nisinnabhāvaṃ ārocehi; asukakulato dadhiādīni āharā’’ti peseti.
In the rainy season, having had gruel cooked by the novices very early and having partaken of it, he sends them out, saying, "Novice, it is difficult to enter the village because of the water and mud. Go to such-and-such a family and inform them that I am staying in the monastery; bring back curd and so on from such-and-such a family."
Vào mùa mưa, vị tỳ khưu ấy dậy sớm, sai các Sa-di nấu cháo rồi thọ dụng. Sau đó, vị ấy bảo: “Này Sa-di, thật khó để vào làng vì bùn lầy nước đọng. Con hãy đi đến gia đình kia và báo rằng ta đang ở trong tịnh xá; rồi con hãy mang sữa đông và các thứ khác từ gia đình ấy về đây.”
Bhikkhūhi – ‘‘kiṃ, bhante, gāmaṃ pavisissathā’’ti vuttepi, ‘‘duppaveso, āvuso, idāni gāmo’’ti vadati.
Even when the bhikkhus ask, "Venerable sir, will you be entering the village?" he says, "Friends, the village is difficult to enter now."
Khi các tỳ khưu hỏi: “Bạch Thế Tôn, ngài có vào làng không?”, vị ấy đáp: “Này chư Hiền, bây giờ làng khó vào lắm.”
Te – ‘‘hotu, bhante, acchatha tumhe, mayaṃ bhikkhaṃ pariyesitvā āharissāmā’’ti gacchanti.
They say, "So be it, venerable sir. You may stay. We will search for alms food and bring it back," and then they go.
Thế là các vị ấy nói: “Bạch Thế Tôn, xin ngài cứ ở lại, chúng con sẽ đi khất thực rồi mang về.” Và họ ra đi.
Atha sāmaṇeropi dadhiādīni āharitvā bhattañca byañjanañca sampādetvā upaneti, taṃ bhuñjantasseva upaṭṭhākā bhattaṃ pahiṇanti, tatopi manāpaṃ manāpaṃ bhuñjati.
Then the novice, having brought curd and so on, prepares and offers rice and curry. While he is eating it, the supporters send a meal, and from that too, he eats what is delicious.
Sau đó, Sa-di mang sữa đông và các thứ khác về, chuẩn bị cơm và thức ăn rồi dâng lên. Trong khi vị ấy đang thọ dụng, các thí chủ lại gửi cơm đến, và vị ấy lại thọ dụng những món ngon lành từ đó.
Atha bhikkhū piṇḍapātaṃ gahetvā āgacchanti, tatopi manāpaṃ manāpaṃ gīvāyāmakaṃ bhuñjatiyeva.
Then the bhikkhus arrive with the alms food they have collected, and from that too, he eats the delicious items, craning his neck.
Sau đó, các tỳ khưu mang bát khất thực về. Từ bát của họ, vị ấy cũng thọ dụng những món ngon lành, ăn đến no căng cổ.
Evaṃ catumāsampi vītināmeti.
In this way, he passes the entire four months.
Cứ thế, vị ấy trải qua bốn tháng mưa.
Ayaṃ vuccati – ‘‘bhikkhu muṇḍakuṭumbikajīvikaṃ jīvati, na samaṇajīvika’’nti.
This is said to be: "A bhikkhu living the life of a shaven-headed householder, not the life of a samaṇa."
Vị tỳ khưu như vậy được gọi là “sống theo lối sống của gia chủ đầu trọc, không phải lối sống của Sa-môn”.
Evarūpo āmisasannidhi nāma hoti.
Such a one is said to be storing up provisions.
Đó gọi là sự tích trữ vật thực.
Bhikkhuno pana vasanaṭṭhāne ekā taṇḍulanāḷi, eko guḷapiṇḍo, catubhāgamattaṃ sappīti ettakaṃ nidhetuṃ vaṭṭati, akāle sampattacorānaṃ atthāya.
However, it is allowable for a bhikkhu to store in his dwelling place this much: one nāḷi of rice, one lump of molasses, and ghee amounting to one-quarter part, for the sake of thieves who may arrive at an inappropriate time.
Tuy nhiên, tại nơi ở của một tỳ khưu, được phép cất giữ một bát gạo, một cục đường thô, và một phần tư lượng bơ lỏng để dùng cho những kẻ trộm đến vào lúc không thích hợp.
Te hi ettakampi āmisapaṭisanthāraṃ alabhantā jīvitāpi voropeyyuṃ, tasmā sace ettakaṃ natthi, āharāpetvāpi ṭhapetuṃ vaṭṭati.
For if those thieves do not receive even this much hospitable offering of provisions, they might even take his life; therefore, if he does not have this much, it is allowable to have it brought and kept.
Vì nếu không nhận được chút vật thực tiếp đãi nào, chúng có thể cướp đi cả mạng sống. Do đó, nếu không có đủ lượng này, cũng được phép sai người mang đến và cất giữ.
Aphāsukakāle ca yadettha kappiyaṃ, taṃ attanāpi paribhuñjituṃ vaṭṭati.
And during a time of discomfort, whatever of this is allowable, it is permissible for him to consume it himself.
Và trong trường hợp bệnh tật, những gì phù hợp trong số đó, vị ấy cũng được phép tự mình thọ dụng.
Kappiyakuṭiyaṃ pana bahuṃ ṭhapentassāpi sannidhi nāma natthi.
However, for one who stores a large quantity in an allowable hut, there is no storing.
Tuy nhiên, đối với người cất giữ nhiều vật trong một căn chòi hợp lệ (kappiyakuṭi), thì không gọi là tích trữ.
Tathāgatassa pana taṇḍulanāḷiādīsu vā yaṃ kiñci caturatanamattaṃ vā pilotikakhaṇḍaṃ ‘‘idaṃ me ajja vā sve vā bhavissatī’’ti ṭhapitaṃ nāma natthi.
But for the Tathāgata, there was never anything stored from among a nāḷi of rice and so on, or even a piece of cloth measuring four finger-breadths, with the thought, "This will be for me today or tomorrow."
Còn đối với Đức Như Lai, không có bất kỳ vật gì như một bát gạo hoặc bất kỳ miếng vải vụn nào dài bốn gang tay được cất giữ với ý nghĩ: “Cái này sẽ là của ta hôm nay hoặc ngày mai.”
Pekkhanti naṭasamajjaṃ.
A show means a gathering of dancers.
Pekkhaṃ là hội diễn của các diễn viên.
Akkhānanti bhāratayujjhanādikaṃ.
Recitations means the Battle of the Bhāratas and the like.
Akkhānaṃ là những câu chuyện như trận chiến Bhārata.
Yasmiṃ ṭhāne kathīyati, tattha gantumpi na vaṭṭati.
It is not proper even to go to a place where this is being told.
Không được phép đến nơi đang kể chuyện đó.
Pāṇissaranti kaṃsatāḷaṃ, pāṇitāḷantipi vadanti.
Hand-clapping means the clash of cymbals; some say it is also clapping hands.
Pāṇissaraṃ là tiếng chiêng đồng, cũng được gọi là tiếng vỗ tay.
Vetāḷanti ghanatāḷaṃ, mantena matasarīruṭṭhāpanantipi eke.
Vetāla means the beating of solid cymbals; some say it is the raising of a dead body through a mantra.
Vetāḷaṃ là tiếng trống ghana, một số người còn gọi là việc làm cho xác chết sống lại bằng thần chú.
Kumbhathūṇanti caturassaambaṇakatāḷaṃ, kumbhasaddantipi eke.
Kumbhathūṇa means the beating of a square ambaṇaka cymbal; some say it is the sound of a drum.
Kumbhathūṇaṃ là tiếng trống ambaṇaka hình vuông, một số người còn gọi là tiếng trống nồi.
Sobhanakanti naṭānaṃ abbhokkiraṇaṃ, sobhanakaraṃ vā, paṭibhānacittanti vuttaṃ hoti.
Sobhanaka means the offering of dancers; or it makes things beautiful, meaning a creative work of genius.
Sobhanakaṃ là việc rắc hoa của các diễn viên, hoặc là vật trang trí, nghĩa là một bức tranh hoặc tác phẩm điêu khắc được làm đẹp bằng trí tuệ ứng biến.
Caṇḍālanti ayoguḷakīḷā, caṇḍālānaṃ sāṇadhovanakīḷātipi vadanti.
Caṇḍāla means the iron-ball game; some say it is the game of washing hemp played by caṇḍālas.
Caṇḍālaṃ là trò chơi bi sắt, một số người còn gọi là trò chơi giặt vải gai của người Caṇḍāla.
Vaṃsanti veḷuṃ ussāpetvā kīḷanaṃ.
Vaṃsa means playing by raising a bamboo pole.
Vaṃsaṃ là trò chơi dựng cây tre lên.
Dhovananti aṭṭhidhovanaṃ, ekaccesu kira janapadesu kālaṅkate ñātake na jhāpenti, nikhaṇitvā ṭhapenti.
Dhovana means the washing of bones. Indeed, in some districts, they do not cremate their relatives who have passed away; they bury and keep them.
Dhovanaṃ là lễ rửa xương. Có lẽ ở một số vùng, khi người thân qua đời, họ không hỏa táng mà chôn cất.
Atha nesaṃ pūtibhūtaṃ kāyaṃ ñatvā nīharitvā aṭṭhīni dhovitvā gandhehi makkhetvā ṭhapenti.
Then, knowing that their bodies have putrefied, they take them out, wash the bones, anoint them with perfumes, and keep them.
Sau đó, khi biết thân thể đã phân hủy, họ lấy xương ra, rửa sạch, xức dầu thơm rồi cất giữ.
Te nakkhattakāle ekasmiṃ ṭhāne aṭṭhīni ṭhapetvā ekasmiṃ ṭhāne surādīni ṭhapetvā rodantā paridevantā suraṃ pivanti.
At a festival time, they place the bones in one place, place liquor and so on in another place, and while weeping and lamenting, they drink liquor.
Vào dịp lễ hội, họ đặt xương ở một nơi, đặt rượu và các thứ khác ở một nơi, rồi vừa khóc than, vừa uống rượu.
Vuttampi cetaṃ – ‘‘atthi, bhikkhave, dakkhiṇesu janapadesu aṭṭhidhovanaṃ nāma, tattha hoti annampi pānampi khajjampi bhojjampi leyyampi peyyampi naccampi gītampi vāditampi.
And this has been said: "Bhikkhus, in the southern districts there is what is called the washing of bones. There, there is food, drink, hard food, soft food, food to be licked, food to be drunk, dancing, singing, and music.
Điều này cũng đã được nói: “Này chư tỳ khưu, có một lễ rửa xương ở các vùng phía Nam. Ở đó có thức ăn, thức uống, đồ ăn vặt, đồ ăn chính, đồ liếm, đồ uống, múa, hát và nhạc cụ.
Atthetaṃ, bhikkhave, dhovanaṃ, netaṃ natthīti vadāmī’’ti (a. ni. 10.107).
This washing exists, bhikkhus; I do not say that it does not exist."
Này chư tỳ khưu, lễ rửa xương đó có thật, ta không nói là không có.”
Ekacce pana indajālena aṭṭhidhovanaṃ dhovanantipi vadanti.
Some, however, say that dhovana is the washing of bones through magic.
Tuy nhiên, một số người còn nói rằng Dhovanaṃ là việc rửa xương bằng ma thuật.
Hatthiyuddhādīsu bhikkhuno neva hatthiādīhi saddhiṃ yujjhituṃ, na te yujjhāpetuṃ, na yujjhante daṭṭhuṃ vaṭṭati.
Regarding elephant-fights and so on, it is not proper for a bhikkhu to fight with elephants and so on, nor to make them fight, nor to watch them fighting.
Trong các trận đấu voi và các trò tương tự, tỳ khưu không được phép chiến đấu với voi hay các loài vật khác, không được phép sai chúng chiến đấu, và không được phép xem chúng chiến đấu.
Nibbuddhanti mallayuddhaṃ.
Nibbuddha means a wrestling match.
Nibbuddhaṃ là đấu vật.
Uyyodhikanti yattha sampahāro dissati.
Uyyodhika is where a mock-fight can be seen.
Uyyodhikaṃ là nơi có thể thấy sự xung đột.
Balagganti balagaṇanaṭṭhānaṃ.
Balagga is a place for counting the troops.
Balaggaṃ là nơi đếm quân lính.
Senābyūhanti senāniveso, sakaṭabyūhādivasena senāya nivesanaṃ.
Senābyūha is the array of an army, the arrangement of an army in formations such as the cart-array.
Senābyūhaṃ là sự bố trí quân đội, tức là sự sắp xếp quân đội theo đội hình xe cộ, v.v.
Anīkadassananti – ‘‘tayo hatthī pacchimaṃ hatthānīka’’ntiādinā (pāci. 324) nayena vuttassa anīkassa dassanaṃ.
Anīkadassana is the viewing of an army unit spoken of in the manner of "three elephants are the rearguard elephant unit," and so on.
Anīkadassanaṃ là việc xem đội quân đã được nói đến theo cách như: “Ba con voi là đội quân voi cuối cùng” và các cách tương tự.
14. Pamādo ettha tiṭṭhatīti pamādaṭṭhānaṃ.
Heedlessness stands here, thus it is a ground for heedlessness.
14. Nơi nào sự phóng dật tồn tại, đó là pamādaṭṭhānaṃ (nơi phóng dật).
Jūtañca taṃ pamādaṭṭhānañcāti jūtappamādaṭṭhānaṃ.
It is gambling and it is a ground for heedlessness, thus it is a jūtappamādaṭṭhāna.
Cờ bạc cũng là nơi phóng dật, nên gọi là jūtappamādaṭṭhānaṃ (nơi phóng dật của cờ bạc).
Ekekāya pantiyā aṭṭha aṭṭha padāni assāti aṭṭhapadaṃ dasapadepi eseva nayo.
Because in each row there are eight squares, it is an aṭṭhapada; the same method applies to a dasapada.
Mỗi hàng có tám ô, nên gọi là aṭṭhapadaṃ (tám ô). Đối với mười ô cũng vậy.
Ākāsanti aṭṭhapadadasapadesu viya ākāseyeva kīḷanaṃ.
Ākāsa is playing in the air, as if on an aṭṭhapada or dasapada board.
Ākāsaṃ là trò chơi được chơi trên không, giống như trong trò tám ô và mười ô.
Parihārapathanti bhūmiyaṃ nānāpathamaṇḍalaṃ katvā tattha tattha pariharitabbaṃ, pathaṃ pariharantānaṃ kīḷanaṃ.
Parihātapatha is making a circular path of various routes on the ground and playing by those who avoid the path that should be avoided in those respective routes.
Parihārapathaṃ là trò chơi mà người chơi phải tránh các con đường khác nhau đã được vẽ thành vòng tròn trên mặt đất.
Santikanti santikakīḷanaṃ.
Santika is the game of santika.
Santikaṃ là trò chơi santika.
Ekajjhaṃ ṭhapitā sāriyo vā sakkharāyo vā acālentā nakheneva apanenti ca upanenti ca, sace tattha kāci calati, parājayo hoti, evarūpāya kīḷāyetaṃ adhivacanaṃ.
Without moving the dice or pebbles placed together, they remove and add them with just their fingernail. If any one of them moves, it is a defeat. This is the name for such a game.
Trong trò này, các quân cờ hoặc sỏi được đặt gần nhau, người chơi dùng móng tay để di chuyển chúng đi hoặc lại mà không làm xê dịch quân nào khác; nếu có quân nào bị xê dịch, người chơi sẽ thua. Đây là tên gọi của trò chơi như vậy.
Khalikanti jūtaphalake pāsakakīḷanaṃ.
Khalika is playing with dice on a gaming board.
Khalikaṃ là trò chơi xúc xắc trên bàn cờ.
Ghaṭikā vuccati dīghadaṇḍakena rassadaṇḍakaṃ paharaṇakīḷanaṃ.
Ghaṭikā is said to be the game of striking a short stick with a long stick.
Ghaṭikā là trò chơi dùng gậy dài đánh gậy ngắn.
Salākahatthanti lākhāya vā mañjiṭṭhikāya vā piṭṭhodakena vā salākahatthaṃ temetvā – ‘‘kiṃ hotū’’ti bhūmiyaṃ vā bhittiyaṃ vā taṃ paharitvā hatthiassādirūpadassanakīḷanaṃ.
Salākahattha is the game of showing figures of elephants, horses, etc., by moistening a brush with shellac, madder, or flour-water, and asking "What shall it be?", then striking it on the ground or a wall.
Salākahatthaṃ là trò chơi nhúng một cây gậy vào nước sơn mài, hoặc nước màu đỏ, hoặc nước bột gạo, rồi hỏi: “Muốn gì?”, sau đó đánh cây gậy đó xuống đất hoặc tường để tạo ra hình ảnh voi, ngựa, v.v.
Akkhanti guḷakīḷā.
Akkha is the game of marbles.
Akkhaṃ là trò chơi bi.
Paṅgacīraṃ vuccati paṇṇanāḷikaṃ, taṃ dhamantā kīḷanti.
Paṅgacīra is said to be a leaf-pipe; they play by blowing it.
Paṅgacīraṃ là một ống sáo làm bằng lá, người chơi thổi nó để chơi.
Vaṅkakanti gāmadārakānaṃ kīḷanakaṃ khuddakanaṅgalaṃ.
Vaṅkaka is a small toy plough for village children to play with.
Vaṅkakaṃ là một cái cày nhỏ, đồ chơi của trẻ con trong làng.
Mokkhacikā vuccati samparivattanakīḷā, ākāse vā daṇḍakaṃ gahetvā bhūmiyaṃ vā sīsaṃ ṭhapetvā heṭṭhupariyabhāvena parivattanakīḷāti vuttaṃ hoti.
Mokkhacikā is said to be the game of somersaulting, that is, the game of turning upside-down, either by grabbing a bar in the air or by placing one's head on the ground.
Mokkhacikā là trò chơi lăn lộn, tức là trò chơi cầm gậy trên không hoặc đặt đầu xuống đất rồi lăn lộn từ dưới lên trên.
Ciṅgulikaṃ vuccati tālapaṇṇādīhi kataṃ vātappahārena paribbhamanacakkaṃ.
Ciṅgulika is a spinning wheel made of palm leaves and so on, which revolves when struck by the wind.
Ciṅgulikaṃ là một bánh xe quay tròn do gió thổi, làm bằng lá cọ, v.v.
Pattāḷhakaṃ vuccati paṇṇanāḷikā.
Pattāḷhaka is said to be a leaf-measure.
Pattāḷhakaṃ là một cái giỏ lá.
Tāya vālukādīni minantā kīḷanti.
They play by measuring sand and so on with it.
Người chơi dùng nó để đong cát và các thứ khác.
Rathakanti khuddakarathaṃ.
Rathaka is a small chariot.
Rathakaṃ là một chiếc xe nhỏ.
Dhanukanti khuddakadhanumeva.
Dhanuka is a small bow.
Dhanukaṃ cũng là một cây cung nhỏ.
Akkharikā vuccati ākāse vā piṭṭhiyaṃ vā akkharajānanakīḷā.
Akkharikā is said to be the game of guessing letters in the air or on one's back.
Akkharikā là trò chơi nhận biết chữ cái trên không hoặc trên lưng.
Manesikā nāma manasā cintitajānanakīḷā.
Manesikā is the game of guessing what is thought in the mind.
Manesikā là trò chơi đoán ý nghĩ trong tâm.
Yathāvajjaṃ nāma kāṇakuṇikhujjādīnaṃ yaṃ yaṃ vajjaṃ, taṃ taṃ payojetvā dassanakīḷā.
Yathāvajjaṃ is the game of demonstrating by enacting whatever faults belong to the blind, the crippled, the hunchbacked, and so on.
Yathāvajjaṃ là trò chơi thể hiện các khuyết điểm của người mù, người què, người gù, v.v.
15. Āsandinti pamāṇātikkantāsanaṃ.
An āsandi is a seat that exceeds the proper size.
15. Āsandi là ghế ngồi quá khổ.
Anuyuttā viharantīti idaṃ apekkhitvā pana sabbapadesu upayogavacanaṃ kataṃ.
However, the instrumental case is used in all instances with reference to "they dwell engaged in."
Tuy nhiên, khi đề cập đến "anuyuttā viharanti" (sống gắn bó), thì thuật ngữ được sử dụng cho tất cả các đoạn.
Pallaṅkoti pādesu vāḷarūpāni ṭhapetvā kato.
A pallaṅka is one made by attaching animal figures to its legs.
Pallaṅko là ghế được làm với hình rắn ở chân.
Gonakoti dīghalomako mahākojavo, caturaṅgulādhikāni kira tassa lomāni.
A gonaka is a large, long-fleeced woolen coverlet; its fleece is said to be more than four finger-breadths long.
Gonako là một tấm chăn lông dài, dày; lông của nó dài hơn bốn ngón tay.
Cittakanti vānavicittaṃ uṇṇāmayattharaṇaṃ.
Cittaka is a woolen spread with various animal figures.
Cittakaṃ là một tấm thảm len có hoa văn.
Paṭikāti uṇṇāmayo setattharaṇo.
A paṭikā is a white woolen spread.
Paṭikā là một tấm thảm len màu trắng.
Paṭalikāti ghanapupphako uṇṇāmayattharaṇo.
Paṭalikā means a thick woolen blanket with dense flowers.
Paṭalikā là một tấm thảm len có hoa văn dày đặc.
Yo āmalakapattotipi vuccati.
It is also called āmalakapattopi (having emblic myrobalan leaf pattern).
Nó cũng được gọi là tấm thảm có hoa văn hình lá āmalaka.
Tūlikāti tiṇṇaṃ tūlānaṃ aññatarapuṇṇā tūlikā.
Tūlikā means a mattress filled with any one of the three kinds of cotton.
Tūlikā là một loại nệm nhồi bằng một trong ba loại bông.
Vikatikāti sīhabyagghādirūpavicitro uṇṇāmayattharaṇo.
Vikatikā means a woolen rug patterned with figures of lions, tigers, and so on.
Vikatikā là một tấm thảm len được trang trí bằng các hình ảnh sư tử, hổ, v.v.
Uddalomīti ubhayatodasaṃ uṇṇāmayattharaṇaṃ, keci ‘‘ekatouggatapuppha’’nti vadanti.
Uddalomī means a woolen rug with fringes on both sides. Some say it is a rug with raised patterns on one side.
Uddalomī là một tấm thảm len có tua rua ở cả hai mặt; một số người nói rằng nó là một tấm thảm có hoa văn nổi ở một mặt.
Ekantalomīti ekatodasaṃ uṇṇāmayattharaṇaṃ.
Ekantalomī means a woolen rug with fringes on one side.
Ekantalomī là một tấm thảm len có tua rua ở một mặt.
Keci ‘‘ubhatouggatapuppha’’nti vadanti.
Some say it has raised patterns on both sides.
Một số người nói rằng nó có hoa văn nổi ở cả hai mặt.
Kaṭṭissanti ratanaparisibbitaṃ koseyyakaṭṭissamayapaccattharaṇaṃ.
Kaṭṭissa means an over-rug made of coarse silk and stitched with gems, or woven with gold threads inserted into silk threads.
Kaṭṭissa là một tấm trải giường bằng sợi tơ thô được thêu bằng ngọc quý, hoặc được dệt bằng sợi tơ có lồng chỉ vàng.
Koseyyanti ratanaparisibbitameva kosiyasuttamayapaccattharaṇaṃ.
Koseyya means an over-rug made of silk thread, likewise stitched with gems.
Koseyya là một tấm trải giường bằng sợi tơ được thêu bằng ngọc quý.
Suddhakoseyyaṃ pana vaṭṭatīti vinaye vuttaṃ.
However, pure silk is permissible, as stated in the Vinaya.
Tuy nhiên, trong Luật đã nói rằng tấm trải bằng tơ lụa thuần túy thì được phép.
Dīghanikāyaṭṭhakathāyaṃ pana ‘‘ṭhapetvā tūlikaṃ sabbāneva gonakādīni ratanaparisibbitāni na vaṭṭantī’’ti vuttaṃ.
But in the Dīghanikāyaṭṭhakathā, it is said, "Except for tūlikā, all other rugs like gonaka, etc., when stitched with gems, are not permissible."
Nhưng trong Chú Giải Trường Bộ Kinh thì nói rằng: "Trừ nệm bông ra, tất cả các loại thảm lông thú, v.v., được thêu bằng ngọc quý đều không được phép".
Kuttakanti soḷasannaṃ nāṭakitthīnaṃ ṭhatvā naccanayoggaṃ uṇṇāmayattharaṇaṃ.
Kuttaka means a woolen rug suitable for sixteen dancing girls to stand upon and dance.
Kuttaka là một tấm thảm len đủ lớn để mười sáu vũ nữ đứng nhảy.
Hatthattharaṃ assattharanti hatthiassapiṭṭhīsu attharaṇaattharakāyeva.
Hatthatthara and assatthara are coverings for the backs of elephants and horses, respectively.
Hatthattharaṃ assattharaṃ là những tấm trải dùng trên lưng voi và lưng ngựa.
Rathattharepi eseva nayo.
The same method applies to chariot coverings.
Đối với tấm trải xe cũng theo cùng nguyên tắc này.
Ajinappaveṇīti ajinacammehi mañcappamāṇena sibbitvā katā paveṇī.
Ajinappaveṇī means a layered rug made by sewing together antelope skins to the size of a couch.
Ajinappaveṇī là một tấm trải được may từ da linh dương có kích thước bằng một chiếc giường.
Kadalīmigapavarapaccattharaṇanti kadalīmigacammaṃ nāma atthi, tena kataṃ pavarapaccattharaṇaṃ; uttamapaccattharaṇanti attho.
Kadalīmigapavarapaccattharaṇa means a superior over-rug made from the skin of the kadalī deer; that is, an excellent over-rug.
Kadalīmigapavarapaccattharaṇa là một tấm trải quý giá được làm từ da hươu Kadali; tức là một tấm trải thượng hạng.
Taṃ kira setavatthassa upari kadalīmigacammaṃ pattharitvā sibbetvā karonti.
They say it is made by spreading the kadalī deer skin over white cloth and sewing it.
Người ta nói rằng tấm trải đó được làm bằng cách trải da hươu Kadali lên trên một tấm vải trắng rồi may lại.
Sauttaracchadanti saha uttaracchadena, uparibaddhena rattavitānena saddhinti attho.
Sauttaracchada means with an upper covering, that is, with a red canopy suspended above.
Sauttaracchada có nghĩa là có màn che phía trên, tức là có màn trần màu đỏ được treo phía trên.
Setavitānampi heṭṭhā akappiyapaccattharaṇe sati na vaṭṭati, asati pana vaṭṭati.
Even a white canopy is not permissible if there is an impermissible rug below it, but it is permissible if there is none.
Màn trần màu trắng cũng không được phép nếu bên dưới có tấm trải không phù hợp, nhưng nếu không có thì được phép.
Ubhatolohitakūpadhānanti sīsūpadhānañca pādūpadhānañcāti mañcassa ubhatolohitakaṃ upadhānaṃ, etaṃ na kappati.
Ubhatolohitakūpadhāna means a pillow that is red on both ends of the couch, both the head-pillow and the foot-pillow. This is not permissible.
Ubhatolohitakūpadhāna là gối màu đỏ ở cả hai đầu giường, tức là gối đầu và gối chân; điều này không được phép.
Yaṃ pana ekameva upadhānaṃ ubhosu passesu rattaṃ vā hoti padumavaṇṇaṃ vā vicitraṃ vā, sace pamāṇayuttaṃ, vaṭṭati.
However, a single pillow that is red or lotus-colored or variegated on both sides is permissible if it is of the appropriate size.
Tuy nhiên, nếu chỉ có một chiếc gối màu đỏ hoặc màu hoa sen hoặc có hoa văn ở cả hai mặt, và nếu nó có kích thước phù hợp, thì được phép.
Mahāupadhānaṃ pana paṭikkhittaṃ.
But large pillows are forbidden.
Nhưng gối lớn thì bị cấm.
Alohitakāni dvepi vaṭṭantiyeva.
Two non-red pillows are certainly permissible.
Hai chiếc gối không màu đỏ thì đều được phép.
Tato uttari labhitvā aññesaṃ dātabbāni.
If one obtains more than that, they should be given to others.
Nếu có thêm, cần phải cho người khác.
Dātuṃ asakkonto mañce tiriyaṃ attharitvā upari paccattharaṇaṃ datvā nipajjitumpi labhati.
If one cannot give them away, one may spread them crosswise on the couch, place an over-rug on top, and lie down.
Nếu không thể cho, có thể trải ngang trên giường, đặt tấm trải lên trên và nằm xuống.
Āsandīādīsu pana vuttanayeneva paṭipajjitabbaṃ.
In the case of āsandī, etc., one should proceed as stated.
Đối với ghế āsandī và các loại khác, cần phải thực hành theo cách đã nói.
Vuttañhetaṃ – ‘‘anujānāmi, bhikkhave, āsandiyā pāde chinditvā paribhuñjituṃ, pallaṅkassa vāḷe bhinditvā paribhuñjituṃ, tūlikaṃ vijaṭetvā bimbohanaṃ kātuṃ, avasesaṃ bhummattharaṇaṃ kātu’’nti (cūḷava. 297).
For it is said: "Monks, I allow you to break off the legs of an āsandī and use it, to break off the animal figures of a pallaṅka and use it, to unravel a tūlikā to make a pillow, and to use the remaining part as a ground covering."
Điều này đã được nói: "Này các Tỳ-khưu, Ta cho phép các ông cắt chân ghế āsandī để sử dụng, phá bỏ hình thú trên ghế pallaṅka để sử dụng, tháo bông gòn trong nệm tūlikā để làm gối, và biến phần còn lại thành tấm trải sàn".
16. Ucchādanādīsu mātukucchito nikkhantadārakānaṃ sarīragandho dvādasavassapattakāle nassati, tesaṃ sarīraduggandhaharaṇatthāya gandhacuṇṇādīhi ucchādenti, evarūpaṃ ucchādanaṃ na vaṭṭati.
16. In the case of ointments, etc., the bodily scent of children who have emerged from their mother's womb disappears at the age of twelve. To remove their bodily foul odor, they apply scented powders, etc., as an anointing. Such anointing is not permissible.
16. Trong việc xoa bóp, v.v., mùi cơ thể của trẻ sơ sinh sẽ biến mất khi chúng đạt mười hai tuổi. Để loại bỏ mùi hôi cơ thể của chúng, người ta xoa bóp bằng bột thơm, v.v. Việc xoa bóp như vậy không được phép.
Puññavante pana dārake ūrūsu nipajjāpetvā telena makkhetvā hatthapādaūrunābhiādīnaṃ saṇṭhānasampādanatthaṃ parimaddanti, evarūpaṃ parimaddanaṃ na vaṭṭati.
However, they make fortunate children lie on their laps, anoint them with oil, and massage their hands, feet, thighs, navel, etc., to make their figures well-formed. Such massaging is not permissible.
Tuy nhiên, người ta đặt những đứa trẻ có phước lành nằm trên đùi, xoa dầu rồi xoa bóp tay, chân, đùi, rốn, v.v., để tạo hình dáng cơ thể. Việc xoa bóp như vậy không được phép.
Nhāpananti tesaṃyeva dārakānaṃ gandhādīhi nhāpanaṃ.
Nhāpana means bathing those same children with perfumes, etc.
Nhāpana là việc tắm rửa cho những đứa trẻ đó bằng hương liệu, v.v.
Sambāhananti mahāmallānaṃ viya hatthapāde muggarādīhi paharitvā bāhuvaḍḍhanaṃ.
Sambāhana means increasing the size of arms and legs by striking them with clubs, etc., like great wrestlers.
Sambāhana là việc tăng cường sức mạnh cho tay và chân bằng cách đấm bóp bằng chày, v.v., như các đô vật vĩ đại.
Ādāsanti yaṃ kiñci ādāsaṃ pariharituṃ na vaṭṭati.
Ādāsa means carrying any mirror is not permissible.
Ādāsa là không được phép giữ bất kỳ loại gương nào.
Añjananti alaṅkārañjanameva.
Añjana means only kohl for adornment.
Añjana chỉ là thuốc kẻ mắt để trang điểm.
Mālāti baddhamālā vā abaddhamālā vā.
Mālā means either tied garlands or untied flowers.
Mālā là vòng hoa đã kết hoặc vòng hoa chưa kết.
Vilepananti yaṃ kiñci chavirāgakaraṇaṃ.
Vilepana means any substance that creates a lustrous complexion.
Vilepana là bất cứ thứ gì làm da trở nên hấp dẫn.
Mukhacuṇṇaṃ mukhalepananti mukhe kāḷapīḷakādīnaṃ haraṇatthāya mattikakakkaṃ denti, tena lohite calite sāsapakakkaṃ denti, tena dose khādite tilakakkaṃ denti, tena lohite sannisinne haliddikakkaṃ denti, tena chavivaṇṇe ārūḷhe mukhacuṇṇakena mukhaṃ cuṇṇenti, taṃ sabbaṃ na vaṭṭati.
Mukhacuṇṇaṃ mukhalepana means applying a paste of clay to the face to remove black spots and pimples, etc. When the blood is agitated by that, they apply a mustard paste. When the impurities are eaten away by that, they apply a sesame paste. When the blood has settled by that, they apply a turmeric paste. When the complexion has improved by that, they powder the face with face powder. All of that is not permissible.
Mukhacuṇṇaṃ mukhalepanaṃ là người ta dùng bột đất sét để loại bỏ mụn nhọt, v.v., trên mặt. Khi máu lưu thông, người ta dùng bột mù tạt. Khi các khuyết điểm được loại bỏ, người ta dùng bột mè. Khi máu lắng xuống, người ta dùng bột nghệ. Khi da trở nên sáng màu, người ta dùng bột thoa mặt để thoa lên mặt. Tất cả những điều đó đều không được phép.
Hatthabandhādīsu hatthe vicitrasaṅkhakapālādīni bandhitvā vicaranti, taṃ vā aññaṃ vā sabbampi hatthābharaṇaṃ na vaṭṭati, apare sikhaṃ bandhitvā vicaranti.
In the case of hand ornaments, etc., some wear ornate conch shells and bracelets on their hands. That, or any other hand ornament, is not permissible. Others wear their hair in a topknot and walk around.
Trong số các vật trang sức tay, v.v., người ta đeo các loại vỏ ốc, xương, v.v., được trang trí công phu trên tay và đi lại; tất cả các loại trang sức tay như vậy hoặc bất kỳ loại nào khác đều không được phép. Một số người khác búi tóc và đi lại.
Suvaṇṇacīrakamuttalatādīhi ca taṃ parikkhipanti; taṃ sabbaṃ na vaṭṭati.
And they adorn it with golden ornaments, pearl strands, etc. All of that is not permissible.
Họ quấn tóc bằng dây vàng, chuỗi ngọc trai, v.v.; tất cả những điều đó đều không được phép.
Apare catuhatthadaṇḍaṃ vā aññaṃ vā pana alaṅkatadaṇḍakaṃ gahetvā vicaranti, tathā itthipurisarūpādivicittaṃ bhesajjanāḷikaṃ suparikkhittaṃ vāmapasse olaggitaṃ; apare kaṇṇikaratanaparikkhittakosaṃ atitikhiṇaṃ asiṃ, pañcavaṇṇasuttasibbitaṃ makaradantakādivicittaṃ chattaṃ, suvaṇṇarajatādivicitrā morapiñchādiparikkhittā upāhanā, keci ratanamattāyāmaṃ caturaṅgulavitthataṃ kesantaparicchedaṃ dassetvā meghamukhe vijjulataṃ viya nalāṭe uṇhīsapaṭṭaṃ bandhanti, cūḷāmaṇiṃ dhārenti, cāmaravālabījaniṃ dhārenti, taṃ sabbaṃ na vaṭṭati.
Others carry an ornate staff, four cubits long or otherwise, and walk around; similarly, a well-covered medicine tube, variegated with figures of women and men, etc., hanging on the left side; others, a very sharp sword in a scabbard adorned with gems; an umbrella variegated with makara-teeth, etc., and sewn with five-colored threads; sandals variegated with gold, silver, etc., and adorned with peacock feathers, etc. Some tie an ornamental headband on their forehead, showing the hairline, with a length of one ratana and a width of four fingers, like a streak of lightning in the mouth of a cloud. They wear a crest-jewel, they carry a yak-tail whisk. All of that is not permissible.
Một số người khác cầm một cây gậy dài bốn khuỷu tay hoặc một cây gậy trang trí khác và đi lại, cũng như một ống thuốc được trang trí bằng hình nam nữ, v.v., được bao bọc cẩn thận và treo ở bên trái; một số người khác đeo một thanh kiếm rất sắc bén với vỏ kiếm được nạm ngọc, một chiếc dù được thêu bằng năm màu chỉ và trang trí bằng ngà cá sấu, v.v., những đôi dép được trang trí bằng vàng, bạc, v.v., và được đính lông công, v.v. Một số người buộc một dải khăn đội đầu trên trán, dài bằng một viên ngọc và rộng bốn ngón tay, để lộ đường chân tóc, giống như một tia chớp trên đám mây; họ đội vương miện, và cầm quạt lông đuôi bò. Tất cả những điều đó đều không được phép.
17. Aniyyānikattā saggamokkhamaggānaṃ tiracchānabhūtā kathāti tiracchānakathā. Tattha rājānaṃ ārabbha mahāsammato mandhātā dhammāsoko evaṃ mahānubhāvotiādinā nayena pavattā kathā rājakathā. Esa nayo corakathādīsu. Tesu asuko rājā abhirūpo dassanīyotiādinā nayena gehassitakathāva tiracchānakathā hoti.
17. Tiracchānakathā means animal talk, because it does not lead to heaven or liberation. In this, talk that proceeds in the manner of "King Mahāsammata, Mandhātā, Dhammāsoka had such great power" is rājakathā (talk about kings). The same method applies to corakathādayo (talk about robbers, etc.). Among these, talk based on worldly attachment, like "Such-and-such a king was handsome and pleasing to look at," is tiracchānakathā. But talk that proceeds with "Even those with such great power perished" stands as a meditation subject.
17. Tiracchānakathā là những câu chuyện không dẫn đến sự giải thoát, tức là những câu chuyện tầm thường. Trong đó, câu chuyện về các vị vua, chẳng hạn như Đại Chuyển Luân Vương (Mahāsammata), Mandhātā, Dhammāsoka vĩ đại như thế nào, v.v., là rājakathā. Nguyên tắc này cũng áp dụng cho corakathā, v.v. Trong số đó, những câu chuyện liên quan đến gia đình, chẳng hạn như vị vua kia đẹp trai và đáng ngưỡng mộ như thế nào, v.v., là tiracchānakathā.
Sopi nāma evaṃ mahānubhāvo khayaṃ gatoti evaṃ pavattā pana kammaṭṭhānabhāve tiṭṭhati.
Similarly, in the case of robbers, talk based on worldly attachment about their deeds, such as "Mūladeva had such great power, Meghamāla had such great power! Oh, how brave they were!" is tiracchānakathā. The same applies to war. Talk based on worldly attachment about the pleasure of killing, such as "In the Battle of Bhārata, so-and-so killed so-and-so in this way, pierced him in that way," is tiracchānakathā. But talk that proceeds with "Even they perished" is everywhere a meditation subject.
Nhưng những câu chuyện như "Ngay cả người vĩ đại như vậy cũng đã diệt vong" thì trở thành đề mục thiền quán.
Coresu mūladevo evaṃ mahānubhāvo, meghamālo evaṃ mahānubhāvoti tesaṃ kammaṃ paṭicca aho sūrāti gehassitakathāva tiracchānakathā. Yuddhepi bhāratayuddhādīsu asukena asuko evaṃ mārito, evaṃ viddhoti kāmassādavaseneva kathā tiracchānakathā. Tepi nāma khayaṃ gatāti evaṃ pavattā pana sabbattha kammaṭṭhānameva hoti.
Also, it is not permissible to talk about food, etc., based on sensual pleasure, saying, "We ate and consumed such flavorful, fragrant, tasty, and pleasant food."
Trong số những tên cướp, những câu chuyện liên quan đến hành động của họ, chẳng hạn như Mūladeva vĩ đại như thế nào, Meghamāla vĩ đại như thế nào, và "Ôi, thật dũng cảm!", là những câu chuyện tầm thường liên quan đến gia đình, tức là tiracchānakathā. Trong chiến tranh, những câu chuyện về chiến tranh Bhārata, v.v., về việc người này đã giết người kia như thế nào, đã bắn như thế nào, v.v., chỉ dựa trên sự hưởng thụ dục lạc là tiracchānakathā. Nhưng những câu chuyện như "Ngay cả họ cũng đã diệt vong" thì luôn là đề mục thiền quán.
Api ca annādīsu evaṃ vaṇṇavantaṃ gandhavantaṃ rasavantaṃ phassasampannaṃ khādimha bhuñjimhāti kāmassādavasena kathetuṃ na vaṭṭati.
However, it is permissible to speak beneficially, saying, "Formerly, we gave such flavorful food, drink, clothing, bedding, garlands, and scents to virtuous ones, and made offerings to the cetiya."
Hơn nữa, không được phép kể chuyện về thức ăn, v.v., theo cách hưởng thụ dục lạc, chẳng hạn như "Chúng ta đã ăn, đã uống những món ăn, thức uống có màu sắc, hương vị, mùi thơm, và cảm giác tuyệt vời như thế nào".
Sātthakaṃ pana katvā pubbe evaṃ vaṇṇādisampannaṃ annaṃ pānaṃ vatthaṃ sayanaṃ mālaṃ gandhaṃ sīlavantānaṃ adamha, cetiye pūjaṃ karimhāti kathetuṃ vaṭṭati.
Regarding ñātikathādayo (talk about relatives, etc.), it is not permissible to say, based on gratification, "Our relatives are brave and capable," or "Formerly, we traveled in such ornate vehicles."
Tuy nhiên, được phép kể chuyện có ý nghĩa, chẳng hạn như "Trước đây, chúng ta đã cúng dường thức ăn, đồ uống, y phục, giường nằm, vòng hoa, hương liệu có màu sắc, v.v., tuyệt vời như vậy cho những người giữ giới, và đã cúng dường tại bảo tháp".
Ñātikathādīsu pana ‘‘amhākaṃ ñātakā sūrā samatthā’’ti vā ‘‘pubbe mayaṃ evaṃ vicitrehi yānehi vicarimhā’’ti vā assādavasena vattuṃ na vaṭṭati.
However, it is permissible to speak beneficially, saying, "Even those relatives of ours perished," or "Formerly, we gave such sandals to the Saṅgha."
Trong ñātikathā, v.v., không được phép nói một cách hưởng thụ dục lạc rằng "Thân quyến của chúng ta thật dũng cảm và tài giỏi" hoặc "Trước đây, chúng ta đã đi lại bằng những phương tiện lộng lẫy như thế nào".
Sātthakaṃ pana katvā ‘‘tepi no ñātakā khayaṃ gatā’’ti vā ‘‘pubbe mayaṃ evarūpā upāhanā saṅghassa adamhā’’ti vā kathetuṃ vaṭṭati.
However, it is permissible to make it meaningful by saying, "Our relatives have also perished," or "Previously, we gave such sandals to the Saṅgha."
Tuy nhiên, được phép kể chuyện có ý nghĩa, chẳng hạn như "Ngay cả những thân quyến đó của chúng ta cũng đã diệt vong" hoặc "Trước đây, chúng ta đã cúng dường những đôi dép như thế này cho Tăng đoàn".
Gāmakathāpi suniviṭṭhadunniviṭṭhasubhikkhadubbhikkhādivasena vā ‘‘asukagāmavāsino sūrā samatthā’’ti vā evaṃ assādavasena na vaṭṭati.
Talk of villages, too, is not proper when done with sensual delight, whether in terms of being well-situated or poorly-situated, prosperous or famine-stricken, and so on, or by saying, “The inhabitants of such-and-such a village are brave and capable.”
Chuyện làng cũng không được nói theo kiểu thích thú về việc làng đó được an cư hay không an cư, có mùa màng tốt hay mất mùa, hoặc nói rằng ‘dân làng đó dũng cảm, có năng lực’.
Sātthakaṃ pana katvā ‘‘saddhā pasannā’’ti vā ‘‘khayavayaṃ gatā’’ti vā vattuṃ vaṭṭati.
However, it is proper to speak of it meaningfully, saying, “They have faith and confidence,” or, “They have come to destruction and ruin.”
Nhưng nếu biến thành có ích thì được phép nói rằng ‘họ có đức tin, hoan hỷ’ hoặc ‘họ đã đi đến sự tiêu vong’.
Nigamanagarajanapadakathādīsupi eseva nayo.
This same method applies to talk of towns, cities, countries, and so on.
Trong các chuyện về thị trấn, thành phố, quốc gia, v.v. cũng theo cách tương tự.
Itthikathāpi vaṇṇasaṇṭhānādīni paṭicca assādavasena na vaṭṭati, saddhā pasannā khayavayaṃ gatāti evameva vaṭṭati.
Talk of women, too, is not proper when done with sensual delight concerning their complexion, figure, and so on; it is only proper to say, “She has faith and confidence,” or, “She has come to destruction and ruin.”
Chuyện phụ nữ cũng không được nói theo kiểu thích thú dựa trên sắc đẹp, hình dáng, v.v., mà chỉ được nói rằng họ có đức tin, hoan hỷ, đã đi đến sự tiêu vong, v.v.
Sūrakathāpi ‘nandimitto nāma yodho sūro ahosī’ti assādavasena na vaṭṭati.
Talk of heroes, too, is not proper when done with sensual delight, saying, ‘The warrior named Nandimitta was a hero.’
Chuyện anh hùng cũng không được nói theo kiểu thích thú rằng ‘chiến binh tên Nandimitta là một anh hùng’.
Saddho ahosi khayaṃ gatoti evameva vaṭṭati.
It is only proper to say, “He was faithful,” or, “He has come to destruction.”
Chỉ được nói rằng ‘ông ấy có đức tin, đã đi đến sự tiêu vong’.
Visikhākathāpi ‘‘asukā visikhā suniviṭṭhā dunniviṭṭhā sūrā samatthā’’ti assādavasena na vaṭṭati.
Talk of streets, too, is not proper when done with sensual delight, saying, “Such-and-such a street is well-situated or poorly-situated,” or, “The people are brave and capable.”
Chuyện đường phố cũng không được nói theo kiểu thích thú rằng ‘đường phố đó được an cư hay không an cư, có những người dũng cảm, có năng lực’.
Saddhā pasannā khayavayaṃ gatāti evameva vaṭṭati.
It is only proper to say, “They have faith and confidence,” or, “They have come to destruction and ruin.”
Chỉ được nói rằng ‘họ có đức tin, hoan hỷ, đã đi đến sự tiêu vong’.
Samuddakkhāyikā nāma kasmā samuddo sāgaro?
Speculation about the sea is, for instance: “Why is the ocean called sāgara?”
Samuddakkhāyikā là những chuyện như ‘tại sao biển lại được gọi là Samudda, Sāgara?’
Sāgaradevena khato, tasmā sāgaro.
“It was dug by the deva Sāgara, therefore it is sāgara.”
‘Được đào bởi thần Sāgara, nên gọi là Sāgara’.
Khato meti hatthamuddāya sayaṃ niveditattā ‘‘samuddo’’ti evamādikā niratthakā samuddakkhāyanakathā.
Pointless speculation about the sea, such as: “It is called samudda because he himself indicated with a hand gesture, ‘It was dug by me (sa-mudda).’”
‘Vì tự mình báo tin bằng cử chỉ tay rằng “ta đã đào”, nên gọi là “Samudda”’, v.v., những chuyện vô ích về biển cả như vậy.
Bhavoti vuḍḍhi.
Existence means increase.
Bhavo là sự tăng trưởng.
Abhavoti hāni.
Non-existence means decrease.
Abhavo là sự suy giảm.
Iti bhavo, iti abhavoti yaṃ vā taṃ vā niratthakakāraṇaṃ vatvā pavattitakathā itibhavābhavakathā.
Talk of existence and non-existence is talk that proceeds by stating some pointless reason or other, such as, “Thus there is existence; thus there is non-existence.”
Itibhavābhavakathā là những chuyện được nói ra sau khi đưa ra bất kỳ lý do vô ích nào, như ‘đây là sự tăng trưởng, đây là sự suy giảm’.
18. Viggāhikakathāti viggahakathā, sārambhakathā.
18. Contentious talk means disputatious talk, hostile talk.
18. Viggāhikakathā là chuyện tranh chấp, chuyện gây gổ.
Tattha sahitaṃ meti mayhaṃ vacanaṃ sahitaṃ siliṭṭhaṃ atthayuttaṃ kāraṇayuttanti attho.
Therein, “Mine is consistent” means my statement is consistent, coherent, meaningful, and logical.
Trong đó, sahitaṃ me có nghĩa là ‘lời nói của ta là đúng đắn, chặt chẽ, có ý nghĩa, có lý’.
Asahitaṃ teti tuyhaṃ vacanaṃ asahitaṃ asiliṭṭhaṃ.
“Yours is inconsistent” means your statement is inconsistent, incoherent.
Asahitaṃ te có nghĩa là ‘lời nói của ngươi là không đúng đắn, không chặt chẽ’.
Adhiciṇṇaṃ te viparāvattanti yaṃ tuyhaṃ dīgharattāciṇṇavasena suppaguṇaṃ, taṃ mayhaṃ ekavacaneneva viparāvattaṃ parivattitvā ṭhitaṃ, na kiñci jānāsīti attho.
“What you have long practiced has been overturned” means that which was well-mastered by you through long practice is now overturned by my single statement; the meaning is, “You know nothing.”
Adhiciṇṇaṃ te viparāvattaṃ có nghĩa là ‘điều mà ngươi đã quen thuộc trong một thời gian dài, điều đó đã bị ta đảo ngược chỉ bằng một lời nói; ngươi chẳng biết gì cả’.
19. Dūteyyakathāyaṃ idha gacchāti ito asukaṃ nāma ṭhānaṃ gaccha.
19. In talk of messages, “Go here” means go from here to such-and-such a place.
19. Trong chuyện sứ giả, idha gacchā có nghĩa là ‘hãy đi từ đây đến nơi tên là…’.
Amutrāgacchāti tato asukaṃ nāma ṭhānaṃ āgaccha.
“Come from there” means come from there to such-and-such a place.
Amutrāgacchā có nghĩa là ‘hãy đến đây từ nơi tên là…’.
Idaṃ harāti ito idaṃ nāma hara.
“Take this” means take this thing from here.
Idaṃ harā có nghĩa là ‘hãy mang vật tên là này từ đây đi’.
Amutra idaṃ āharāti asukaṭṭhānato idaṃ nāma idha āhara.
“Bring this from there” means bring this thing here from such-and-such a place.
Amutra idaṃ āharā có nghĩa là ‘hãy mang vật tên là này từ nơi đó đến đây’.
Saṅkhepato pana idaṃ dūteyyaṃ nāma ṭhapetvā pañca sahadhammike ratanattayassa upakārapaṭisaṃyuttañca gihīsāsanaṃ aññesaṃ na vaṭṭati.
In short, however, this business of being a messenger is not proper for others, apart from for the five kinds of spiritual companions and messages from householders connected with rendering service to the Triple Gem.
Tuy nhiên, tóm lại, công việc sứ giả này không được phép đối với những người khác, ngoại trừ năm vị đồng phạm hạnh và những lời nhắn nhủ của cư sĩ có liên quan đến lợi ích của Tam Bảo.
20. Kuhakātiādīsu tividhena kuhanavatthunā lokaṃ kuhayanti, vimhāpayantīti kuhakā.
20. In the passage beginning with “Deceivers,” they are called deceivers because they deceive and astonish the world with the threefold basis of deception.
20. Trong Kuhakā v.v., kuhakā là những người lừa dối, làm cho thế gian ngạc nhiên bằng ba loại đối tượng lừa dối.
Lābhasakkāratthikā hutvā lapantīti lapakā. Nimittaṃ sīlametesanti nemittikā. Nippeso sīlametesanti nippesikā. Lābhena lābhaṃ nijigīsanti magganti pariyesantīti lābhena lābhaṃ nijigīsitāro. Kuhanā, lapanā, nemittikatā, nippesikatā, lābhena lābhaṃ nijigīsanatāti etāhi samannāgatānaṃ puggalānaṃ etaṃ adhivacanaṃ.
They are called “smooth-talkers” because they speak out of a desire for gains and honour. They are “diviners” because it is their practice to give hints. They are “belittlers” because it is their practice to belittle others. They are “those who pursue gain with gain” because they seek and search for gain with gain. These are designations for individuals endowed with deception, smooth-talking, divining, belittling, and pursuing gain with gain.
Lapakā là những người nói dối vì muốn được lợi lộc và sự tôn kính. Nemittikā là những người có thói quen xem điềm. Nippesikā là những người có thói quen làm hại người khác. Lābhena lābhaṃ nijigīsitāro là những người tìm kiếm, mong muốn lợi lộc bằng lợi lộc. Đây là những tên gọi dành cho những người có đầy đủ sự lừa dối (kuhanā), nói dối (lapanā), xem điềm (nemittikatā), làm hại người khác (nippesikatā), và tìm kiếm lợi lộc bằng lợi lộc (lābhena lābhaṃ nijigīsanatā).
Ayamettha saṅkhepo.
This is the summary here.
Đây là phần tóm tắt.
Vitthārena panetā kuhanādikā visuddhimagge sīlaniddeseyeva pāḷiñca aṭṭhakathañca āharitvā pakāsitāti.
However, these things, such as deception, have been explained in detail in the Visuddhimagga, in the exposition of virtue, by citing both the Pali and the commentary.
Tuy nhiên, những điều về kuhanā v.v. này đã được trình bày chi tiết trong Thanh Tịnh Đạo, trong phần giải thích về giới, bằng cách trích dẫn cả Pāḷi và Chú giải.
21. Ito paraṃ mahāsīlaṃ hoti.
21. Hereafter follows the Great Section on Virtue.
21. Từ đây trở đi là Đại Giới.
Aṅganti hatthapādādīsu yena kenaci evarūpena aṅgena samannāgato dīghāyu yasavā hotītiādinayappavattaṃ aṅgasatthaṃ.
Bodily marks means the science of bodily marks, which proceeds in the following way: “One endowed with such-and-such a bodily feature, among hands, feet, and so on, becomes long-lived and famous.”
Aṅga là khoa tướng số về các chi phần như tay, chân, v.v., theo đó người có chi phần như vậy sẽ sống lâu, có danh tiếng, v.v.
Nimittanti nimittasatthaṃ.
Prognostication means the science of omens.
Nimitta là khoa xem điềm.
Paṇḍurājā kira tisso muttāyo muṭṭhiyaṃ katvā nemittikaṃ pucchi – ‘‘kiṃ me hatthe’’ti?
It is said that King Paṇḍu, holding three pearls in his fist, asked a diviner, “What is in my hand?”
Tương truyền, vua Paṇḍu đã cầm ba viên ngọc trai trong tay và hỏi nhà xem điềm: “Trong tay ta có gì?”
So ito cito ca vilokesi, tasmiñca samaye gharagolikāya makkhikā gayhantī muttā, so ‘‘muttā’’ti āha.
He looked here and there, and at that moment, a house lizard, while catching a fly, let it escape (muttā); so he said, “Pearls (muttā).”
Vị đó nhìn quanh đây đó, và vào lúc đó, một con thằn lằn nhà đang bắt một con ruồi thì làm rơi một viên ngọc trai. Vị đó nói: “Ngọc trai!”
Puna ‘‘katī’’ti puṭṭho kukkuṭassa tikkhattuṃ ravantassa saddaṃ sutvā ‘‘tisso’’ti āha.
When asked again, “How many?” he heard the sound of a rooster crowing three times and said, “Three.”
Khi được hỏi lại: “Bao nhiêu viên?”, nghe tiếng gà gáy ba lần, vị đó nói: “Ba viên!”
Evaṃ taṃ taṃ ādisitvā nimittamanuyuttā viharanti.
In this way, they live engaged in prognostication, pointing out this and that omen.
Cứ như vậy, họ sống bằng cách giải đoán điềm báo.
Uppātanti asanipātādīnaṃ mahantānaṃ uppatitaṃ, tañhi disvā ‘‘idaṃ bhavissati, evaṃ bhavissatī’’ti ādisanti.
Portents means the occurrence of major events like thunderbolts. Upon seeing them, they predict, “This will happen, that will happen.”
Uppāta là sự xuất hiện của những hiện tượng lớn như sét đánh, v.v. Khi thấy chúng, họ dự đoán: “Điều này sẽ xảy ra, điều kia sẽ xảy ra” và giải thích.
Supinanti yo pubbaṇhasamaye supinaṃ passati, evaṃ vipāko hoti; yo idaṃ nāma passati, tassa idaṃ nāma hotītiādinā nayena supinakaṃ anuyuttā viharanti.
Dreams means they live engaged in the interpretation of dreams in the following way: “Whoever sees a dream in the early morning will have such-and-such a result; whoever sees this thing will have that outcome.”
Supina là những người sống bằng cách giải đoán giấc mơ, theo cách: “Nếu mơ thấy điều này vào buổi sáng sớm, sẽ có quả báo như vậy; nếu mơ thấy điều tên là này, sẽ có điều tên là kia xảy ra” và giải thích.
Lakkhaṇanti iminā lakkhaṇena samannāgato rājā hoti, iminā uparājātiādikaṃ.
Characteristics refers to such things as, “One endowed with this characteristic becomes a king, with that one a viceroy.”
Lakkhaṇa là những điều như: “Người có tướng này sẽ làm vua, người có tướng kia sẽ làm phó vương”, v.v.
Mūsikacchinnanti undūrakhāyitaṃ.
Cloth gnawed by mice means cloth eaten by rats.
Mūsikacchinna là những điều bị chuột gặm.
Tenāpi hi ahate vā vatthe anahate vā vatthe ito paṭṭhāya evaṃ chinne idaṃ nāma hotīti ādisanti.
Based on that too, whether on new cloth or old cloth, they predict, “If it is gnawed in this way from this point, such-and-such will happen.”
Ngay cả từ đó, họ cũng dự đoán rằng: “Nếu vải mới hoặc cũ bị cắt như vậy từ đây, sẽ có điều tên là này xảy ra” và giải thích.
Aggihomanti evarūpena dārunā evaṃ hute idaṃ nāma hotīti aggijuhanaṃ.
Fire oblation is the offering to fire, such as: “If an offering is made in this manner with this kind of wood, such-and-such will happen.”
Aggihoma là việc cúng dường lửa, theo đó: “Nếu cúng dường bằng loại củi như vậy, sẽ có điều tên là này xảy ra” và giải thích.
Dabbihomādīnipi aggihomāneva, evarūpāya dabbiyā īdisehi kaṇādīhi hute idaṃ nāma hotīti evaṃ pavattivasena pana visuṃ vuttāni.
Oblations with a ladle and so on are also fire oblations, but they are mentioned separately because they are performed in a certain way, such as: “If an offering is made with such-and-such a ladle and with these kinds of grains, such-and-such will happen.”
Dabbihoma, v.v. cũng là các loại cúng dường lửa, nhưng chúng được nói riêng vì chúng diễn ra theo cách: “Nếu cúng dường bằng muỗng như vậy với các hạt như vậy, sẽ có điều tên là này xảy ra” và giải thích.
Tattha kaṇoti kuṇḍako.
Therein, broken rice means husk.
Trong đó, kaṇo là cám.
Taṇḍulāti sāliādīnañceva tiṇajātīnañca taṇḍulā.
Rice grains means the grains of rice and other types of grass.
Taṇḍulā là gạo của lúa (sāli) và các loại cỏ khác.
Sappīti gosappiādikaṃ.
Ghee means cow's ghee and so on.
Sappī là bơ bò, v.v.
Telanti tilatelādikaṃ.
Oil means sesame oil and so on.
Tela là dầu mè, v.v.
Sāsapādīni pana mukhena gahetvā aggimhi pakkhipanaṃ, vijjaṃ parijappitvā juhanaṃ vā mukhahomaṃ. Dakkhiṇakkhakajaṇṇulohitādīhi juhanaṃ lohitahomaṃ.
Taking mustard seeds and so on in the mouth and throwing them into the fire, or making an offering while reciting a spell, is a mouth oblation. Making an offering with blood from the right knee, eye, and so on, is a blood oblation.
Mukhahoma là việc lấy hạt cải, v.v. bằng miệng và ném vào lửa, hoặc cúng dường sau khi tụng thần chú. Lohitahoma là việc cúng dường bằng máu từ đầu gối, vai phải, v.v.
Aṅgavijjāti pubbe aṅgameva disvā byākaraṇavasena aṅgaṃ vuttaṃ, idha aṅgulaṭṭhiṃ disvā vijjaṃ parijappitvā ayaṃ kulaputto vā no vā, sirīsampanno vā no vātiādibyākaraṇavasena aṅgavijjā vuttā.
Knowledge of bodily marks: previously, aṅga was mentioned in terms of making a prediction just by seeing a bodily mark; here, aṅgavijjā is mentioned in terms of making a prediction by seeing a finger bone and reciting a spell as to whether one is of good family or not, fortunate or not, and so on.
Aṅgavijjā: Trước đây, aṅga được nói về việc giải đoán chỉ bằng cách nhìn vào các chi phần. Ở đây, aṅgavijjā được nói về việc giải đoán liệu người con trai gia đình này có phải là người giàu sang hay không, bằng cách nhìn vào xương ngón tay và tụng thần chú.
Vatthuvijjāti gharavatthuārāmavatthādīnaṃ guṇadosasallakkhaṇavijjā.
Knowledge of sites is the knowledge for determining the good and bad qualities of house sites, monastery sites, and so on.
Vatthuvijjā là khoa học về việc nhận biết ưu và nhược điểm của các loại đất xây nhà, đất làm tu viện, v.v.
Mattikādivisesaṃ disvāpi hi vijjaṃ parijappitvā heṭṭhā pathaviyaṃ tiṃsaratanamatte, ākāse ca asītiratanamatte padese guṇadosaṃ passanti.
For, by observing the specific characteristics of the soil and reciting a spell, they see the good and bad qualities in an area thirty cubits below the earth and eighty cubits up in the sky.
Thật vậy, ngay cả khi nhìn thấy các loại đất sét khác nhau, họ cũng tụng thần chú và nhìn thấy ưu và nhược điểm của đất ở độ sâu ba mươi tầm dưới mặt đất và ở độ cao tám mươi tầm trên không trung.
Khattavijjāti abbheyyamāsurakkharājasatthādisatthaṃ.
Knowledge of statecraft is the science of warriors, demons, kings, and so on, which should not be studied.
Khattavijjā là khoa học về các chữ cái của các vị vua A-tu-la, v.v.
Sivavijjāti susāne pavisitvā santikaraṇavijjā, siṅgālarutavijjātipi vadanti.
Sivavijjā is the science of pacification practiced by entering a charnel ground; they also call it the science of jackal cries.
Sivavijjā là thuật đi vào nghĩa địa để làm cho tai họa được an lành; cũng gọi là thuật tiếng hú của chó rừng.
Bhūtavijjāti bhūtavejjamanto.
Bhūtavijjā is a mantra for treating those possessed by spirits.
Bhūtavijjā là thần chú để điều khiển các loài quỷ thần.
Bhūrivijjāti bhūrighare vasantena uggahetabbamanto.
Bhūrivijjā is a mantra to be learned while living in an earth-house.
Bhūrivijjā là thần chú mà người sống trong hang đất hoặc nhà dưới đất nên học.
Ahivijjāti sappadaṭṭhatikicchanavijjā ceva sappāvhāyanavijjā ca.
Ahivijjā is both the science of treating snakebites and the science of charming snakes.
Ahivijjā là thuật chữa rắn cắn và thuật gọi rắn.
Visavijjāti yāya, purāṇavisaṃ vā rakkhanti, navavisaṃ vā karonti visavantameva vā.
Visavijjā is that by which they either preserve old poison or create new poison, or that which deals with poison itself.
Visavijjā là thuật mà nhờ đó người ta có thể bảo vệ nọc độc cũ hoặc tạo ra nọc độc mới, hoặc làm cho nọc độc được nôn ra.
Vicchikavijjāti vicchikadaṭṭhatikicchanavijjā.
Vicchikavijjā is the science of treating scorpion stings.
Vicchikavijjā là thuật chữa vết cắn của bọ cạp.
Mūsikavijjāyapi eseva nayo.
The same method applies to Mūsikavijjā.
Đối với Mūsikavijjā cũng theo cách tương tự.
Sakuṇavijjāti sapakkhakaapakkhakadvipadacatuppadānaṃ rutagatādivasena sakuṇañāṇaṃ.
Sakuṇavijjā is the knowledge of omens based on the cries, movements, and so on, of winged and wingless creatures, bipeds, and quadrupeds.
Sakuṇavijjā là kiến thức về chim chóc, biết được tiếng kêu, cách bay, v.v., của các loài có cánh, không cánh, hai chân, bốn chân.
Vāyasavijjāti kākarutañāṇaṃ, taṃ visuññeva satthaṃ, tasmā visuṃ vuttaṃ.
Vāyasavijjā is the knowledge of crow cries; this is a separate science, which is why it is mentioned separately.
Vāyasavijjā là kiến thức về tiếng kêu của quạ; đó là một bộ môn khoa học riêng biệt, vì vậy được đề cập riêng.
22. Maṇilakkhaṇādīsu evarūpo maṇi pasattho, evarūpo apasattho, sāmino ārogyaissariyādīnaṃ hetu hoti, na hotīti, evaṃ vaṇṇasaṇṭhānādivasena maṇiādīnaṃ lakkhaṇaṃ anuyuttā viharantīti attho.
22. Regarding the characteristics of gems and so on, the meaning is that they dwell engaged in the science of the characteristics of gems and the like based on their color, shape, and so on, determining thus: “A gem of this type is commendable; a gem of that type is not commendable,” and “It is a cause of health, sovereignty, etc., for the owner,” or “It is not.”
22. Về Maṇilakkhaṇa và các loại tương tự, có nghĩa là họ sống chuyên tâm vào việc xem xét các đặc điểm của ngọc báu và các loại tương tự, như: “Viên ngọc này tốt, viên ngọc kia không tốt, nó là nguyên nhân của sức khỏe, quyền lực, v.v., cho chủ nhân, hay không phải là nguyên nhân”, tùy theo màu sắc, hình dáng, v.v.
Tattha āvudhanti ṭhapetvā asiādīni avasesaṃ āvudhaṃ.
Therein, āvudha means weapons other than swords and the like.
Trong đó, āvudha là các loại vũ khí còn lại, ngoại trừ gươm và các loại tương tự.
Itthilakkhaṇādīnipi yamhi kule te itthipurisādayo vasanti, tassa vuḍḍhihānivaseneva veditabbāni.
The characteristics of women and so on are to be understood based on the prosperity or decline of the family in which those women, men, and others live.
Các Itthilakkhaṇa và các loại tương tự cũng nên được hiểu tùy theo sự thịnh suy của gia đình mà những người nam nữ đó sinh sống.
Ajalakkhaṇādīsu pana evarūpānaṃ ajādīnaṃ maṃsaṃ khāditabbaṃ, evarūpānaṃ na khāditabbanti ayaṃ viseso veditabbo.
However, regarding the characteristics of goats and so on, this distinction should be understood: “The meat of such-and-such goats should be eaten; the meat of such-and-such goats should not be eaten.”
Tuy nhiên, đối với Ajalakkhaṇa và các loại tương tự, cần biết sự khác biệt này: “Thịt của những con dê và các loại tương tự như thế này thì nên ăn, còn thịt của những con như thế kia thì không nên ăn”.
Api cettha godhāya lakkhaṇe cittakammapiḷandhanādīsupi evarūpāya godhāya sati idaṃ nāma hotīti ayaṃ viseso veditabbo.
Furthermore, regarding the characteristics of an iguana, this distinction should be understood: “When there is an iguana of such-and-such a type in paintings, ornaments, and so on, such-and-such a thing will happen.”
Hơn nữa, ở đây, đối với Godhāya lakkhaṇa (đặc điểm của kỳ đà), cần biết sự khác biệt này: “Khi có kỳ đà như thế này trong các bức tranh hoặc đồ trang sức, thì điều này sẽ xảy ra”.
Idañcettha vatthu – ekasmiṃ kira vihāre cittakamme godhaṃ aggiṃ dhamamānaṃ akaṃsu.
And here is the story about this: It is said that in a certain monastery, they made a painting of an iguana blowing on a fire.
Và đây là câu chuyện liên quan: Người ta kể rằng, trong một tu viện, trên một bức tranh, họ vẽ một con kỳ đà đang thổi lửa.
Tato paṭṭhāya bhikkhūnaṃ mahāvivādo jāto.
From that time on, a great dispute arose among the monks.
Từ đó, một cuộc tranh cãi lớn đã nảy sinh giữa các Tỳ-khưu.
Eko āgantukabhikkhu taṃ disvā makkhesi.
A visiting monk saw it and erased it.
Một Tỳ-khưu khách thấy vậy liền xóa bỏ bức tranh.
Tato paṭṭhāya vivādo mandībhūto hoti.
From that time on, the dispute subsided.
Từ đó trở đi, cuộc tranh cãi lắng xuống.
Kaṇṇikalakkhaṇaṃ piḷandhanakaṇṇikāyapi gehakaṇṇikāyapi vasena veditabbaṃ.
The characteristics of a kaṇṇikā should be understood with reference to an ear-ornament and a house-pinnacle.
Kaṇṇikalakkhaṇa (đặc điểm của hoa tai) nên được hiểu theo nghĩa hoa tai trang sức và hoa tai nhà.
Kacchapalakkhaṇaṃ godhālakkhaṇasadisameva.
The characteristics of a tortoise are similar to the characteristics of an iguana.
Kacchapalakkhaṇa (đặc điểm của rùa) cũng tương tự như đặc điểm của kỳ đà.
Migalakkhaṇaṃ sabbasaṅgāhikaṃ sabbacatuppadānaṃ lakkhaṇavasena vuttaṃ.
The characteristics of a deer is stated comprehensively with reference to the characteristics of all quadrupeds.
Migalakkhaṇa (đặc điểm của thú vật) được đề cập theo nghĩa đặc điểm của tất cả các loài động vật bốn chân, bao gồm tất cả chúng.
23. Raññaṃ niyyānaṃ bhavissatīti asukadivase asukanakkhattena asukassa nāma rañño niggamanaṃ bhavissatīti evaṃ rājūnaṃ pavāsagamanaṃ byākaroti.
23. Regarding “the kings’ march-out will occur,” he predicts the travel of kings abroad, saying, “On such-and-such a day, under such-and-such a constellation, the departure of King So-and-so will take place.”
23. Raññaṃ niyyānaṃ bhavissatī (vua sẽ xuất chinh) có nghĩa là dự đoán việc vua sẽ đi xa, chẳng hạn như: “Vào ngày đó, dưới chòm sao đó, vua tên là đó sẽ xuất chinh”.
Esa nayo sabbattha.
This method applies everywhere.
Điều này áp dụng cho tất cả các trường hợp.
Kevalaṃ panettha aniyyānanti vippavutthānaṃ puna āgamanaṃ.
However, here, “march-in” means the return of those who are away from home.
Tuy nhiên, ở đây, aniyyāna là sự trở về của những người đã đi xa.
Abbhantarānaṃ raññaṃ upayānaṃ bhavissati, bāhirānaṃ raññaṃ apayānanti antonagare amhākaṃ rājā paṭiviruddhaṃ bahirājānaṃ upasaṅkamissati, tato tassa paṭikkamanaṃ bhavissatīti evaṃ raññaṃ upayānāpayānaṃ byākaroti.
Regarding “the march-up of the inner kings will occur, the march-away of the outer kings,” he predicts the advance and retreat of kings, saying, “Our king within the city will advance upon the opposing king outside, and then the latter’s retreat will occur.”
Abbhantarānaṃ raññaṃ upayānaṃ bhavissati, bāhirānaṃ raññaṃ apayāna có nghĩa là dự đoán sự đến và đi của các vị vua, chẳng hạn như: “Vị vua của chúng ta trong thành sẽ đến gặp vị vua bên ngoài đối địch, và sau đó vị vua bên ngoài sẽ rút lui”.
Dutiyapadepi eseva nayo.
The same method applies to the second phrase.
Điều này cũng tương tự trong vế thứ hai.
Jayaparājayā pākaṭāyeva.
Victory and defeat are self-evident.
Chiến thắng và thất bại thì đã rõ ràng.
24. Candaggāhādayo asukadivase rāhu candaṃ gahessatīti byākaraṇavaseneva veditabbā.
24. Lunar eclipses and so on are to be understood simply through the prediction that “On such-and-such a day, Rāhu will seize the moon.”
24. Candaggāhādayo (hiện tượng nguyệt thực và các loại tương tự) nên được hiểu theo nghĩa dự đoán, chẳng hạn như: “Vào ngày đó, Rahu sẽ nuốt mặt trăng”.
Api ca nakkhattassa aṅgārakādigāhasamāyogopi nakkhattagāhoyeva.
Furthermore, the conjunction of a constellation with planets like Mars is also a planetary eclipse of a constellation.
Hơn nữa, sự kết hợp của một chòm sao với sao Hỏa và các hành tinh khác cũng là một hiện tượng nguyệt thực.
Ukkāpātoti ākāsato ukkānaṃ patanaṃ.
A meteor fall is the falling of firebrands from the sky.
Ukkāpāto là hiện tượng các thiên thạch rơi từ trên trời xuống.
Disāḍāhoti disākālusiyaṃ aggisikhadhūmasikhādīhi ākulabhāvo viya.
A directional fire is a disturbance in the directions, like a state of turmoil caused by tongues of fire, tongues of smoke, and so on.
Disāḍāho là sự u ám của các phương hướng, như thể bị bao phủ bởi lửa và khói.
Devadudrabhīti sukkhavalāhakagajjanaṃ.
A celestial drum is the rumbling of dry clouds.
Devadudrabhī là tiếng sấm của những đám mây khô.
Uggamananti udayanaṃ.
Rising is emergence.
Uggamana là sự mọc lên.
Okkamananti atthaṅgamanaṃ.
Setting is disappearance.
Okkamana là sự lặn xuống.
Saṃkilesanti avisuddhatā.
Defilement is impurity.
Saṃkilesa là sự không thanh tịnh.
Vodānanti visuddhatā.
Purification is purity.
Vodāna là sự thanh tịnh.
Evaṃ vipākoti lokassa evaṃ vividhasukhadukkhāvaho.
“Such will be the result” means it will bring various kinds of happiness and suffering to the world in this way.
Evaṃ vipāko là mang lại nhiều loại khổ vui như vậy cho thế gian.
25. Suvuṭṭhikāti devassa sammādhārānuppavecchanaṃ.
25. Good rainfall is the proper showering down of rain by the devas.
25. Suvuṭṭhikā là việc mưa rơi đều đặn.
Dubbuṭṭhikāti avaggāho, vassavibandhoti vuttaṃ hoti.
Bad rainfall is a drought; it means a withholding of rain.
Dubbuṭṭhikā là hạn hán, tức là sự ngưng trệ của mưa.
Muddāti hatthamuddā.
Muddā is hand-reckoning.
Muddā là thuật tính toán bằng ngón tay.
Gaṇanā vuccati acchiddakagaṇanā.
Gaṇanā is called unbroken counting.
Gaṇanā được gọi là phép tính không gián đoạn.
Saṅkhānanti saṅkalanasaṭuppādanādivasena piṇḍagaṇanā.
Saṅkhāna is calculation in bulk by way of addition, subtraction, and so on.
Saṅkhāna là phép tính tổng hợp, dựa trên việc cộng, trừ, v.v.
Yassa sā paguṇā hoti, so rukkhampi disvā ettakāni ettha paṇṇānīti jānāti.
One who is skilled in this knows, even upon seeing a tree, “There are this many leaves on it.”
Người nào thành thạo phép tính đó, dù nhìn một cái cây cũng biết được có bao nhiêu lá trên đó.
Kāveyyanti ‘‘cattārome, bhikkhave, kavī.
Kāveyya is the composition of poetry for the sake of a livelihood, based on one of four kinds of poets: “Monks, there are these four kinds of poets.
Kāveyya (thi ca) là: “Này các Tỳ-khưu, có bốn loại thi sĩ.
Katame cattāro?
What four?
Bốn loại nào?
Cintākavi, sutakavi, atthakavi, paṭibhānakavī’’ti (a. ni. 4.231).
The poet of imagination, the poet of tradition, the poet of meaning, and the poet of improvisation”
Thi sĩ tư duy, thi sĩ học hỏi, thi sĩ ý nghĩa, thi sĩ ứng khẩu” (A.N. 4.231).
Imesaṃ catunnaṃ kavīnaṃ attano cintāvasena vā; ‘‘vessantaro nāma rājā ahosī’’tiādīni sutvā sutavasena vā; imassa ayaṃ attho, evaṃ taṃ yojessāmīti evaṃ atthavasena vā; kiñcideva disvā tappaṭibhāgaṃ kattabbaṃ karissāmīti evaṃ ṭhānuppattikapaṭibhānavasena vā; jīvikatthāya kabyakaraṇaṃ.
This is based on one’s own imagination; or on tradition after hearing things like “There was a king named Vessantara”; or on meaning, thinking, “This is the meaning of this; I will arrange it thus”; or on spontaneous inspiration, thinking, “Having seen something, I will create a corresponding composition.”
Đó là việc làm thơ để mưu sinh, tùy theo tư duy của mình; hoặc do nghe những câu chuyện như “Có một vị vua tên là Vessantara”; hoặc theo ý nghĩa, như “Ý nghĩa của từ này là thế này, ta sẽ áp dụng nó như thế này”; hoặc do ứng khẩu, như “Khi thấy điều gì đó, ta sẽ làm điều tương ứng”.
Lokāyataṃ vuttameva.
Lokāyata has already been explained.
Lokāyata đã được giải thích rồi.
26. Āvāhanaṃ nāma imassa dārakassa asukakulato asukanakkhattena dārikaṃ ānethāti āvāhakaraṇaṃ.
26. Āvāhana is the act of bringing a bride, saying, “Bring a girl from such-and-such a family for this boy under such-and-such a constellation.”
26. Āvāhana là việc tổ chức cưới hỏi, chẳng hạn như: “Hãy đón con gái từ gia đình đó về cho con trai này vào ngày sao đó”.
Vivāhananti imaṃ dārikaṃ asukassa nāma dārakassa asukanakkhattena detha, evamassā vuḍḍhi bhavissatīti vivāhakaraṇaṃ.
Vivāhana is the act of giving a bride, saying, “Give this girl to the boy named So-and-so under such-and-such a constellation; thus she will prosper.”
Vivāhana là việc gả con gái, chẳng hạn như: “Hãy gả con gái này cho con trai tên là đó vào ngày sao đó, như vậy con bé sẽ được thịnh vượng”.
Saṃvaraṇanti saṃvaraṇaṃ nāma ‘ajja nakkhattaṃ sundaraṃ, ajjeva samaggā hotha, iti vo viyogo na bhavissatī’ti evaṃ samaggakaraṇaṃ.
Saṃvaraṇa, called uniting, is the act of bringing people together, saying, ‘Today the constellation is favorable; unite today, and you will not be separated.’
Saṃvaraṇa là việc hòa hợp, chẳng hạn như: “Hôm nay là ngày tốt, hãy hòa hợp ngay hôm nay, như vậy các con sẽ không chia lìa”.
Vivaraṇaṃ nāma ‘sace viyujjitukāmattha, ajjeva viyujjatha, iti vo puna saṃyogo na bhavissatī’ti evaṃ visaṃyogakaraṇaṃ.
Vivaraṇa, called separating, is the act of causing separation, saying, ‘If you wish to separate, separate today, and you will not be reunited.’
Vivaraṇa là việc chia lìa, chẳng hạn như: “Nếu các con muốn chia lìa, hãy chia lìa ngay hôm nay, như vậy các con sẽ không tái hợp nữa”.
Saṅkiraṇanti ‘uṭṭhānaṃ vā iṇaṃ vā dinnaṃ dhanaṃ ajja saṅkaḍḍhatha, ajja saṅkaḍḍhitañhi taṃ thāvaraṃ hotī’ti evaṃ dhanapiṇḍāpanaṃ.
Saṅkiraṇa is causing wealth to be amassed, saying, ‘Collect today the wealth that has been invested or lent; for what is collected today will be secure.’
Saṅkiraṇa là việc thu gom tài sản, chẳng hạn như: “Hôm nay hãy thu gom thuế má hoặc tiền đã cho vay, vì tài sản được thu gom hôm nay sẽ vững chắc”.
Vikiraṇanti ‘sace payogauddhārādivasena dhanaṃ payojitukāmattha, ajja payojitaṃ diguṇacatugguṇaṃ hotī’ti evaṃ dhanapayojāpanaṃ.
Vikiraṇa is causing wealth to be dispersed, saying, ‘If you wish to invest wealth through ventures, loans, and so on, what is invested today will become double or quadruple.’
Vikiraṇa là việc đầu tư tài sản, chẳng hạn như: “Nếu các con muốn đầu tư tài sản để sinh lời hoặc rút vốn, thì việc đầu tư hôm nay sẽ sinh lời gấp đôi, gấp bốn”.
Subhagakaraṇanti piyamanāpakaraṇaṃ vā sassirīkakaraṇaṃ vā.
Subhagakaraṇa is making one beloved and pleasing, or making one glorious.
Subhagakaraṇa là việc tạo ra sự yêu mến, dễ thương hoặc tạo ra sự may mắn, thịnh vượng.
Dubbhagakaraṇanti tabbiparītaṃ.
Dubbhagakaraṇa is the opposite of that.
Dubbhagakaraṇa là điều ngược lại.
Viruddhagabbhakaraṇanti viruddhassa vilīnassa aṭṭhitassa matassa gabbhassa karaṇaṃ.
Viruddhagabbhakaraṇa is the stabilization of a contrary, dissolved, unstable, or dead fetus.
Viruddhagabbhakaraṇa là việc làm cho thai nhi bị sai lệch, tiêu tan, không phát triển hoặc chết.
Puna avināsāya bhesajjadānanti attho.
The meaning is the giving of medicine for its non-destruction.
Có nghĩa là việc cho thuốc để tránh sự hư hại một lần nữa.
Gabbho hi vātena, pāṇakehi, kammunā cāti tīhi kāraṇehi vinassati.
For a fetus is destroyed by three causes: by wind, by small creatures, and by kamma.
Thai nhi bị hư hại do ba nguyên nhân: do gió, do vi khuẩn, và do nghiệp.
Tattha vātena vinassante nibbāpanīyaṃ sītalaṃ bhesajjaṃ deti, pāṇakehi vinassante pāṇakānaṃ paṭikammaṃ karoti, kammunā vinassante pana buddhāpi paṭibāhituṃ na sakkonti.
Therein, when it is being destroyed by wind, one gives cooling, calming medicine; when it is being destroyed by small creatures, one treats the small creatures; but when it is being destroyed by kamma, not even Buddhas are able to prevent it.
Trong đó, khi thai nhi bị hư hại do gió, người ta cho thuốc mát để làm dịu; khi bị hư hại do vi khuẩn, người ta chữa trị vi khuẩn; nhưng khi bị hư hại do nghiệp, ngay cả chư Phật cũng không thể ngăn cản được.
Jivhānibandhananti mantena jivhāya bandhakaraṇaṃ.
Jivhānibandhana is the binding of the tongue with a mantra.
Jivhānibandhana là việc dùng thần chú để buộc lưỡi.
Hanusaṃhanananti mukhabandhamantena yathā hanukaṃ cāletuṃ na sakkonti, evaṃ bandhakaraṇaṃ.
Hanusaṃhanana is the binding of the jaw with a mouth-sealing mantra so that they cannot move it.
Hanusaṃhanana là việc dùng thần chú buộc miệng để không thể cử động hàm.
Hatthābhijappananti hatthānaṃ parivattanatthaṃ mantajappanaṃ.
Hatthābhijappana is the chanting of a mantra for paralyzing the hands.
Hatthābhijappana là việc niệm chú để tay có thể xoay chuyển.
Tasmiṃ kira mante sattapadantare ṭhatvā jappite itaro hatthe parivattetvā khipati.
They say that when this mantra is chanted while standing seven paces apart, the other person turns their hands and throws them.
Khi chú thuật đó được niệm trong vòng bảy bước chân, người kia liền xoay tay ném đi.
Kaṇṇajappananti kaṇṇehi saddaṃ assavanatthāya vijjāya jappanaṃ.
Kaṇṇajappana means whispering spells into the ears so that no sound is heard.
Kaṇṇajappana (thì thầm vào tai) là niệm chú để không nghe thấy tiếng bằng tai.
Taṃ kira jappitvā vinicchayaṭṭhāne yaṃ icchati, taṃ bhaṇati, paccatthiko taṃ na suṇāti, tato paṭivacanaṃ sampādetuṃ na sakkoti.
Having charmed that, one speaks what one desires at the place of judgment; the opponent, it is said, does not hear it, and therefore is unable to give a reply.
Sau khi niệm chú đó, tại nơi xét xử, người ta nói điều mình muốn, đối thủ không nghe thấy điều đó, và do đó không thể đưa ra lời đáp lại.
Ādāsapañhanti ādāse devataṃ otāretvā pañhapucchanaṃ.
Mirror-questioning means causing a deity to descend into a mirror and asking questions.
Ādāsapañha (hỏi gương) là triệu mời thiên thần vào gương rồi hỏi các vấn đề.
Kumārikapañhanti kumārikāya sarīre devataṃ otāretvā pañhapucchanaṃ.
Maiden-questioning means causing a deity to descend into a maiden's body and asking questions.
Kumārikapañha (hỏi thiếu nữ) là triệu mời thiên thần vào thân thiếu nữ rồi hỏi các vấn đề.
Devapañhanti dāsiyā sarīre devataṃ otāretvā pañhapucchanaṃ.
Deity-questioning means causing a deity to descend into a slave girl's body and asking questions.
Devapañha (hỏi nữ thần) là triệu mời thiên thần vào thân nữ tỳ rồi hỏi các vấn đề.
Ādiccupaṭṭhānanti jīvikatthāya ādiccapāricariyā.
Worship of the sun means the service of the sun for livelihood.
Ādiccupaṭṭhāna (phụng sự mặt trời) là thờ phụng mặt trời để kiếm sống.
Mahatupaṭṭhānanti tatheva mahābrahmapāricariyā.
Worship of the great means similarly the service of Mahābrahmā.
Mahatupaṭṭhāna (phụng sự đại phạm thiên) cũng tương tự là thờ phụng Đại Phạm Thiên.
Abbhujjalananti mantena mukhato aggijālānīharaṇaṃ.
Making fire blaze up means causing flames of fire to issue from the mouth by means of a charm.
Abbhujjalana (phun lửa) là dùng thần chú để phun lửa ra từ miệng.
Sirivhāyananti ‘‘ehi siri, mayhaṃ sire patiṭṭhāhī’’ti evaṃ sirena siriyā avhāyanaṃ.
Calling forth good fortune means calling forth good fortune to one's head, saying, "Come, Siri, settle upon my head!"
Sirivhāyana (triệu thỉnh tài lộc) là triệu thỉnh tài lộc bằng cách nói: “Hỡi tài lộc, hãy đến và an trú trên đầu ta!”
27. Santikammanti devaṭṭhānaṃ gantvā sace me idaṃ nāma samijjhissati, tumhākaṃ iminā ca iminā ca upahāraṃ karissāmīti samiddhikāle kattabbaṃ santipaṭissavakammaṃ.
27. Promissory ritual means going to the shrine of a deity and vowing, "If this desired thing comes to pass for me, I will make this and that offering to you," which is a promise to be fulfilled upon the attainment of success.
27. Santikamma (lễ cầu an) là việc hứa nguyện cúng dường khi đến đền thờ thần và nói: “Nếu điều này thành tựu cho tôi, tôi sẽ cúng dường quý vị vật này và vật kia.”
Tasmiṃ pana samiddhe tassa karaṇaṃ paṇidhikammaṃ nāma.
Performing that offering upon its attainment is called vowed ritual.
Khi điều đó thành tựu, việc thực hiện lời hứa đó được gọi là paṇidhikamma (lễ hứa nguyện).
Bhūrikammanti bhūrighare vasitvā gahitamantassa payogakaraṇaṃ.
Earth-ritual means the performance of a ritual after having stayed in an underground chamber and learned a charm.
Bhūrikamma (lễ địa thần) là việc thực hành thần chú đã học được khi sống trong nhà đất.
Vassakammaṃ vossakammanti ettha vassoti puriso, vossoti paṇḍako.
Vassakamma or vossakamma: here, vassa means a man, vossa means an eunuch.
Vassakammaṃ vossakamma (biến đổi giới tính): Ở đây, vassa là đàn ông, vossa là hoạn nhân.
Iti vossassa vassakaraṇaṃ vassakammaṃ, vassassa vossakaraṇaṃ vossakammaṃ.
Thus, making an eunuch into a man is vassakamma, and making a man into an eunuch is vossakamma.
Như vậy, việc biến hoạn nhân thành đàn ông là vassakamma, việc biến đàn ông thành hoạn nhân là vossakamma.
Taṃ pana karonto acchandikabhāvamattaṃ pāpeti, na liṅgaṃ antaradhāpetuṃ sakkoti.
One who performs this can only cause a lack of desire, but cannot change the sexual characteristic.
Tuy nhiên, khi làm điều đó, người ta chỉ có thể khiến đối tượng không còn ham muốn, chứ không thể làm biến mất giới tính.
Vatthukammanti akatavatthusmiṃ gehapatiṭṭhāpanaṃ.
Ground-ritual means establishing a house on an undeveloped plot of land.
Vatthukamma (lễ đặt nền nhà) là việc đặt nền nhà trên mảnh đất chưa xây dựng.
Vatthuparikammanti ‘‘idañcidañcāharathā’’ti vatvā vatthubalikammakaraṇaṃ.
Ground-preparation ritual means performing an offering ritual for the ground, saying, "Bring these and these things."
Vatthuparikamma (lễ cúng dường đất đai) là việc cúng dường đất đai bằng cách nói: “Hãy mang đến vật này, vật này!”
Ācamananti udakena mukhasuddhikaraṇaṃ.
Rinsing means purifying the mouth with water.
Ācamana (súc miệng) là việc làm sạch miệng bằng nước.
Nhāpananti aññesaṃ nhāpanaṃ.
Bathing means bathing others.
Nhāpana (tắm rửa) là việc tắm rửa cho người khác.
Juhananti tesaṃ atthāya aggijuhanaṃ.
Offering into fire means offering into fire for their sake.
Juhana (tế lửa) là việc tế lửa vì lợi ích của họ.
Vamananti yogaṃ datvā vamanakaraṇaṃ.
Vomiting means inducing vomiting by administering an emetic.
Vamana (gây nôn) là việc gây nôn bằng cách cho uống thuốc.
Virecanepi eseva nayo.
The same method applies to purging.
Đối với virecana (tẩy xổ) cũng theo cách tương tự.
Uddhaṃvirecananti uddhaṃ dosānaṃ nīharaṇaṃ.
Upward purging means expelling impurities upwards.
Uddhaṃvirecana (tẩy xổ thượng bộ) là việc loại bỏ các chất độc từ phía trên.
Adhovirecananti adho dosānaṃ nīharaṇaṃ.
Downward purging means expelling impurities downwards.
Adhovirecana (tẩy xổ hạ bộ) là việc loại bỏ các chất độc từ phía dưới.
Sīsavirecananti sirovirecanaṃ.
Head purging means purging from the head.
Sīsavirecana (tẩy xổ đầu) là việc tẩy xổ đầu.
Kaṇṇatelanti kaṇṇānaṃ bandhanatthaṃ vā vaṇaharaṇatthaṃ vā bhesajjatelapacanaṃ.
Ear oil means preparing medicinal oil for binding the ears or removing ear diseases.
Kaṇṇatela (dầu tai) là việc nấu dầu thuốc để băng tai hoặc chữa lành vết thương ở tai.
Nettatappananti akkhitappanatelaṃ.
Eye soothing means oil for soothing the eyes.
Nettatappana (dầu nhỏ mắt) là dầu nhỏ mắt làm dịu mắt.
Natthukammanti telena yojetvā natthukaraṇaṃ.
Nasal treatment means performing nasal treatment by administering oil.
Natthukamma (thuốc nhỏ mũi) là việc nhỏ mũi bằng cách dùng dầu.
Añjananti dve vā tīṇi vā paṭalāni nīharaṇasamatthaṃ khārañjanaṃ.
Collyrium means alkaline collyrium capable of removing two or three eye membranes.
Añjana (thuốc nhỏ mắt) là thuốc nhỏ mắt có tính kiềm, có khả năng loại bỏ hai hoặc ba lớp màng mắt.
Paccañjananti nibbāpanīyaṃ sītalabhesajjañjanaṃ.
Counter-collyrium means cooling medicinal collyrium for extinguishing heat.
Paccañjana (thuốc nhỏ mắt làm dịu) là thuốc nhỏ mắt mát lành có tính làm dịu.
Sālākiyanti salākavejjakammaṃ.
Surgery with a probe means the medical practice of a probe-surgeon.
Sālākiya (y học châm cứu) là nghề y dùng que kim.
Sallakattiyanti sallakattavejjakammaṃ.
General surgery means the medical practice of a surgeon.
Sallakattiya (y học phẫu thuật) là nghề y phẫu thuật.
Dārakatikicchā vuccati komārabhaccavejjakammaṃ.
Child healing is called the medical practice of a pediatrician.
Dārakatikicchā được gọi là y học nhi khoa.
Mūlabhesajjānaṃ anuppādananti iminā kāyatikicchanaṃ dasseti.
Administering fundamental medicines indicates the treatment of the body by this means.
Mūlabhesajjānaṃ anuppādana (cung cấp thuốc gốc) bằng cách này cho thấy việc chữa bệnh thân thể.
Osadhīnaṃ paṭimokkhoti khārādīni datvā tadanurūpe vaṇe gate tesaṃ apanayanaṃ.
Removal of medicines means removing those medicines after the wounds corresponding to the administered alkalis, etc., have healed.
Osadhīnaṃ paṭimokkho (tháo băng thuốc) là việc loại bỏ các loại thuốc sau khi đã dùng kiềm và các chất khác, và các vết thương đã lành tương ứng.
28. Evaṃ brahmadattena vuttavaṇṇassa anusandhivasena tividhaṃ sīlaṃ vitthāretvā idāni bhikkhusaṅghena vuttavaṇṇassa anusandhivasena – ‘‘atthi, bhikkhave, aññeva dhammā gambhīrā duddasā’’tiādinā nayena suññatāpakāsanaṃ ārabhi.
Having thus elaborated the threefold Sīla in connection with the qualities spoken of by Brahmadatta, now, in connection with the qualities spoken of by the Saṅgha of bhikkhus, the exposition of emptiness begins with the phrase "There are, bhikkhus, other teachings, profound, hard to see," and so forth.
Như vậy, sau khi đã giải thích chi tiết về ba loại giới luật theo cách mô tả của Brahmadatta, bây giờ, theo cách mô tả của Tăng đoàn, Đức Phật bắt đầu tuyên bố về Tánh Không với câu: “Này các tỳ-khưu, có những pháp khác sâu xa, khó thấy,” v.v.
Tattha dhammāti guṇe, desanāyaṃ, pariyattiyaṃ, nissatteti evamādīsu dhammasaddo vattati.
Here, the word dhammā is used in the sense of qualities, teaching, study, non-self, and so forth.
Trong đó, từ dhammā (pháp) được dùng với các nghĩa như phẩm chất, giáo pháp, học tập, vô ngã, v.v.
Ādīsu hi guṇe dhammasaddo.
In these examples, the word dhamma refers to qualities.
Ở đây, từ pháp có nghĩa là phẩm chất.
‘‘Dhammaṃ, vo bhikkhave, desessāmi ādikalyāṇa’’ntiādīsu (ma. ni. 3.420) desanāyaṃ.
In "Bhikkhus, I shall teach you the Dhamma, beautiful in the beginning," and so forth, it refers to the teaching.
Trong các câu như: “Này các tỳ-khưu, Ta sẽ thuyết pháp cho các con, đẹp ở đoạn đầu,” v.v., từ pháp có nghĩa là giáo pháp.
‘‘Idha bhikkhu dhammaṃ pariyāpuṇāti suttaṃ, geyya’’ntiādīsu (a. ni. 5.73) pariyattiyaṃ.
In "Here, a bhikkhu studies the Dhamma: suttas, geyyas," and so forth, it refers to study.
Trong các câu như: “Ở đây, một tỳ-khưu học tập pháp, kinh, kệ,” v.v., từ pháp có nghĩa là học tập.
‘‘Tasmiṃ kho pana samaye dhammā honti, khandhā hontī’’tiādīsu (dha. sa. 121) nissatte.
In "At that time, there are dhammas, there are aggregates," and so forth, it refers to non-self.
Trong các câu như: “Vào thời điểm đó, có các pháp, có các uẩn,” v.v., từ pháp có nghĩa là vô ngã.
Idha pana guṇe vattati.
Here, however, it refers to qualities.
Ở đây, nó có nghĩa là phẩm chất.
Tasmā atthi, bhikkhave, aññeva tathāgatassa guṇāti evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as: "Bhikkhus, there are other qualities of the Tathāgata."
Vì vậy, ý nghĩa ở đây cần được hiểu là: “Này các tỳ-khưu, Thế Tôn còn có những phẩm chất khác.”
Gambhīrāti mahāsamuddo viya makasatuṇḍasūciyā aññatra tathāgatā aññesaṃ ñāṇena alabbhaneyyapatiṭṭhā, gambhīrattāyeva duddasā. Duddasattāyeva duranubodhā. Nibbutasabbapariḷāhattā santā, santārammaṇesu pavattanatopi santā.
Profound means, like the great ocean, a foundation not to be attained by the knowledge of others apart from the Tathāgata, like a mosquito's proboscis-needle; precisely because of its profundity, it is hard to see. Precisely because it is hard to see, it is hard to fathom. Because all fevers are extinguished, it is calm; also calm because it proceeds upon calm objects.
Gambhīrā (sâu xa) có nghĩa là nền tảng không thể đạt được bằng trí tuệ của người khác ngoài Như Lai, giống như đại dương sâu thẳm mà kim miệng muỗi không thể chạm tới. Do sâu xa nên duddasā (khó thấy).
Atittikaraṇaṭṭhena paṇītā, sādurasabhojanaṃ viya.
It is sublime in the sense that it never satisfies, like delicious food.
Do khó thấy nên duranubodhā (khó thấu hiểu). Do mọi phiền não đã được dập tắt nên santā (an tịnh), và cũng an tịnh vì chúng vận hành trên các đối tượng an tịnh.
Uttamañāṇavisayattā na takkena avacaritabbāti atakkāvacarā.
Because it is the domain of supreme knowledge, it is not to be explored by mere reasoning; hence, it is beyond the reach of reason.
Paṇītā (vi diệu) theo nghĩa là không gây nhàm chán, giống như món ăn ngon.
Nipuṇāti saṇhasukhumasabhāvattā.
Subtle means because of its fine and delicate nature.
Vì là đối tượng của trí tuệ tối thượng nên không thể suy luận bằng lý trí, do đó là atakkāvacarā (vượt ngoài tầm suy luận).
Bālānaṃ avisayattā, paṇḍitehiyeva veditabbāti paṇḍitavedanīyā.
Because it is not the domain of the foolish, and is to be known only by the wise, it is to be realized by the wise.
Nipuṇā (tinh tế) vì bản chất vi tế và mỏng manh. Do không phải là đối tượng của kẻ ngu si, mà chỉ có người trí mới có thể biết được, nên là paṇḍitavedanīyā (chỉ người trí mới có thể cảm nhận).
Ye tathāgato sayaṃ abhiññā sacchikatvā pavedetīti ye dhamme tathāgato anaññaneyyo hutvā sayameva abhivisiṭṭhena ñāṇena paccakkhaṃ katvā pavedeti, dīpeti, katheti, pakāsetīti attho.
"Which the Tathāgata himself has realized through direct knowledge and proclaimed" means those qualities that the Tathāgata, not taught by others, has himself directly known with supreme knowledge and has proclaimed, illuminated, taught, and revealed.
Ye tathāgato sayaṃ abhiññā sacchikatvā pavedetī (mà Như Lai tự mình chứng ngộ và tuyên bố) có nghĩa là những pháp mà Như Lai tự mình chứng ngộ bằng trí tuệ siêu việt, không cần ai chỉ dạy, rồi tuyên bố, giảng giải, nói ra, làm sáng tỏ.
Yehīti yehi guṇadhammehi.
"By which" refers to those qualities (of Dhamma).
Yehī (bằng những) có nghĩa là bằng những phẩm chất pháp nào.
Yathābhuccanti yathābhūtaṃ.
"Truthfully" means as it truly is.
Yathābhuccaṃ (chân thật) có nghĩa là đúng như thực.
Vaṇṇaṃ sammā vadamānā vadeyyunti tathāgatassa vaṇṇaṃ vattukāmā sammā vadeyyuṃ, ahāpetvā vattuṃ sakkuṇeyyunti attho.
"They would speak the praise correctly" means those who wish to speak the praise of the Tathāgata would speak correctly, meaning they would be able to speak without omission.
Vaṇṇaṃ sammā vadamānā vadeyyuṃ (những ai muốn ca ngợi sẽ ca ngợi một cách đúng đắn) có nghĩa là những người muốn ca ngợi phẩm chất của Như Lai sẽ ca ngợi một cách đúng đắn, không bỏ sót điều gì.
Katame ca pana te dhammā bhagavatā evaṃ thomitāti?
"And what, bhikkhus, are these dhammas praised thus by the Blessed One?"
Vậy những pháp nào đã được Đức Thế Tôn tán thán như vậy?
Sabbaññutaññāṇaṃ.
Omniscient knowledge (sabbaññutaññāṇa).
Đó là Trí Toàn Tri (Sabbaññutaññāṇa).
Yadi evaṃ, kasmā bahuvacananiddeso katoti?
If so, why is the plural form used?
Nếu vậy, tại sao lại dùng số nhiều?
Puthucittasamāyogato ceva, puthuārammaṇato ca.
Because of its association with diverse minds and its diverse objects.
Là do sự kết hợp của nhiều tâm và do nhiều đối tượng.
Tañhi catūsu ñāṇasampayuttamahākiriyacittesu labbhati, na cassa koci dhammo ārammaṇaṃ nāma na hoti.
For it is found in the four great functional consciousnesses associated with knowledge, and there is no dhamma that is not its object.
Trí ấy được tìm thấy trong bốn tâm đại thiện tương ưng với trí, và không có pháp nào mà không phải là đối tượng của nó.
Yathāha – ‘‘atītaṃ sabbaṃ jānātīti sabbaññutaññāṇaṃ, tattha āvaraṇaṃ natthīti anāvaraṇañāṇa’’ntiādi (paṭi. ma. 1.120).
As it is said: "Knowledge that knows all past things is omniscient knowledge; there is no obstruction therein, hence it is unobstructed knowledge," and so forth.
Như đã nói: “Trí biết tất cả quá khứ là Trí Toàn Tri, không có chướng ngại ở đó là Trí Vô Chướng Ngại,” v.v.
Iti puthucittasamāyogato punappunaṃ uppattivasena puthuārammaṇato ca bahuvacananiddeso katoti.
Thus, the plural form is used due to its association with diverse minds and its repeated occurrence with diverse objects.
Như vậy, việc dùng số nhiều là do sự kết hợp của nhiều tâm và do sự tái diễn của nhiều đối tượng.
‘‘Aññevā’’ti idaṃ panettha vavatthāpanavacanaṃ, ‘‘aññeva, na pāṇātipātā veramaṇiādayo.
The word "aññeva" here is a specifying term, meaning "other, not abstinence from killing living beings, etc."
Từ “ Aññevā” (khác) ở đây là một từ xác định, có nghĩa là “khác, không phải là sự kiêng cữ sát sinh, v.v.
Gambhīrāva na uttānā’’ti evaṃ sabbapadehi yojetabbaṃ.
"Profound indeed, not superficial," thus it should be connected with all terms.
Sâu xa chứ không phải nông cạn,” v.v., phải được ghép với tất cả các từ.
Sāvakapāramīñāṇañhi gambhīraṃ, paccekabodhiñāṇaṃ pana tato gambhīrataranti tattha vavatthānaṃ natthi, sabbaññutaññāṇañca tatopi gambhīrataranti tatthāpi vavatthānaṃ natthi, ito panaññaṃ gambhīrataraṃ natthi; tasmā gambhīrā vāti vavatthānaṃ labbhati.
For the knowledge of a disciple's perfections is profound, but the knowledge of a Paccekabuddha is more profound than that, so there is no specification there. And the knowledge of omniscience is even more profound than that, so there is also no specification there. However, there is nothing more profound than this; therefore, the specification "profound indeed" is obtained.
Trí tuệ Ba-la-mật của Thanh văn tuy sâu xa, nhưng trí tuệ Độc Giác Phật còn sâu xa hơn, nên không có sự xác định tuyệt đối ở đó. Trí tuệ Toàn Tri còn sâu xa hơn cả trí tuệ Độc Giác Phật, nên cũng không có sự xác định tuyệt đối ở đó. Tuy nhiên, không có trí tuệ nào sâu xa hơn trí tuệ này; vì vậy, có thể xác định là “sâu xa.”
Tathā duddasāva duranubodhā vāti sabbaṃ veditabbaṃ.
Similarly, "hard to see indeed, hard to fathom indeed," all should be understood.
Tương tự, tất cả các từ như “khó thấy” và “khó thấu hiểu” cũng phải được hiểu như vậy.
Katame ca te bhikkhaveti ayaṃ pana tesaṃ dhammānaṃ kathetukamyatā pucchā.
"What are they, bhikkhus?" This is a question expressing the desire to speak of those dhammas.
Câu Katame ca te bhikkhave (Và này các tỳ-khưu, những pháp ấy là gì) là câu hỏi thể hiện mong muốn được nghe về những pháp ấy.
Santi, bhikkhave, eke samaṇabrāhmaṇātiādi pucchāvissajjanaṃ.
"There are, bhikkhus, some ascetics and brahmins," and so forth, is the answer to the question.
Santi, bhikkhave, eke samaṇabrāhmaṇā (Này các tỳ-khưu, có một số sa-môn và bà-la-môn) v.v., là câu trả lời cho câu hỏi.
Kasmā panetaṃ evaṃ āraddhanti ce?
"But why was this thus introduced?"
Nếu hỏi: "Vì sao điều này được khởi xướng như vậy?"
Buddhānañhi cattāri ṭhānāni patvā gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati, buddhañāṇassa mahantabhāvo paññāyati, desanā gambhīrā hoti, tilakkhaṇāhatā, suññatāpaṭisaṃyuttā.
Indeed, for the Buddhas, having reached four stations, the roar is mighty, knowledge penetrates, the greatness of the Buddha's knowledge is revealed, and the teaching is profound, stamped with the three characteristics, and associated with emptiness.
Khi chư Phật đạt đến bốn điểm này, tiếng rống (giáo pháp) trở nên vĩ đại, tuệ giác thâm nhập, sự vĩ đại của Phật tuệ được hiển lộ, giáo pháp trở nên sâu sắc, được ấn chứng bằng ba đặc tướng (tilakkhaṇa), và liên hệ đến tánh không (suññatā).
Katamāni cattāri?
Which are the four?
Bốn điều nào?
Vinayapaññattiṃ, bhūmantaraṃ, paccayākāraṃ, samayantaranti.
The promulgation of the Vinaya, the distinction of planes, the modes of conditionality, and the distinction of views.
Đó là: sự chế định giới luật (Vinayapaññatti), sự phân biệt các cõi (bhūmantara), các phương thức duyên khởi (paccayākāra), và các tà kiến khác (samayantara).
Tasmā – ‘‘idaṃ lahukaṃ, idaṃ garukaṃ, idaṃ satekicchaṃ, idaṃ atekicchaṃ, ayaṃ āpatti, ayaṃ anāpatti, ayaṃ chejjagāminī, ayaṃ vuṭṭhānagāminī, ayaṃ desanāgāminī, ayaṃ lokavajjā, ayaṃ paṇṇattivajjā, imasmiṃ vatthusmiṃ idaṃ paññapetabba’’nti yaṃ evaṃ otiṇṇe vatthusmiṃ sikkhāpadapaññāpanaṃ nāma, tattha aññesaṃ thāmo vā balaṃ vā natthi; avisayo esa aññesaṃ, tathāgatasseva visayo.
Therefore, concerning a matter that has thus arisen—"This is a minor offense, this is a grave offense, this is remediable, this is irremediable, this is an offense, this is not an offense, this leads to expulsion, this leads to rehabilitation, this leads to confession, this is blameworthy by the world, this is blameworthy by rule, in this matter this should be laid down"—the promulgation of a training rule in such a case, for others there is no power or strength; this is not the domain of others, but solely the domain of the Tathāgata.
Vì vậy, việc chế định các học giới (sikkhāpada) khi một sự việc xảy ra, như: "Điều này nhẹ, điều này nặng, điều này có thể sửa chữa, điều này không thể sửa chữa, đây là một lỗi (āpatti), đây là không lỗi (anāpatti), lỗi này dẫn đến sự đoạn diệt (chejjagāminī), lỗi này dẫn đến sự phục hồi (vuṭṭhānagāminī), lỗi này dẫn đến sự sám hối (desanāgāminī), lỗi này bị thế gian chỉ trích (lokavajjā), lỗi này bị giới luật chỉ trích (paṇṇattivajjā), trong trường hợp này, điều này nên được chế định"—thì không ai khác có sức mạnh hay năng lực để làm điều đó; đây là phạm vi không thuộc về người khác, mà chỉ thuộc về Như Lai.
Iti vinayapaññattiṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Thus, having reached the promulgation of the Vinaya, the roar of the Buddhas is mighty, knowledge penetrates... and is associated with emptiness.
Như vậy, khi đạt đến sự chế định giới luật, tiếng rống (giáo pháp) của chư Phật trở nên vĩ đại, tuệ giác thâm nhập... liên hệ đến tánh không.
Tathā ime cattāro satipaṭṭhānā nāma…pe… ariyo aṭṭhaṅgiko maggo nāma, pañca khandhā nāma, dvādasa āyatanāni nāma, aṭṭhārasa dhātuyo nāma, cattāri ariyasaccāni nāma, bāvīsatindriyāni nāma, nava hetū nāma, cattāro āhārā nāma, satta phassā nāma, satta vedanā nāma, satta saññā nāma, satta cetanā nāma, satta cittāni nāma.
Similarly, these are the four foundations of mindfulness... and the Noble Eightfold Path, the five aggregates, the twelve sense bases, the eighteen elements, the four Noble Truths, the twenty-two faculties, the nine causes, the four nutriments, the seven contacts, the seven feelings, the seven perceptions, the seven volitions, the seven consciousnesses.
Tương tự, không ai khác có sức mạnh hay năng lực để phân tích và thuyết giảng Abhidhamma Piṭaka vô tận với hai mươi bốn phương pháp (catuvīsatisamantapaṭṭhānaṃ), như: bốn niệm xứ (satipaṭṭhāna), Bát Chánh Đạo (ariyo aṭṭhaṅgiko maggo), năm uẩn (pañca khandhā), mười hai xứ (dvādasa āyatanāni), mười tám giới (aṭṭhārasa dhātuyo), bốn Thánh đế (cattāri ariyasaccāni), hai mươi hai căn (bāvīsatindriyāni), chín nhân (nava hetū), bốn món ăn (cattāro āhārā), bảy xúc (satta phassā), bảy thọ (satta vedanā), bảy tưởng (satta saññā), bảy tư (satta cetanā), bảy tâm (satta cittāni).
Etesu ettakā kāmāvacarā dhammā nāma, ettakā rūpāvacaraarūpāvacarapariyāpannā dhammā nāma, ettakā lokiyā dhammā nāma, ettakā lokuttarā dhammā nāmāti catuvīsatisamantapaṭṭhānaṃ anantanayaṃ abhidhammapiṭakaṃ vibhajitvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo.
Among these, how many are dhammas of the kāma-loka, how many are dhammas included in the rūpa-loka and arūpa-loka, how many are mundane dhammas, how many are supramundane dhammas – to analyze and teach this Abhidhamma Piṭaka with its twenty-fourfold universal conditionality and infinite methods, others have neither the intellect nor the strength; this is not the domain of others, but solely the domain of the Tathāgata.
Và trong những pháp này, bao nhiêu là pháp thuộc Dục giới (kāmāvacarā dhammā), bao nhiêu là pháp thuộc Sắc giới và Vô sắc giới (rūpāvacaraarūpāvacarapariyāpannā dhammā), bao nhiêu là pháp hữu lậu (lokiyā dhammā), bao nhiêu là pháp siêu thế (lokuttarā dhammā)—đây là phạm vi không thuộc về người khác, mà chỉ thuộc về Như Lai.
Iti bhūmantaraparicchedaṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Thus, having reached the distinction of planes, the roar of the Buddhas is mighty, knowledge penetrates... and is associated with emptiness.
Như vậy, khi đạt đến sự phân biệt các cõi, tiếng rống (giáo pháp) của chư Phật trở nên vĩ đại, tuệ giác thâm nhập... liên hệ đến tánh không.
Tathā ayaṃ avijjā saṅkhārānaṃ navahākārehi paccayo hoti, uppādo hutvā paccayo hoti, pavattaṃ hutvā, nimittaṃ, āyūhanaṃ, saṃyogo, palibodho, samudayo, hetu, paccayo hutvā paccayo hoti, tathā saṅkhārādayo viññāṇādīnaṃ.
Similarly, this ignorance is a condition for volitional formations in nine ways: it is a condition by being the origination, by being the continuance, by being the sign, by being the accumulation, by being the conjunction, by being the entanglement, by being the arising, by being the root cause, by being the condition; and similarly, volitional formations and so on are conditions for consciousness and so on.
Tương tự, vô minh (avijjā) là duyên cho các hành (saṅkhārā) theo chín phương cách: là duyên bằng cách phát sinh (uppādo hutvā), bằng cách tiếp diễn (pavattaṃ hutvā), bằng cách tạo dấu hiệu (nimittaṃ), bằng cách thúc đẩy (āyūhanaṃ), bằng cách kết hợp (saṃyogo), bằng cách ràng buộc (palibodho), bằng cách tập khởi (samudayo), bằng cách là nhân (hetu), bằng cách là duyên (paccayo); tương tự, các hành (saṅkhārā) và các pháp khác là duyên cho thức (viññāṇa) và các pháp khác.
Yathāha – ‘‘kathaṃ paccayapariggahe paññā dhammaṭṭhitiñāṇaṃ?
As it is said: “How is the wisdom of discerning conditions the knowledge of the stability of phenomena?
Như đã nói:
Avijjā saṅkhārānaṃ uppādaṭṭhiti ca pavattaṭṭhiti ca, nimittaṭṭhiti ca, āyūhanaṭṭhiti ca, saṃyogaṭṭhiti ca, palibodhaṭṭhiti ca, samudayaṭṭhiti ca, hetuṭṭhiti ca, paccayaṭṭhiti ca, imehi navahākārehi avijjā paccayo, saṅkhārā paccayasamuppannā, ubhopete dhammā paccayasamuppannāti paccayapariggahe paññā dhammaṭṭhitiñāṇaṃ.
Ignorance is the condition of origination and stability for volitional formations, and the condition of continuance and stability, and the condition of the sign and stability, and the condition of accumulation and stability, and the condition of conjunction and stability, and the condition of entanglement and stability, and the condition of arising and stability, and the condition of the root cause and stability, and the condition of the condition and stability—through these nine modes ignorance is the condition, volitional formations are conditionally arisen, and both these phenomena are conditionally arisen. This wisdom in discerning conditions is the knowledge of the stability of phenomena.
"Thế nào là tuệ giác về sự an trú của các pháp (dhammaṭṭhitiñāṇa) trong sự nắm giữ các duyên (paccayapariggahe paññā)? Vô minh là duyên cho các hành theo chín phương cách này: là duyên cho sự phát sinh và an trú, sự tiếp diễn và an trú, sự tạo dấu hiệu và an trú, sự thúc đẩy và an trú, sự kết hợp và an trú, sự ràng buộc và an trú, sự tập khởi và an trú, sự là nhân và an trú, sự là duyên và an trú. Vô minh là duyên, các hành là pháp do duyên sinh, cả hai pháp này đều là pháp do duyên sinh—đây là tuệ giác về sự an trú của các pháp trong sự nắm giữ các duyên.
Atītampi addhānaṃ, anāgatampi addhānaṃ avijjā saṅkhārānaṃ uppādaṭṭhiti ca…pe… jāti jarāmaraṇassa uppādaṭṭhiti ca…pe… paccayaṭṭhiti ca, imehi navahākārehi jāti paccayo, jarāmaraṇaṃ paccayasamuppannaṃ, ubhopete dhammā paccayasamuppannāti paccayapariggahe paññā dhammaṭṭhitiñāṇa’’nti (paṭi. ma. 1.45).
Also in the past period, and also in the future period, ignorance is the condition of origination and stability for volitional formations... and birth is the condition of origination and stability for aging and death... and the condition of the condition and stability—through these nine modes birth is the condition, aging and death are conditionally arisen, and both these phenomena are conditionally arisen. This wisdom in discerning conditions is the knowledge of the stability of phenomena.”
Trong thời quá khứ và trong thời vị lai, vô minh là duyên cho các hành theo sự phát sinh và an trú... sanh là duyên cho già chết theo sự phát sinh và an trú... là duyên và an trú. Sanh là duyên theo chín phương cách này, già chết là pháp do duyên sinh, cả hai pháp này đều là pháp do duyên sinh—đây là tuệ giác về sự an trú của các pháp trong sự nắm giữ các duyên."
Evamimaṃ tassa tassa dhammassa tathā tathā paccayabhāvena pavattaṃ tivaṭṭaṃ tiyaddhaṃ tisandhiṃ catusaṅkhepaṃ vīsatākāraṃ paṭiccasamuppādaṃ vibhajitvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo, iti paccayākāraṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Thus, to analyze and teach this Dependent Origination, which functions as the conditionality of each phenomenon in such and such a way, comprising three cycles, three periods, three connections, four sections, and twenty modes, others have neither the intellect nor the strength; this is not the domain of others, but solely the domain of the Tathāgata. Thus, having reached the modes of conditionality, the roar of the Buddhas is mighty, knowledge penetrates... and is associated with emptiness.
Như vậy, không ai khác có sức mạnh hay năng lực để phân tích và thuyết giảng Thập Nhị Duyên Khởi (paṭiccasamuppāda) này, với ba vòng luân hồi (tivaṭṭaṃ), ba thời kỳ (tiyaddhaṃ), ba mối nối (tisandhiṃ), bốn nhóm (catusaṅkhepaṃ), hai mươi khía cạnh (vīsatākāraṃ), diễn ra theo các phương cách duyên khởi của từng pháp—đây là phạm vi không thuộc về người khác, mà chỉ thuộc về Như Lai. Như vậy, khi đạt đến các phương thức duyên khởi, tiếng rống (giáo pháp) của chư Phật trở nên vĩ đại, tuệ giác thâm nhập... liên hệ đến tánh không.
Tathā cattāro janā sassatavādā nāma, cattāro ekaccasassatavādā, cattāro antānantikā, cattāro amarāvikkhepikā, dve adhiccasamuppannikā, soḷasa saññīvādā, aṭṭha asaññīvādā, aṭṭha nevasaññīnāsaññīvādā, satta ucchedavādā, pañca diṭṭhadhammanibbānavādā nāma.
Similarly, there are four kinds of eternalists, four kinds of partial eternalists, four kinds of finitists and infinitists, four kinds of eel-wrigglers, two kinds of fortuitous originists, sixteen kinds of consciousists, eight kinds of unconsciousists, eight kinds of neither-conscious-nor-unconsciousists, seven kinds of annihilationists, and five kinds of Nibbāna-in-this-life adherents.
Tương tự, có bốn loại người theo thuyết thường kiến (sassatavādā), bốn loại theo thuyết một phần thường kiến (ekaccasassatavādā), bốn loại theo thuyết hữu biên và vô biên (antānantikā), bốn loại theo thuyết lươn lẹo (amarāvikkhepikā), hai loại theo thuyết vô nhân sinh (adhiccasamuppannikā), mười sáu loại theo thuyết có tưởng (saññīvādā), tám loại theo thuyết vô tưởng (asaññīvādā), tám loại theo thuyết phi tưởng phi phi tưởng (nevasaññīnāsaññīvādā), bảy loại theo thuyết đoạn kiến (ucchedavādā), năm loại theo thuyết niết bàn hiện tại (diṭṭhadhammanibbānavādā).
Te idaṃ nissāya idaṃ gaṇhantīti dvāsaṭṭhi diṭṭhigatāni bhinditvā nijjaṭaṃ niggumbaṃ katvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo.
To break down these sixty-two speculative views, showing how they arise by relying on this and grasping that, and to make them clear and untangled, others have neither the intellect nor the strength; this is not the domain of others, but solely the domain of the Tathāgata.
Việc phân tích sáu mươi hai tà kiến (diṭṭhigatāni) này, làm cho chúng không còn vướng mắc, không còn rối rắm, và thuyết giảng rằng: "Họ nương vào điều này mà chấp thủ điều này"—thì không ai khác có sức mạnh hay năng lực để làm điều đó; đây là phạm vi không thuộc về người khác, mà chỉ thuộc về Như Lai.
Iti samayantaraṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati, buddhañāṇassa mahantatā paññāyati, desanā gambhīrā hoti, tilakkhaṇāhatā, suññatāpaṭisaṃyuttāti.
Thus, having reached the distinction of views, the roar of the Buddhas is mighty, knowledge penetrates, the greatness of the Buddha's knowledge is revealed, and the teaching is profound, stamped with the three characteristics, and associated with emptiness.
Như vậy, khi đạt đến các tà kiến khác, tiếng rống (giáo pháp) của chư Phật trở nên vĩ đại, tuệ giác thâm nhập, sự vĩ đại của Phật tuệ được hiển lộ, giáo pháp trở nên sâu sắc, được ấn chứng bằng ba đặc tướng, và liên hệ đến tánh không.
29. Tattha santīti atthi saṃvijjanti upalabbhanti.
29. Here, santi means 'there are', 'exist', 'are found'.
29. Trong đó, santi có nghĩa là có, hiện hữu, được tìm thấy.
Bhikkhaveti ālapanavacanaṃ.
Bhikkhave is a vocative address.
Bhikkhave là từ xưng hô.
Eketi ekacce.
Eke means 'some'.
Eke có nghĩa là một số.
Samaṇabrāhmaṇāti pabbajjūpagatabhāvena samaṇā, jātiyā brāhmaṇā.
Samaṇabrāhmaṇā means ascetics by virtue of having gone forth, and brahmins by birth.
Samaṇabrāhmaṇā là những người Sa-môn do đã xuất gia, và Bà-la-môn do dòng dõi.
Lokena vā samaṇāti ca brāhmaṇāti ca evaṃ sammatā.
Or they are regarded by the world as ascetics and brahmins.
Hoặc những người được thế gian công nhận là Sa-môn và Bà-la-môn.
Pubbantaṃ kappetvā vikappetvā gaṇhantīti pubbantakappikā. Pubbantakappo vā etesaṃ atthīti pubbantakappikā.
They are pubbantakappikā because they conceptualize and elaborate on the past. Or they are pubbantakappikā because they have "pubbantakappa" (conceptualization of the past).
Những người chấp thủ và phân tích các cực đoan quá khứ (pubbantaṃ kappetvā vikappetvā gaṇhanti) được gọi là pubbantakappikā. Hoặc những người có sự chấp thủ quá khứ (pubbantakappo) được gọi là pubbantakappikā.
Tattha antoti ayaṃ saddo antaabbhantaramariyādalāmakaparabhāgakoṭṭhāsesu dissati.
Here, the word anta is seen in the senses of 'entrails', 'interior', 'boundary', 'inferior', 'further side', 'portion'.
Trong đó, từ anta này được thấy trong các nghĩa: ruột, bên trong, giới hạn, thấp kém, phần cuối, và phần.
‘‘Antapūro udarapūro’’tiādīsu hi ante antasaddo.
In phrases like “antapūro udarapūro” (filled with entrails, filled with abdomen), anta means 'entrails'.
Trong các câu như: "Antapūro udarapūro" (ruột đầy, bụng đầy), anta có nghĩa là ruột.
‘‘Caranti loke parivārachannā anto asuddhā bahi sobhamānā’’tiādīsu (saṃ. ni. 1.122) abbhantare.
In phrases like “Caranti loke parivārachannā anto asuddhā bahi sobhamānā” (They wander in the world, covered by attendants, impure within, appearing fair outside), anta means 'interior'.
Trong các câu như: "Caranti loke parivārachannā anto asuddhā bahi sobhamānā" (Họ đi lại trong thế gian, được vây quanh, bên trong không thanh tịnh, bên ngoài thì đẹp đẽ), anta có nghĩa là bên trong.
‘‘Kāyabandhanassa anto jīrati (cūḷava. 278).
“The end of the waistband wears out.”
"Kāyabandhanassa anto jīrati" (Phần cuối của dây lưng bị mục nát).
‘‘Sā haritantaṃ vā panthantaṃ vā selantaṃ vā udakantaṃ vā’’tiādīsu (ma. ni. 1.304) mariyādāyaṃ.
In phrases like “sā haritantaṃ vā panthantaṃ vā selantaṃ vā udakantaṃ vā” (it goes to the edge of the grass, or the edge of the path, or the edge of the rock, or the edge of the water), anta means 'boundary'.
Trong các câu như: "Sā haritantaṃ vā panthantaṃ vā selantaṃ vā udakantaṃ vā" (Nó đến giới hạn của cây cỏ, hoặc giới hạn của con đường, hoặc giới hạn của đá, hoặc giới hạn của nước), anta có nghĩa là giới hạn.
‘‘Antamidaṃ, bhikkhave, jīvikānaṃ yadidaṃ piṇḍolya’’ntiādīsu (saṃ. ni. 3.80) lāmake.
In phrases like “Antamidaṃ, bhikkhave, jīvikānaṃ yadidaṃ piṇḍolyaṃ” (This, bhikkhus, is the lowest of livelihoods, namely alms-gathering), anta means 'inferior'.
Trong các câu như: "Antamidaṃ, bhikkhave, jīvikānaṃ yadidaṃ piṇḍolyaṃ" (Này các Tỳ-khưu, đây là sự sống thấp kém nhất, tức là khất thực), anta có nghĩa là thấp kém.
‘‘Esevanto dukkhassā’’tiādīsu (saṃ. ni. 2.51) parabhāge.
In phrases like “Esevanto dukkhassā” (This is the end of suffering), anta means 'further side'.
Trong các câu như: "Esevanto dukkhassā" (Đây là sự chấm dứt của khổ), anta có nghĩa là phần cuối.
Sabbapaccayasaṅkhayo hi dukkhassa parabhāgo koṭīti vuccati.
For the cessation of all conditions is called the further side or culmination of suffering.
Vì sự đoạn diệt của tất cả các duyên được gọi là phần cuối, là đỉnh cao của khổ.
‘‘Sakkāyo kho, āvuso, eko anto’’tiādīsu (a. ni. 6.61) koṭṭhāse.
In phrases like “Sakkāyo kho, āvuso, eko anto” (Indeed, friend, sakkāya is one portion), anta means 'portion'.
Trong các câu như: "Sakkāyo kho, āvuso, eko anto" (Này các hiền giả, sắc thân (sakkāya) là một phần), anta có nghĩa là phần.
Svāyaṃ idhāpi koṭṭhāse vattati.
And here too, it is used in the sense of 'portion'.
Và ở đây, từ này cũng được dùng với nghĩa là phần.
Kappasaddopi – ‘‘tiṭṭhatu, bhante bhagavā kappaṃ’’ (dī. ni. 2.167), ‘‘atthi kappo nipajjituṃ’’ (a. ni. 8.80), ‘‘kappakatena akappakataṃ saṃsibbitaṃ hotī’’ti, (pāci. 371) evaṃ āyukappalesakappavinayakappādīsu sambahulesu atthesu vattati.
The word kappa also appears in many senses, such as 'life-span', 'small portion', 'Vinaya rule', as in “tiṭṭhatu, bhante bhagavā kappaṃ” (May the Blessed One remain for an eon), “atthi kappo nipajjituṃ” (Is it permissible to lie down?), “kappakatena akappakataṃ saṃsibbitaṃ hotī” (What is permissible becomes mixed with what is not permissible).
Từ kappasadda cũng được dùng trong nhiều nghĩa khác nhau như: tuổi thọ (āyukappa), thời kỳ (lesakappa), giới luật (vinayakappa), v.v., như trong các câu: "Tiṭṭhatu, bhante bhagavā kappaṃ" (Bạch Thế Tôn, xin Thế Tôn an trụ trọn một kiếp), "Atthi kappo nipajjituṃ" (Có thời điểm thích hợp để nằm), "Kappakatena akappakataṃ saṃsibbitaṃ hotī" (Điều đã được cho phép hòa lẫn với điều không được cho phép).
Idha taṇhādiṭṭhīsu vattatīti veditabbo.
Here it should be understood as referring to craving and wrong views.
Ở đây, nó nên được hiểu là dùng trong nghĩa tham ái (taṇhā) và tà kiến (diṭṭhi).
Vuttampi cetaṃ – ‘‘kappāti dve kappā, taṇhākappo ca diṭṭhikappo cā’’ti (mahāni. 28).
It has also been stated: “Kappa are two kappas: taṇhākappa and diṭṭhikappa.”
Cũng đã nói rằng: "Kappa có hai loại kappa: taṇhākappo (chấp thủ do tham ái) và diṭṭhikappo (chấp thủ do tà kiến)."
Tasmā taṇhādiṭṭhivasena atītaṃ khandhakoṭṭhāsaṃ kappetvā pakappetvā ṭhitāti pubbantakappikāti evamettha attho veditabbo.
Therefore, by way of craving and views, having conceived and distinctively conceived the past portion of aggregates, they remain. Thus, they are called pubbantakappikā. In this way, the meaning here should be understood.
Do đó, do sức mạnh của tham ái và tà kiến (taṇhā-diṭṭhi), họ đã hình dung và suy tưởng về phần uẩn quá khứ, nên được gọi là pubbantakappikā (những người chấp thủ vào quá khứ). Nghĩa ở đây nên được hiểu như vậy.
Tesaṃ evaṃ pubbantaṃ kappetvā ṭhitānaṃ punappunaṃ uppajjanavasena pubbantameva anugatā diṭṭhīti pubbantānudiṭṭhino.
Of those who thus remain having conceived the past, their views follow only the past, by way of repeatedly arising. Thus, they are pubbantānudiṭṭhino.
Đối với những người đã hình dung về quá khứ như vậy, tà kiến của họ tiếp tục phát sinh lặp đi lặp lại theo cách đó, nên họ được gọi là pubbantānudiṭṭhino (những người theo tà kiến về quá khứ).
Te evaṃdiṭṭhino taṃ pubbantaṃ ārabbha āgamma paṭicca aññampi janaṃ diṭṭhigatikaṃ karontā anekavihitāni adhimuttipadāni abhivadanti aṭṭhārasahi vatthūhi.
Those with such views, taking, resorting to, and depending on that past, make other people also fall into wrong views, proclaiming various declarations of belief (adhimuttipadāni) through eighteen bases.
Những người có tà kiến như vậy, dựa vào và nương tựa vào quá khứ đó, khiến những người khác cũng có tà kiến, và họ tuyên bố nhiều loại quan điểm (adhimuttipadāni) bằng mười tám căn cứ (vatthūhi).
30. Idāni yehi aṭṭhārasahi vatthūhi abhivadanti, tesaṃ kathetukamyatāya pucchāya ‘‘te ca kho bhonto’’tiādinā nayena pucchitvā tāni vatthūni vibhajitvā dassetuṃ ‘‘santi, bhikkhave’’tiādimāha.
30. Now, wishing to explain the eighteen bases by which they make proclamations, the text begins with santi, bhikkhave after having asked in the manner of te ca kho bhonto.
Bây giờ, để nói về mười tám nguyên nhân mà họ tuyên bố, Đức Phật đã hỏi theo cách "te ca kho bhonto" và sau đó phân tích và trình bày những nguyên nhân đó bằng cách nói "Santi, bhikkhave" (Này các Tỳ-khưu, có).
Tattha vadanti etenāti vādo, diṭṭhigatassetaṃ adhivacanaṃ.
Here, that by which they speak is vāda; this is a designation for wrong view (diṭṭhigata).
Trong đó, điều mà họ nói ra được gọi là vāda (luận thuyết), đây là một tên gọi khác của diṭṭhigata (tà kiến).
Sassato vādo etesanti sassatavādā, sassatadiṭṭhinoti attho.
Those whose view is that the self is eternal are sassatavādā; that is, those with the eternalist view.
Những người có luận thuyết (vāda) rằng tự ngã (attā) là thường hằng (sassata) được gọi là sassatavādā, nghĩa là những người có tà kiến thường hằng.
Eteneva nayena ito paresampi evarūpānaṃ padānaṃ attho veditabbo.
By this same method, the meaning of similar terms for others (hereafter) should be understood.
Theo cách này, ý nghĩa của các từ ngữ tương tự khác cũng nên được hiểu.
Sassataṃ attānañca lokañcāti rūpādīsu aññataraṃ attāti ca lokoti ca gahetvā taṃ sassataṃ amaraṃ niccaṃ dhuvaṃ paññapenti.
Sassataṃ attānañca lokañcāti means taking any one of the rūpa and so on as 'self' and 'world', and then asserting it as eternal, immortal, permanent, and lasting.
Sassataṃ attānañca lokañcā có nghĩa là họ chấp thủ một trong các uẩn như sắc (rūpa) v.v., coi đó là tự ngã (attā) và thế gian (loka), rồi tuyên bố nó là thường hằng (sassata), bất tử (amara), vĩnh cửu (nicca), và kiên cố (dhuva).
Yathāha – ‘‘rūpaṃ attā ceva loko ca sassato cāti attānañca lokañca paññapenti tathā vedanaṃ, saññaṃ, saṅkhāre, viññāṇaṃ attā ceva loko ca sassato cāti attānañca lokañca paññapentī’’ti.
As it is said: "They assert the self and the world, saying, 'Form is self and world, and is eternal'; likewise, they assert feeling, perception, mental formations, and consciousness as self and world, and eternal."
Như đã nói: "Họ tuyên bố sắc (rūpa) là tự ngã và thế gian, là thường hằng; cũng vậy, thọ (vedanā), tưởng (saññā), hành (saṅkhārā), thức (viññāṇa) là tự ngã và thế gian, là thường hằng."
31. Ātappamanvāyātiādīsu vīriyaṃ kilesānaṃ ātāpanabhāvena ātappanti vuttaṃ.
31. In ātappamanvāyā and so on, exertion (vīriya) is called ātappa because of its nature of burning up defilements.
Trong các từ Ātappamanvāyā v.v., tinh tấn (vīriya) được gọi là ātappa (nhiệt tâm) vì nó có khả năng đốt cháy các phiền não.
Tadeva padahanavasena padhānaṃ. Punappunaṃ yuttavasena anuyogoti.
The same (exertion) is padhāna by way of striving. And it is anuyoga by way of repeated application.
Chính tinh tấn đó, do sự nỗ lực, được gọi là padhāna (sự tinh cần). Do sự gắn bó lặp đi lặp lại, được gọi là anuyoga (sự chuyên cần).
Evaṃ tippabhedaṃ vīriyaṃ anvāya āgamma paṭiccāti attho.
Thus, the meaning is: having resorted to and depended on exertion, which has three aspects.
Như vậy, nghĩa là nương theo, dựa vào, và tùy thuộc vào ba loại tinh tấn này.
Appamādo vuccati satiyā avippavāso.
Appamādo is said to be the non-separation from mindfulness.
Appamādo (không phóng dật) được gọi là sự không rời xa chánh niệm (sati).
Sammā manasikāroti upāyamanasikāro, pathamanasikāro, atthato ñāṇanti vuttaṃ hoti.
Sammā manasikāro means appropriate attention, or the attention that is the right path; in terms of ultimate meaning, it is knowledge.
Sammā manasikāro (chánh tư duy) được gọi là sự tư duy đúng đắn, sự tư duy ban đầu, và về mặt ý nghĩa là trí tuệ (ñāṇa).
Yasmiñhi manasikāre ṭhitassa pubbenivāsānussati ñāṇaṃ ijjhati, ayaṃ imasmiṃ ṭhāne manasikāroti adhippeto.
For the attention in which one stands when the knowledge of recollecting past lives is achieved, that attention is intended in this context.
Vì trí tuệ về túc mạng ký ức (pubbenivāsānussati ñāṇa) thành tựu khi hành giả an trú trong sự tư duy nào, thì sự tư duy đó được coi là manasikāra (tư duy) trong trường hợp này.
Tasmā vīriyañca satiñca ñāṇañca āgammāti ayamettha saṅkhepattho.
Therefore, the brief meaning here is: having resorted to exertion, mindfulness, and knowledge.
Do đó, tóm tắt ý nghĩa ở đây là nương vào tinh tấn, chánh niệm và trí tuệ.
Tathārūpanti tathājātikaṃ.
Tathārūpaṃ means of that kind.
Tathārūpaṃ có nghĩa là loại như vậy.
Cetosamādhinti cittasamādhiṃ.
Cetosamādhiṃ means concentration of mind.
Cetosamādhiṃ có nghĩa là tâm định (cittasamādhi).
Phusatīti vindati paṭilabhati.
Phusatīti means one obtains, one acquires.
Phusatī có nghĩa là đạt được, thâu hoạch.
Yathā samāhite citteti yena samādhinā sammā āhite suṭṭhu ṭhapite cittamhi anekavihitaṃ pubbenivāsantiādīnaṃ attho visuddhimagge vutto.
The meaning of anekavihitaṃ pubbenivāsa and so on, in relation to yathā samāhite citte (where the mind is properly established in such concentration), is explained in the Visuddhimagga.
Ý nghĩa của anekavihitaṃ pubbenivāsaṃ v.v., như đã được giải thích trong Visuddhimagga, là "khi tâm đã được định tĩnh đúng đắn (yathā samāhite citte), tức là tâm đã được an trú vững chắc bằng thiền định đó".
So evamāhāti so evaṃ jhānānubhāvasampanno hutvā diṭṭhigatiko evaṃ vadati.
So evamāhāti means that person, being endowed with the power of jhāna, and holding to wrong views, says this.
So evamāhā có nghĩa là vị có tà kiến đó, đã thành tựu năng lực thiền định như vậy, nói như thế.
Vañjhoti vañjhapasuvañjhatālādayo viya aphalo kassaci ajanakoti.
Vañjho means barren, like a barren animal or a barren palm tree; fruitless, not generating anything.
Vañjho (vô sinh) có nghĩa là vô ích, không tạo ra bất cứ điều gì, giống như một con vật cái vô sinh hoặc một cây cọ vô sinh.
Etena ‘‘attā’’ti ca ‘‘loko’’ti ca gahitānaṃ jhānādīnaṃ rūpādijanakabhāvaṃ paṭikkhipati.
By this, he rejects the notion that jhāna and so on, taken as 'self' and 'world', generate form and so on.
Bằng cách này, ông ta phủ nhận khả năng tạo ra sắc (rūpa) v.v., của thiền định (jhāna) v.v., mà ông ta đã chấp thủ là "tự ngã" (attā) và "thế gian" (loka).
Pabbatakūṭaṃ viya ṭhitoti kūṭaṭṭho.
That which stands like a mountain peak is kūṭaṭṭho.
Nó đứng vững như đỉnh núi, nên được gọi là kūṭaṭṭho (bất động).
Esikaṭṭhāyiṭṭhitoti esikaṭṭhāyī viya hutvā ṭhitoti esikaṭṭhāyiṭṭhito.
Esikaṭṭhāyiṭṭhitoti means standing firm like a gatepost (esikaṭṭhāyī).
Esikaṭṭhāyiṭṭhito có nghĩa là đứng vững như một cột trụ.
Yathā sunikhāto esikatthambho niccalo tiṭṭhati, evaṃ ṭhitoti attho.
The meaning is that just as a well-driven gatepost stands motionless, so too does it stand.
Nghĩa là nó đứng vững chắc như một cột trụ đã được chôn sâu, không lay chuyển.
Ubhayenapi lokassa vināsābhāvaṃ dīpeti.
By both (terms), he indicates the non-destruction of the world.
Bằng cả hai cách này, ông ta chỉ ra rằng thế gian không bị hủy diệt.
Keci pana īsikaṭṭhāyiṭṭhitoti pāḷiṃ vatvā muñje īsikā viya ṭhitoti vadanti.
Some, however, recite the Pāḷi as īsikaṭṭhāyiṭṭhito and say that it stands like a reed in muñja grass.
Tuy nhiên, một số vị đã đọc pāḷi là īsikaṭṭhāyiṭṭhito (đứng vững như sợi cỏ īsikā) và nói rằng nó đứng vững như sợi cỏ īsikā trong cây muñja.
Tatrāyamadhippāyo – yadidaṃ jāyatīti vuccati, taṃ muñjato īsikā viya vijjamānameva nikkhamati.
Their intention is this: what is said to be born emerges as if it already exists, like a reed from muñja grass.
Ý nghĩa của điều này là: cái được gọi là sinh ra, thì nó xuất hiện như sợi cỏ īsikā từ cây muñja, vốn đã tồn tại.
Yasmā ca īsikaṭṭhāyiṭṭhito, tasmā teva sattā sandhāvanti, ito aññattha gacchantīti attho.
And because it stands like a reed (īsikaṭṭhāyiṭṭhito), these same beings wander on, meaning they go elsewhere from here.
Và bởi vì nó là īsikaṭṭhāyiṭṭhito, nên các chúng sinh đó tiếp tục luân chuyển, nghĩa là họ đi từ đây đến nơi khác.
Saṃsarantīti aparāparaṃ sañcaranti.
Saṃsarantīti means they wander from one existence to another.
Saṃsarantī có nghĩa là luân chuyển từ đời này sang đời khác.
Cavantīti evaṃ saṅkhyaṃ gacchanti.
Cavantīti means they reach the state of passing away in this manner.
Cavantī có nghĩa là đi đến sự chấm dứt như vậy.
Tathā upapajjantīti.
Likewise, upapajjantīti means they are reborn.
Cũng vậy, upapajjantī (tái sinh).
Aṭṭhakathāyaṃ pana pubbe ‘‘sassato attā ca loko cā’’ti vatvā idāni te ca sattā sandhāvantītiādinā vacanena ayaṃ diṭṭhigatiko attanāyeva attano vādaṃ bhindati, diṭṭhigatikassa dassanaṃ nāma na nibaddhaṃ, thusarāsimhi nikhātakhāṇu viya cañcalaṃ, ummattakapacchiyaṃ pūvakhaṇḍagūthagomayādīni viya cettha sundarampi asundarampi hoti yevāti vuttaṃ.
However, in the Aṭṭhakathā, it is said that after stating "the self and the world are eternal" earlier, this view-holder now contradicts his own assertion with the statement "these same beings wander on," and so on. It is stated that the view of a view-holder is not fixed, but wavering like a stake driven into a pile of husks, and that in it, like fragments of cakes, excrement, and cow dung in a madman's basket, both good and bad things are found.
Tuy nhiên, trong Aṭṭhakathā, sau khi nói "tự ngã và thế gian là thường hằng" trước đó, bây giờ với lời nói "các chúng sinh đó tiếp tục luân chuyển" v.v., người có tà kiến này tự mình phá vỡ luận thuyết của chính mình. Quan điểm của người có tà kiến không cố định, nó dao động như một cọc gỗ đóng trong đống trấu, và trong cái giỏ của người điên, có cả những thứ đẹp và không đẹp, như bánh, phân và phân bò, v.v., đã được nói như vậy.
Atthitveva sassatisamanti ettha sassatīti niccaṃ vijjamānatāya mahāpathaviṃva maññati, tathā sinerupabbatacandimasūriye.
In atthitveva sassatisamaṃ, sassatī means perceiving the self as continually existing, just like the great earth, and similarly, like Mount Sineru, the moon, and the sun.
Trong Atthitveva sassatisamaṃ, sassatī là do sự tồn tại vĩnh viễn, ông ta nghĩ nó giống như đại địa, và cũng như núi Sineru, mặt trăng và mặt trời.
Tato tehi samaṃ attānaṃ maññamānā atthi tveva sassatisamanti vadanti.
Therefore, considering the self to be equal to these, they say, "It exists as eternally equal."
Từ đó, khi nghĩ tự ngã (attā) giống như những thứ đó, họ nói rằng nó tồn tại vĩnh viễn như vậy.
Idāni sassato attā ca loko cātiādikāya paṭiññāya sādhanatthaṃ hetuṃ dassento ‘‘taṃ kissa hetu?
Now, showing the reason to establish the assertion sassato attā ca loko cāti (the self and the world are eternal) and so on, the text says taṃ kissa hetu? Ahañhi ātappamanvāyāti (for what reason? For I, having pursued ardour) and so on.
Bây giờ, để chứng minh cho lời tuyên bố "tự ngã và thế gian là thường hằng" v.v., Đức Phật đã trình bày lý do bằng cách nói "Taṃ kissa hetu? Ahañhi ātappamanvāyā" (Vì lý do gì? Vì ta đã nương theo sự tinh tấn) v.v.
Ahañhi ātappamanvāyā’’tiādimāha.
Tattha imināmahaṃ etaṃ jānāmīti iminā visesādhigamena ahaṃ etaṃ paccakkhato jānāmi, na kevalaṃ saddhāmattakeneva vadāmīti dasseti, makāro panettha padasandhikaraṇatthaṃ vutto.
Tôi sẽ nỗ lực tinh tấn."
Tattha imināmahaṃ etaṃ jānāmīti iminā visesādhigamena ahaṃ etaṃ paccakkhato jānāmi, na kevalaṃ saddhāmattakeneva vadāmīti dasseti, makāro panettha padasandhikaraṇatthaṃ vutto.
Here, imināmahaṃ etaṃ jānāmi means, "By this special attainment, I know this directly; I do not merely speak out of faith." The letter 'm' here is added for euphonic conjunction.
Trong đó, imināmahaṃ etaṃ jānāmī (ta biết điều này bằng cách này) có nghĩa là: "Ta biết điều này một cách trực tiếp bằng sự thành tựu đặc biệt này, chứ không phải chỉ bằng niềm tin đơn thuần." Chữ "ma" ở đây được dùng để nối các từ.
Idaṃ, bhikkhave, paṭhamaṃ ṭhānanti catūhi vatthūhīti vatthusaddena vuttesu catūsu ṭhānesu idaṃ paṭhamaṃ ṭhānaṃ, idaṃ jātisatasahassamattānussaraṇaṃ paṭhamaṃ kāraṇanti attho.
Idaṃ, bhikkhave, paṭhamaṃ ṭhānanti means this is the first base among the four bases mentioned by the word vatthu (bases). That is to say, this recollection of hundreds of thousands of births is the first cause.
Idaṃ, bhikkhave, paṭhamaṃ ṭhānaṃ (Này các Tỳ-khưu, đây là điểm thứ nhất) có nghĩa là: trong bốn điểm được đề cập bằng từ "vatthu" (căn cứ), đây là điểm thứ nhất; sự hồi tưởng về hàng trăm ngàn kiếp sống này là nguyên nhân thứ nhất.
34. Catutthavāre takkayatīti takkī, takko vā assa atthīti takkī. Takketvā vitakketvā diṭṭhigāhino etaṃ adhivacanaṃ.
34. In the fourth section, one who speculates is takkī, or one who has speculation is takkī. This is a designation for one who holds to wrong views after speculating and cogitating.
Trong trường hợp thứ tư, người suy luận được gọi là takkī, hoặc người có suy luận được gọi là takkī. Đây là một tên gọi khác của người chấp thủ tà kiến sau khi đã suy luận và suy xét.
Vīmaṃsāya samannāgatoti vīmaṃsī. Vīmaṃsā nāma tulanā ruccanā khamanā.
One who is endowed with investigation is vīmaṃsī. Vīmaṃsā means weighing, liking, or accepting.
Người có sự khảo sát được gọi là vīmaṃsī. Vīmaṃsā (khảo sát) có nghĩa là cân nhắc, ưa thích, chấp nhận.
Yathā hi puriso yaṭṭhiyā udakaṃ vīmaṃsitvā otarati, evameva yo tulayitvā ruccitvā khamāpetvā diṭṭhiṃ gaṇhāti, so ‘‘vīmaṃsī’’ti veditabbo.
Just as a man probes water with a stick before descending, so too should one who weighs, likes, and accepts a view be understood as a vīmaṃsī.
Giống như một người dùng gậy để dò nước rồi mới lội xuống, cũng vậy, người chấp thủ tà kiến sau khi cân nhắc, ưa thích và chấp nhận nó, thì được gọi là "vīmaṃsī".
Takkapariyāhatanti takkena pariyāhataṃ, tena tena pariyāyena takketvāti attho.
Takkapariyāhataṃ means beaten by speculation; that is, having speculated repeatedly by various methods.
Takkapariyāhataṃ có nghĩa là bị suy luận đánh đổ, nghĩa là đã suy luận bằng nhiều cách khác nhau.
Vīmaṃsānucaritanti tāya vuttappakārāya vīmaṃsāya anucaritaṃ.
Vīmaṃsānucaritaṃ means repeatedly followed by such investigation as described.
Vīmaṃsānucaritaṃ có nghĩa là đã được thực hành theo sự khảo sát đã nói trên.
Sayaṃpaṭibhānanti attano paṭibhānamattasañjātaṃ.
Sayaṃpaṭibhānaṃ means arising solely from one's own quick wit.
Sayaṃpaṭibhānaṃ có nghĩa là tự mình phát sinh trí tuệ.
Evamāhāti sassatadiṭṭhiṃ gahetvā evaṃ vadati.
Evamāhāti means, having adopted the eternalist view, he speaks thus.
Evamāhā có nghĩa là chấp thủ tà kiến thường hằng và nói như vậy.
Tattha catubbidho takkī – anussutiko, jātissaro, lābhī, suddhatakkikoti.
Here, there are four types of speculators: the Anussutika, the Jātissara, the Lābhī, and the Suddhatakkika.
Trong đó, có bốn loại người suy luận (takkī): người nghe theo truyền thống (anussutiko), người nhớ các kiếp sống (jātissaro), người có thành tựu (lābhī), và người thuần túy suy luận (suddhatakkiko).
Tattha yo ‘‘vessantaro nāma rājā ahosī’’tiādīni sutvā ‘‘tena hi yadi vessantarova bhagavā, sassato attā’’ti takkayanto diṭṭhiṃ gaṇhāti, ayaṃ anussutiko nāma.
Among these, whoever, having heard statements such as "There was a king named Vessantara," and then pondering, "Therefore, if the Blessed One (Bhagavā) was Vessantara, the self (attā) is eternal," and thereby grasps this view, this one is called an anussutika.
Ở đây, người nào nghe những điều như: “Vua Vessantara đã từng là một vị vua,” rồi suy luận: “Nếu Vessantara là Đức Thế Tôn, thì tự ngã là thường còn,” và chấp thủ tà kiến, người ấy được gọi là Anussutika (người suy luận theo truyền thuyết).
Dve tisso jātiyo saritvā – ‘‘ahameva pubbe asukasmiṃ nāma ahosiṃ, tasmā sassato attā’’ti takkayanto jātissaratakkiko nāma.
Whoever, having recollected two or three past existences and pondering, "I myself was in such and such an existence previously; therefore, the self is eternal," this one is called a jātissaratakkika.
Người nào nhớ lại hai ba kiếp sống trước, rồi suy luận: “Chính ta đã từng là người tên kia trong quá khứ, do đó tự ngã là thường còn,” người ấy được gọi là Jātissaratakkika (người suy luận dựa trên ký ức về các kiếp sống trước).
Yo pana lābhitāya ‘‘yathā me idāni attā sukhī hoti, atītepi evaṃ ahosi, anāgatepi bhavissatī’’ti takkayitvā diṭṭhiṃ gaṇhāti, ayaṃ lābhītakkiko nāma.
But whoever grasps a view by pondering, for the sake of gain (lābhitāya), "Just as my self is happy now, so it was in the past, and so it will be in the future," this one is called a lābhītakkika.
Còn người nào, vì muốn đạt được lợi lộc, suy luận: “Như bây giờ tự ngã của ta được an lạc, trong quá khứ cũng vậy, và trong tương lai cũng sẽ như vậy,” rồi chấp thủ tà kiến, người ấy được gọi là Lābhītakkika (người suy luận vì lợi lộc).
‘‘Evaṃ sati idaṃ hotī’’ti takkamatteneva gaṇhanto pana suddhatakkiko nāma.
Whoever grasps it merely by reasoning, "If this is so, then this will be," this one is called a suddhatakkika.
Người nào chỉ đơn thuần suy luận: “Khi điều này xảy ra thì điều kia xuất hiện,” rồi chấp thủ tà kiến, người ấy được gọi là Suddhatakkika (người suy luận thuần túy).
36. Tayidaṃ, bhikkhave, tathāgato pajānātīti bhikkhave, taṃ idaṃ catubbidhampi diṭṭhigataṃ tathāgato nānappakārato jānāti.
36. This, bhikkhus, the Tathāgata knows means, bhikkhus, the Tathāgata knows this fourfold wrong view in various ways.
36. Này các Tỳ-khưu, Như Lai hiểu rõ điều này nghĩa là, này các Tỳ-khưu, Như Lai hiểu rõ tất cả bốn loại tà kiến này một cách đa dạng.
Tato taṃ pajānanākāraṃ dassento ime diṭṭhiṭṭhānātiādimāha.
Then, to show the manner of that knowing, he says, "These are the grounds for views," and so on.
Sau đó, để chỉ ra cách hiểu biết đó, Ngài nói: “Đây là những căn cứ của tà kiến,” v.v.
Tattha diṭṭhiyova diṭṭhiṭṭhānā nāma.
Among these, the views themselves are called grounds for views (diṭṭhiṭṭhānā).
Trong đó, chính tà kiến được gọi là Diṭṭhiṭṭhāna (căn cứ của tà kiến).
Api ca diṭṭhīnaṃ kāraṇampi diṭṭhiṭṭhānameva.
Moreover, the causes of views are also grounds for views.
Hơn nữa, nguyên nhân của tà kiến cũng chính là Diṭṭhiṭṭhāna.
Yathāha ‘‘katamāni aṭṭha diṭṭhiṭṭhānāni?
As it is said, "What are the eight grounds for views?
Như đã nói: “Tám căn cứ của tà kiến là gì?
Khandhāpi diṭṭhiṭṭhānaṃ, avijjāpi, phassopi, saññāpi, vitakkopi, ayonisomanasikāropi, pāpamittopi, paratoghosopi diṭṭhiṭṭhāna’’nti.
The aggregates (khandhā) are a ground for views, ignorance (avijjā) is, contact (phasso) is, perception (saññā) is, thought (vitakko) is, improper attention (ayoniso manasikāro) is, evil friends (pāpamitto) are, and external sounds (paratoghoso) are also grounds for views."
Các uẩn cũng là căn cứ của tà kiến, vô minh cũng vậy, xúc cũng vậy, tưởng cũng vậy, tầm cũng vậy, tác ý không như lý cũng vậy, bạn ác cũng vậy, và tiếng nói từ người khác cũng là căn cứ của tà kiến.”
‘‘Khandhā hetu, khandhā paccayo diṭṭhiṭṭhānaṃ upādāya samuṭṭhānaṭṭhena, evaṃ khandhāpi diṭṭhiṭṭhānaṃ.
"The aggregates are a cause (hetu), the aggregates are a condition (paccayo), in the sense of arising dependent on the ground for views; thus, the aggregates are also a ground for views.
“Các uẩn là nhân, các uẩn là duyên theo nghĩa là nguyên nhân phát sinh của căn cứ tà kiến, như vậy các uẩn cũng là căn cứ của tà kiến.
Avijjā hetu…pe… pāpamitto hetu.
Ignorance is a cause... (pe)... evil friends are a cause.
Vô minh là nhân… v.v… bạn ác là nhân.
Paratoghoso hetu, paratoghoso paccayo diṭṭhiṭṭhānaṃ upādāya samuṭṭhānaṭṭhena, evaṃ paratoghosopi diṭṭhiṭṭhāna’’nti (paṭi. ma. 1.124).
External sounds are a cause, external sounds are a condition, in the sense of arising dependent on the ground for views; thus, external sounds are also a ground for views."
Tiếng nói từ người khác là nhân, tiếng nói từ người khác là duyên theo nghĩa là nguyên nhân phát sinh của căn cứ tà kiến, như vậy tiếng nói từ người khác cũng là căn cứ của tà kiến.”
Evaṃgahitāti diṭṭhisaṅkhātā tāva diṭṭhiṭṭhānā – ‘‘sassato attā ca loko cā’’ti evaṃgahitā ādinnā, pavattitāti attho.
Grasped in such a way means that the grounds for views, which are the views themselves—"The self and the world are eternal"—are thus grasped, seized, and established, is the meaning.
Được chấp thủ như vậy nghĩa là, những căn cứ tà kiến được gọi là tà kiến, như “tự ngã và thế giới là thường còn,” được chấp giữ như vậy, được nắm giữ, được duy trì.
Evaṃparāmaṭṭhāti nirāsaṅkacittatāya punappunaṃ āmaṭṭhā parāmaṭṭhā, ‘idameva saccaṃ, moghamañña’nti pariniṭṭhāpitā.
Seized and held in such a way means that due to a mind free from doubt, they are repeatedly held and seized, having firmly concluded, "Only this is true, all else is void."
Được nắm giữ kỹ càng như vậy nghĩa là, do tâm không còn nghi ngờ, chúng được nắm giữ kỹ càng nhiều lần, được xác định chắc chắn là ‘chỉ điều này là sự thật, những điều khác là vô ích’.
Kāraṇasaṅkhātā pana diṭṭhiṭṭhānā yathā gayhamānā diṭṭhiyo samuṭṭhāpenti, evaṃ ārammaṇavasena ca pavattanavasena ca āsevanavasena ca gahitā.
However, the grounds for views which are causes, are grasped in terms of object, continuance, and repeated cultivation, in such a way that when they are grasped, they give rise to views.
Còn những căn cứ tà kiến được gọi là nguyên nhân, chúng được chấp giữ theo cách mà khi được chấp giữ, chúng làm phát sinh các tà kiến, như vậy chúng được chấp giữ theo nghĩa là đối tượng, theo nghĩa là sự duy trì, và theo nghĩa là sự thực hành.
Anādīnavadassitāya punappunaṃ gahaṇavasena parāmaṭṭhā.
They are repeatedly held and seized in terms of repeatedly grasping due to not seeing the danger.
Chúng được nắm giữ kỹ càng nhiều lần do không thấy được hiểm họa.
Evaṃgatikāti evaṃ nirayatiracchānapettivisayagatikānaṃ aññataragatikā.
Having such a destiny means having one of such destinies as the hell realm, animal realm, or ghost realm.
Có cõi đi như vậy nghĩa là, có một trong những cõi đi như địa ngục, súc sanh, ngạ quỷ.
Evaṃ abhisamparāyāti idaṃ purimapadasseva vevacanaṃ, evaṃvidhaparalokāti vuttaṃ hoti.
Having such a future existence is a synonym for the preceding phrase; it means having such a world to come.
Có tương lai như vậy đây là từ đồng nghĩa của từ trước, có nghĩa là có một thế giới bên kia như vậy.
Tañca tathāgato pajānātīti na kevalañca tathāgato sakāraṇaṃ sagatikaṃ diṭṭhigatameva pajānāti, atha kho tañca sabbaṃ pajānāti, tato ca uttaritaraṃ sīlañceva samādhiñca sabbaññutaññāṇañca pajānāti.
That, too, the Tathāgata knows means that the Tathāgata not only knows the wrong view with its causes and destinies, but he knows all that, and beyond that, he knows virtue (sīla), concentration (samādhi), and omniscience (sabbaññutaññāṇa).
Và Như Lai hiểu rõ điều đó nghĩa là, Như Lai không chỉ hiểu rõ tà kiến cùng với nguyên nhân và cõi đi của nó, mà Ngài còn hiểu rõ tất cả những điều đó, và hơn thế nữa, Ngài hiểu rõ cả giới, định, và tuệ toàn tri.
Tañca pajānanaṃ na parāmasatīti tañca evaṃvidhaṃ anuttaraṃ visesaṃ pajānantopi ahaṃ pajānāmīti taṇhādiṭṭhimānaparāmāsavasena tañca na parāmasati.
And knowing that, he does not cling to it means that even though he knows such an unsurpassed distinction, he does not cling to it in terms of clinging, wrong view, or conceit, thinking "I know."
Và Ngài không chấp thủ sự hiểu biết đó nghĩa là, dù hiểu biết được sự đặc biệt vô thượng như vậy, Ngài cũng không chấp thủ sự hiểu biết đó theo cách chấp thủ của tham ái, tà kiến, và ngã mạn, rằng ‘ta hiểu biết’.
Aparāmasato cassa paccattaññeva nibbuti viditāti evaṃ aparāmasato cassa aparāmāsapaccayā sayameva attanāyeva tesaṃ parāmāsakilesānaṃ nibbuti viditā.
For one who does not cling, the extinguishment is known to him personally means that for him who does not cling in this way, due to not clinging, the extinguishment of those clinging defilements is known by himself, personally.
Và đối với người không chấp thủ, sự tịch tịnh được biết đến một cách tự thân nghĩa là, đối với người không chấp thủ như vậy, do không chấp thủ, sự tịch tịnh của những phiền não chấp thủ đó được biết đến một cách tự thân, bởi chính mình.
Pākaṭaṃ, bhikkhave, tathāgatassa nibbānanti dasseti.
This shows, bhikkhus, that the Tathāgata's Nibbāna is manifest.
Điều này cho thấy, này các Tỳ-khưu, Nibbāna của Như Lai là hiển nhiên.
Idāni yathāpaṭipannena tathāgatena sā nibbuti adhigatā, taṃ paṭipattiṃ dassetuṃ yāsu vedanāsu rattā titthiyā ‘‘idha sukhino bhavissāma, ettha sukhino bhavissāmā’’ti diṭṭhigahanaṃ pavisanti, tāsaṃyeva vedanānaṃ vasena kammaṭṭhānaṃ ācikkhanto vedanānaṃ samudayañcātiādimāha.
Now, to show the path by which the Tathāgata attained that extinguishment, teaching the meditation subject (kammaṭṭhāna) in terms of precisely those feelings (vedanā) to which the sectarians, clinging, enter the thicket of wrong views, thinking, "Here we shall be happy, there we shall be happy," he says, "the origin of feelings," and so on.
Bây giờ, để chỉ ra con đường mà Như Lai đã thực hành để đạt được sự tịch tịnh đó, Ngài giảng về đề mục thiền định dựa trên chính những cảm thọ mà các ngoại đạo đã đắm nhiễm, và đã đi vào rừng tà kiến với suy nghĩ: “Ở đây chúng ta sẽ được an lạc, ở đó chúng ta sẽ được an lạc,” và Ngài nói: “Sự tập khởi của các cảm thọ,” v.v.
Tattha yathābhūtaṃ viditvāti ‘‘avijjāsamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, taṇhāsamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, kammasamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, phassasamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati (paṭi. ma. 1.50).
Among these, having known truly means: "One sees the origin of the aggregate of feelings in the sense of the origin of causes, namely, 'With the origin of ignorance, there is the origin of feelings.' One sees the origin of the aggregate of feelings in the sense of the origin of causes, namely, 'With the origin of craving, there is the origin of feelings.' One sees the origin of the aggregate of feelings in the sense of the origin of causes, namely, 'With the origin of kamma, there is the origin of feelings.' One sees the origin of the aggregate of feelings in the sense of the origin of causes, namely, 'With the origin of contact, there is the origin of feelings.'
Trong đó, sau khi hiểu biết đúng như thật nghĩa là: “Do sự tập khởi của vô minh mà có sự tập khởi của cảm thọ,” như vậy thấy được sự tập khởi của uẩn cảm thọ theo nghĩa sự tập khởi của duyên; “Do sự tập khởi của tham ái mà có sự tập khởi của cảm thọ,” như vậy thấy được sự tập khởi của uẩn cảm thọ theo nghĩa sự tập khởi của duyên; “Do sự tập khởi của nghiệp mà có sự tập khởi của cảm thọ,” như vậy thấy được sự tập khởi của uẩn cảm thọ theo nghĩa sự tập khởi của duyên; “Do sự tập khởi của xúc mà có sự tập khởi của cảm thọ,” như vậy thấy được sự tập khởi của uẩn cảm thọ theo nghĩa sự tập khởi của duyên.
Nibbattilakkhaṇaṃ passantopi vedanākkhandhassa udayaṃ passatī’’ti imesaṃ pañcannaṃ lakkhaṇānaṃ vasena vedanānaṃ samudayaṃ yathābhūtaṃ viditvā; ‘‘avijjānirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati, taṇhānirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati, kammanirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati, phassanirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati.
Even one who sees the characteristic of arising sees the origin of the aggregate of feelings." Thus, having known truly the origin of feelings in terms of these five characteristics; "With the cessation of ignorance, there is the cessation of feelings." One sees the passing away of the aggregate of feelings in the sense of the cessation of causes, namely, "With the cessation of craving, there is the cessation of feelings." One sees the passing away of the aggregate of feelings in the sense of the cessation of causes, namely, "With the cessation of kamma, there is the cessation of feelings." One sees the passing away of the aggregate of feelings in the sense of the cessation of causes, namely, "With the cessation of contact, there is the cessation of feelings."
Dù thấy được tướng sinh khởi, vẫn thấy được sự tập khởi của uẩn cảm thọ. Sau khi hiểu biết đúng như thật sự tập khởi của các cảm thọ theo năm tướng này; “Do sự diệt của vô minh mà có sự diệt của cảm thọ,” như vậy thấy được sự hoại diệt của uẩn cảm thọ theo nghĩa sự diệt của duyên; “Do sự diệt của tham ái mà có sự diệt của cảm thọ,” như vậy thấy được sự hoại diệt của uẩn cảm thọ theo nghĩa sự diệt của duyên; “Do sự diệt của nghiệp mà có sự diệt của cảm thọ,” như vậy thấy được sự hoại diệt của uẩn cảm thọ theo nghĩa sự diệt của duyên; “Do sự diệt của xúc mà có sự diệt của cảm thọ,” như vậy thấy được sự hoại diệt của uẩn cảm thọ theo nghĩa sự diệt của duyên.
Vipariṇāmalakkhaṇaṃ passantopi vedanākkhandhassa vayaṃ passatī’’ti (paṭi. ma. 1.50) imesaṃ pañcannaṃ lakkhaṇānaṃ vasena vedanānaṃ atthaṅgamaṃ yathābhūtaṃ viditvā, ‘‘yaṃ vedanaṃ paṭicca uppajjati sukhaṃ somanassaṃ, ayaṃ vedanāya assādo’’ti (saṃ. ni. 3.26) evaṃ assādañca yathābhūtaṃ viditvā, ‘‘yaṃ vedanā aniccā dukkhā vipariṇāmadhammā, ayaṃ vedanāya ādīnavo’’ti evaṃ ādīnavañca yathābhūtaṃ viditvā, ‘‘yo vedanāya chandarāgavinayo chandarāgappahānaṃ, idaṃ vedanāya nissaraṇa’’nti evaṃ nissaraṇañca yathābhūtaṃ viditvā vigatachandarāgatāya anupādāno anupādāvimutto, bhikkhave, tathāgato; yasmiṃ upādāne sati kiñci upādiyeyya, upādinnattā ca khandho bhaveyya, tassa abhāvā kiñci dhammaṃ anupādiyitvāva vimutto bhikkhave tathāgatoti.
Even one who sees the characteristic of change sees the passing away of the aggregate of feelings." Thus, having known truly the disappearance of feelings in terms of these five characteristics; "Whatever happiness and joy (somanassa) arise dependent on a feeling, this is the gratification (assāda) of that feeling." Thus, having known truly the gratification; "Whatever feeling is impermanent (anicca), suffering (dukkha), and subject to change (vipariṇāmadhammā), this is the danger (ādīnava) of that feeling." Thus, having known truly the danger; "The removal of desire-passion (chandarāga) for feeling, the abandoning of desire-passion, this is the escape (nissaraṇa) from feeling." Thus, having known truly the escape, the Tathāgata, bhikkhus, is without clinging (anupādāno) and liberated without clinging (anupādāvimutto) due to the disappearance of desire-passion; that is to say, if there were clinging (upādāna), one would cling to something, and due to clinging, there would be an aggregate (khandha), but due to the absence of that, having not clung to any phenomenon, the Tathāgata, bhikkhus, is liberated.
Dù thấy được tướng biến hoại, vẫn thấy được sự hoại diệt của uẩn cảm thọ. Sau khi hiểu biết đúng như thật sự chấm dứt của các cảm thọ theo năm tướng này, và sau khi hiểu biết đúng như thật sự vị ngọt như: “Cảm thọ nào mà do duyên đó có sự an lạc, sự hỷ lạc phát sinh, đó là vị ngọt của cảm thọ”; và sau khi hiểu biết đúng như thật sự nguy hiểm như: “Cảm thọ nào là vô thường, khổ, có bản chất biến hoại, đó là sự nguy hiểm của cảm thọ”; và sau khi hiểu biết đúng như thật sự thoát ly như: “Sự đoạn trừ tham ái, sự từ bỏ tham ái đối với cảm thọ, đó là sự thoát ly khỏi cảm thọ.” Này các Tỳ-khưu, Như Lai là người không chấp thủ, giải thoát khỏi chấp thủ, do đã đoạn trừ tham ái; vì không có chấp thủ nào mà có thể chấp thủ bất cứ điều gì, và do sự chấp thủ đó mà có thể có uẩn, do không có điều đó, Như Lai đã giải thoát mà không chấp thủ bất cứ pháp nào, này các Tỳ-khưu.
37. Ime kho te, bhikkhaveti ye te ahaṃ – ‘‘katame, ca te, bhikkhave, dhammā gambhīrā’’ti apucchiṃ, ‘‘ime kho te, bhikkhave, tañca tathāgato pajānāti tato ca uttaritaraṃ pajānātī’’ti evaṃ niddiṭṭhā sabbaññutaññāṇadhammā gambhīrā duddasā…pe… paṇḍitavedanīyāti veditabbā.
37. These, bhikkhus, are those—meaning those omniscient knowledge-dharmas that I asked about: "What, bhikkhus, are those profound dharmas...?" These, bhikkhus, are to be understood as profound, hard to see, etc., comprehensible by the wise, as thus indicated: "That, too, the Tathāgata knows, and he knows beyond that."
37. Này các Tỳ-khưu, đây là những pháp đó nghĩa là, những pháp toàn tri sâu xa, khó thấy… v.v… chỉ những bậc hiền trí mới cảm nhận được, mà ta đã hỏi: “Này các Tỳ-khưu, những pháp sâu xa đó là gì?”, thì “Này các Tỳ-khưu, đây là những pháp đó, và Như Lai hiểu rõ điều đó, và Ngài hiểu rõ hơn thế nữa,” nên cần phải hiểu.
Yehi tathāgatassa neva puthujjano, na sotāpannādīsu aññataro vaṇṇaṃ yathābhūtaṃ vattuṃ sakkoti, atha kho tathāgatova yathābhūtaṃ vaṇṇaṃ sammā vadamāno vadeyyāti evaṃ pucchamānenāpi sabbaññutaññāṇameva puṭṭhaṃ, niyyātentenāpi tadeva niyyātitaṃ, antarā pana diṭṭhiyo vibhattāti.
By which qualities neither a common person nor any of the noble ones, such as a stream-enterer, can speak of the Tathāgata’s praise as it truly is; but rather, only the Tathāgata, speaking correctly, could speak of his praise as it truly is. Thus, by asking in this way, it was omniscience itself that was asked about; and by entrusting it, it was that very thing that was entrusted. In between, however, the views were analyzed.
Với những phẩm chất mà phàm nhân hay bất kỳ vị nào trong số các bậc Nhập Lưu (Sotāpanna) trở lên đều không thể nói lên được sự thật về Thế Tôn, mà chỉ có Thế Tôn mới có thể nói lên sự thật một cách đúng đắn; khi được hỏi như vậy, chính là hỏi về Tuệ Toàn Tri (sabbaññutaññāṇa), và khi trả lời, cũng chính là trả lời về Tuệ ấy. Trong khoảng giữa, các tà kiến đã được phân tích.
39. Yanti nipātamattaṃ.
39. Yaṃ is just a particle.
39. Yaṃ chỉ là một tiểu từ (nipāta).
Kadācīti kismiñci kāle.
Kadāci means at some time.
Kadāci có nghĩa là vào một thời điểm nào đó.
Karahacīti tasseva vevacanaṃ.
Karahaci is a synonym for that.
Karahaci là một từ đồng nghĩa với từ đó.
Dīghassa addhunoti dīghassa kālassa.
Dīghassa addhuno means of a long time.
Dīghassa addhuno có nghĩa là của một thời gian dài.
Accayenāti atikkamena.
Accayena means with the passing away.
Accayena có nghĩa là sau khi trôi qua.
Saṃvaṭṭatīti vinassati.
Saṃvaṭṭati means it is destroyed.
Saṃvaṭṭati có nghĩa là hoại diệt.
Yebhuyyenāti ye uparibrahmalokesu vā arūpesu vā nibbattanti, tadavasese sandhāya vuttaṃ.
Yebhuyyena refers to those remaining beings who are reborn in the upper brahma worlds or the formless realms.
Yebhuyyena được nói đến để chỉ những chúng sinh còn lại, trừ những vị tái sinh ở các cõi Phạm thiên cao hơn hoặc các cõi vô sắc.
Jhānamanena nibbattattā manomayā. Pīti tesaṃ bhakkho āhāroti pītibhakkhā. Attanova tesaṃ pabhāti sayaṃpabhā. Antalikkhe carantīti antalikkhacarā. Subhesu uyyānavimānakapparukkhādīsu tiṭṭhantīti, subhaṭṭhāyino subhā vā manorammavatthābharaṇā hutvā tiṭṭhantīti subhaṭṭhāyino.
They are manomayā (mind-made) because they are created by the mind of jhāna. They are pītibhakkhā (feeding on rapture) because rapture is their sustenance, their food. They are sayaṃpabhā (self-luminous) because their own light shines. They are antalikkhacarā (traveling through the sky) because they move through space. They are subhaṭṭhāyino (remaining in splendor) because they dwell in splendid places such as parks, mansions, and wish-fulfilling trees, or they are subhaṭṭhāyino because they exist having splendid and delightful belongings and ornaments.
Do được sinh ra bởi thiền định nên họ là manomayā (do ý tạo thành). Hỷ là thức ăn của họ, nên họ là pītibhakkhā (ăn hỷ). Ánh sáng của họ tự phát ra từ chính họ, nên họ là sayaṃpabhā (tự phát quang). Họ đi lại trong không trung, nên họ là antalikkhacarā (đi trong không trung). Họ trú ngụ trong những khu vườn, cung điện, cây như ý đẹp đẽ, nên họ là subhaṭṭhāyino (trú ngụ ở nơi tốt đẹp), hoặc họ là những vị có y phục và trang sức đẹp đẽ, đáng yêu, nên họ là subhaṭṭhāyino (trú ngụ ở nơi tốt đẹp).
Ciraṃ dīghamaddhānanti ukkaṃsena aṭṭha kappe.
Ciraṃ dīghamaddhānaṃ means for at most eight aeons.
Ciraṃ dīghamaddhānaṃ có nghĩa là tối đa tám đại kiếp.
40. Vivaṭṭatīti saṇṭhāti.
40. Vivaṭṭati means it is established.
40. Vivaṭṭati có nghĩa là được thiết lập.
Suññaṃ brahmavimānanti pakatiyā nibbattasattānaṃ natthitāya suññaṃ, brahmakāyikabhūmi nibbattatīti attho.
Suññaṃ brahmavimānaṃ means an empty brahma mansion, empty due to the absence of naturally reborn beings; the meaning is that the plane of the Brahmakāyika devas is reborn.
Suññaṃ brahmavimānaṃ có nghĩa là trống rỗng vì chưa có chúng sinh tự nhiên sinh ra; ý nói, cõi Phạm thiên thuộc thân Phạm thiên (brahmakāyikabhūmi) được hình thành.
Tassa kattā vā kāretā vā natthi, visuddhimagge vuttanayena pana kammapaccayautusamuṭṭhānā ratanabhūmi nibbattati.
It has no creator or instigator; rather, a jewel-ground arises from temperature with kamma as its condition, in the way described in the Visuddhimagga.
Không có người tạo ra hay khiến tạo ra nó; tuy nhiên, theo cách đã nói trong Thanh Tịnh Đạo, một vùng đất quý báu được hình thành do nghiệp duyên và sự phát sinh từ thời tiết.
Pakatinibbattiṭṭhānesuyeva cettha uyyānakapparukkhādayo nibbattanti.
Here, parks, wish-fulfilling trees, and so on are reborn in their natural places of arising.
Trong đó, các khu vườn, cây như ý, v.v., chỉ xuất hiện ở những nơi hình thành tự nhiên.
Atha sattānaṃ pakatiyā vasitaṭṭhāne nikanti uppajjati, te paṭhamajjhānaṃ bhāvetvā tato otaranti, tasmā atha kho aññataro sattotiādimāha.
Then, a fondness arises for the place where beings naturally dwelled; they cultivate the first jhāna and then descend from there. Therefore, he said, “Atha kho aññataro satto,” and so on.
Sau đó, sự thích thú phát sinh ở nơi chúng sinh tự nhiên trú ngụ, họ tu tập thiền định thứ nhất rồi từ đó hạ xuống; vì vậy, Ngài nói: “atha kho aññataro satto” (rồi một chúng sinh khác) và tiếp theo.
Āyukkhayā vā puññakkhayā vāti ye uḷāraṃ puññakammaṃ katvā yattha katthaci appāyuke devaloke nibbattanti, te attano puññabalena ṭhātuṃ na sakkonti, tassa pana devalokassa āyuppamāṇeneva cavantīti āyukkhayā cavantīti vuccanti.
Āyukkhayā vā puññakkhayā vā: Those who, having done superior meritorious kamma, are reborn in any deva world with a short lifespan, are unable to remain by the power of their own merit; they pass away only at the end of the lifespan of that deva world. Thus they are said to pass away through the exhaustion of their lifespan.
Āyukkhayā vā puññakkhayā vā có nghĩa là những chúng sinh đã tạo nghiệp phước lớn, tái sinh vào một cõi trời nào đó có tuổi thọ ngắn, họ không thể trụ lại bằng sức mạnh phước báu của mình, mà họ diệt độ theo tuổi thọ của cõi trời đó, nên được gọi là diệt độ do hết tuổi thọ (āyukkhayā cavanti).
Ye pana parittaṃ puññakammaṃ katvā dīghāyukadevaloke nibbattanti, te yāvatāyukaṃ ṭhātuṃ na sakkonti, antarāva cavantīti puññakkhayā cavantīti vuccanti.
But those who, having done limited meritorious kamma, are reborn in a deva world with a long lifespan, are unable to remain for the full lifespan; they pass away in the interim. Thus they are said to pass away through the exhaustion of their merit.
Còn những chúng sinh đã tạo nghiệp phước ít, tái sinh vào cõi trời có tuổi thọ dài, họ không thể trụ lại hết tuổi thọ, mà diệt độ giữa chừng, nên được gọi là diệt độ do hết phước báu (puññakkhayā cavanti).
Dīghamaddhānaṃ tiṭṭhatīti kappaṃ vā upaḍḍhakappaṃ vā.
Dīghamaddhānaṃ tiṭṭhati means for an aeon or half an aeon.
Dīghamaddhānaṃ tiṭṭhati có nghĩa là một kiếp hoặc nửa kiếp.
41. Anabhiratīti aparassāpi sattassa āgamanapatthanā.
41. Anabhirati is the longing for the arrival of another being.
41. Anabhiratī có nghĩa là mong muốn cho những chúng sinh khác đến.
Yā pana paṭighasampayuttā ukkaṇṭhitā, sā brahmaloke natthi.
But that discontent which is associated with aversion does not exist in the brahma world.
Tuy nhiên, sự chán nản do sân hận thì không có ở cõi Phạm thiên.
Paritassanāti ubbijjanā phandanā, sā panesā tāsatassanā, taṇhātassanā, diṭṭhitassanā, ñāṇatassanāti catubbidhā hoti.
Paritassanā means agitation, trembling. This is of four kinds: trembling from terror, trembling from craving, trembling from wrong view, and trembling from knowledge.
Paritassanā có nghĩa là sự bồn chồn, dao động; sự bồn chồn này có bốn loại: tāsatassanā (bồn chồn do sợ hãi), taṇhātassanā (bồn chồn do tham ái), diṭṭhitassanā (bồn chồn do tà kiến), ñāṇatassanā (bồn chồn do trí tuệ).
Tattha ‘‘jātiṃ paṭicca bhayaṃ bhayānakaṃ chambhitattaṃ lomahaṃso cetaso utrāso.
Among these, “Dependent on birth, there is fear, terror, stiffness, horripilation, alarm of the mind.
Trong đó, “do duyên sinh, có sự sợ hãi, sự kinh hoàng, sự cứng đờ, sự dựng tóc gáy, sự hoảng loạn của tâm.
Jaraṃ… byādhiṃ… maraṇaṃ paṭicca…pe… utrāso’’ti (vibha. 921) ayaṃ tāsatassanā nāma.
Dependent on aging… sickness… death… and so on… alarm”—this is called tāsatassanā (trembling from terror).
Do duyên già… bệnh… chết… v.v… sự hoảng loạn” thì đây gọi là tāsatassanā.
‘‘Aho vata aññepi sattā itthattaṃ āgaccheyyu’’nti (dī. ni. 3.38) ayaṃ taṇhātassanā nāma.
“‘Oh, if only other beings would come to this state!’”—this is called taṇhātassanā (trembling from craving).
“Ôi, ước gì những chúng sinh khác cũng đến được trạng thái này!” thì đây gọi là taṇhātassanā.
‘‘Paritassitavipphanditamevā’’ti ayaṃ diṭṭhitassanā nāma.
“‘It is just anxious trembling’”—this is called diṭṭhitassanā (trembling from wrong view).
“Chỉ là sự bồn chồn và dao động” thì đây gọi là diṭṭhitassanā.
‘‘Tepi tathāgatassa dhammadesanaṃ sutvā yebhuyyena bhayaṃ saṃvegaṃ santāsaṃ āpajjantī’’ti (a. ni. 4.33) ayaṃ ñāṇatassanā nāma.
“‘They too, having heard the Tathāgata’s teaching of the Dhamma, for the most part, experience fear, spiritual urgency, and terror’”—this is called ñāṇatassanā (trembling from knowledge).
“Ngay cả họ, sau khi nghe lời thuyết pháp của Thế Tôn, phần lớn đều rơi vào sự sợ hãi, sự chấn động, sự kinh hoàng” thì đây gọi là ñāṇatassanā.
Idha pana taṇhātassanāpi diṭṭhitassanāpi vaṭṭati.
Here, however, both trembling from craving and trembling from wrong view are applicable.
Ở đây, cả taṇhātassanā và diṭṭhitassanā đều phù hợp.
Brahmavimānanti idha pana paṭhamābhinibbattassa atthitāya suññanti na vuttaṃ.
Brahmavimānaṃ: Here, however, it is not said to be ‘empty’ because of the existence of the first-reborn being.
Brahmavimānaṃ – ở đây, không nói là trống rỗng vì có chúng sinh đầu tiên xuất hiện.
Upapajjantīti upapattivasena upagacchanti.
Upapajjanti means they approach by way of rebirth.
Upapajjanti có nghĩa là đến bằng cách tái sinh.
Sahabyatanti sahabhāvaṃ.
Sahabyataṃ means companionship.
Sahabyataṃ có nghĩa là sự đồng hành.
42. Abhibhūti abhibhavitvā ṭhito jeṭṭhakohamasmīti.
42. Abhibhū means having overcome, I am the chief.
42. Abhibhū có nghĩa là “Ta là bậc tối thượng, vượt trội hơn tất cả”.
Anabhibhūtoti aññehi anabhibhūto.
Anabhibhūto means not overcome by others.
Anabhibhūto có nghĩa là không bị người khác vượt trội.
Aññadatthūti ekaṃsavacane nipāto.
Aññadatthū is a particle used in an absolute sense.
Aññadatthu là một tiểu từ trong lời nói khẳng định.
Dassanavasena daso, sabbaṃ passāmīti attho.
Daso means by way of seeing; the meaning is, ‘I see all’.
Daso theo nghĩa nhìn thấy, tức là “Ta thấy tất cả”.
Vasavattīti sabbaṃ janaṃ vase vattemi.
Vasavattī means I bring all people under my control.
Vasavattī có nghĩa là “Ta kiểm soát tất cả chúng sinh theo ý muốn của mình”.
Issaro kattā nimmātāti ahaṃ loke issaro, ahaṃ lokassa kattā ca nimmātā ca, pathavī – himavanta-sineru-cakkavāḷa-mahāsamudda-candima-sūriyā mayā nimmitāti.
Issaro kattā nimmātā means I am the lord in the world, I am the creator and maker of the world. The earth, Himavanta, Sineru, the Cakkavāḷa, the great ocean, the moon, and the sun were created by me.
Issaro kattā nimmātā có nghĩa là “Ta là chúa tể trong thế gian, Ta là người tạo ra và kiến tạo thế gian. Đất, núi tuyết Himalaya, núi Sineru, thế giới, đại dương, mặt trăng, mặt trời đều do Ta tạo ra”.
Seṭṭho sajitāti ahaṃ lokassa uttamo ca sajitā ca, ‘‘tvaṃ khattiyo nāma hohi, tvaṃ brāhmaṇo, vesso, suddo, gahaṭṭho, pabbajito nāma.
Seṭṭho sajitā means I am the supreme and the arranger of the world. ‘You shall be a khattiya, you a brahmin, a vessa, a sudda, a householder, a renunciant.
Seṭṭho sajitā có nghĩa là “Ta là bậc tối thượng và người phân chia trong thế gian, ‘Ngươi hãy là Khattiya, ngươi là Bà-la-môn, Vessa, Sudda, gia chủ, xuất gia.
Antamaso tvaṃ oṭṭho hohi, goṇo hohī’’ti ‘‘evaṃ sattānaṃ saṃvisajetā aha’’nti maññati.
At the very least, you shall be a camel, you shall be an ox.’ Thus he thinks, ‘I am the one who arranges beings in this way.’
Thậm chí ngươi hãy là lạc đà, ngươi hãy là bò’”. Vị ấy nghĩ: “Ta là người phân chia chúng sinh như vậy”.
Vasī pitā bhūtabhabyānanti (dī. ni. 1.17) ahamasmi ciṇṇavasitāya vasī, ahaṃ pitā bhūtānañca bhabyānañcāti maññati.
Vasī pitā bhūtabhabyānaṃ means he thinks, ‘I am the master due to my mastered control, I am the father of beings past and future.’
Vasī pitā bhūtabhabyānaṃ có nghĩa là vị ấy nghĩ: “Ta là bậc Toàn Năng (vasī) vì đã thực hành sự toàn năng, Ta là cha của tất cả chúng sinh đã sinh và sẽ sinh”.
Tattha aṇḍajajalābujā sattā antoaṇḍakose ceva antovatthimhi ca bhabyā nāma, bahi nikkhantakālato paṭṭhāya bhūtā nāma.
Therein, egg-born and womb-born beings, while inside the eggshell and inside the womb, are called ‘future’; from the time they come out, they are called ‘past’.
Trong đó, các chúng sinh noãn sinh và thấp sinh được gọi là bhabyā (sẽ sinh) khi còn ở trong vỏ trứng và trong tử cung, và được gọi là bhūtā (đã sinh) kể từ khi chúng thoát ra ngoài.
Saṃsedajā paṭhamacittakkhaṇe bhabyā, dutiyato paṭṭhāya bhūtā.
Moisture-born beings are ‘future’ at the first moment of consciousness; from the second moment onwards, they are ‘past’.
Các chúng sinh hóa sinh được gọi là bhabyā ở sát na tâm đầu tiên, và được gọi là bhūtā kể từ sát na thứ hai trở đi.
Opapātikā paṭhamairiyāpathe bhabyā, dutiyato paṭṭhāya bhūtāti veditabbā.
Spontaneously-arisen beings are ‘future’ in the first posture; from the second onwards, they are to be known as ‘past’.
Các chúng sinh hóa sinh được gọi là bhabyā ở oai nghi đầu tiên, và được gọi là bhūtā kể từ oai nghi thứ hai trở đi.
Te sabbepi mayhaṃ puttāti saññāya ‘‘ahaṃ pitā bhūtabhabyāna’’nti maññati.
With the perception that all of them are his children, he thinks, “I am the father of beings past and future.”
Vị ấy nghĩ: “Tất cả chúng sinh đó đều là con của ta”, với nhận thức đó, vị ấy nghĩ: “Ta là cha của tất cả chúng sinh đã sinh và sẽ sinh”.
Idāni kāraṇato sādhetukāmo – ‘‘mayā ime sattā nimmitā’’ti paṭiññaṃ katvā ‘‘taṃ kissa hetū’’tiādimāha.
Now, wishing to establish this through a reason, after making the claim, “These beings were created by me,” he says, “Taṃ kissa hetū,” and so on.
Bây giờ, muốn chứng minh bằng lý do, sau khi tuyên bố: “Những chúng sinh này do ta tạo ra”, vị ấy nói: “Taṃ kissa hetū” (Vì lý do gì?) và tiếp theo.
Itthattanti itthabhāvaṃ, brahmabhāvanti attho.
Itthattaṃ means this state, that is, the state of being a brahma.
Itthattaṃ có nghĩa là trạng thái như vậy, tức là trạng thái Phạm thiên.
Iminā mayanti attano kammavasena cutāpi upapannāpi ca kevalaṃ maññanāmatteneva ‘‘iminā mayaṃ nimmitā’’ti maññamānā vaṅkacchidde vaṅkaāṇī viya onamitvā tasseva pādamūlaṃ gacchantīti.
Iminā mayaṃ: Although they have passed away and been reborn according to their own kamma, merely through this assumption they think, “We were created by him.” Like a crooked peg in a crooked hole, they bow down and go to his feet.
Iminā mayaṃ có nghĩa là những chúng sinh đó, dù đã chết hay tái sinh theo nghiệp của mình, chỉ vì sự tưởng tượng sai lầm mà nghĩ: “Chúng ta do vị này tạo ra”, và họ cúi mình như một cái đinh cong trong một lỗ cong, rồi đi đến chân của vị ấy.
44. Ṭhānaṃ kho panetanti kāraṇaṃ kho panetaṃ.
44. Ṭhānaṃ kho panetaṃ means this is indeed a cause.
44. Ṭhānaṃ kho panetaṃ có nghĩa là đây là lý do.
So tato cavitvā aññatra na gacchati, idheva āgacchati, taṃ sandhāyetaṃ vuttaṃ.
This is said in reference to one who, having passed away from there, does not go elsewhere but comes right here.
Vị ấy sau khi chết từ đó sẽ không đi nơi khác, mà sẽ đến đây; điều này được nói đến để chỉ điều đó.
Agārasmāti gehā.
Agārasmā means from the home.
Agārasmā có nghĩa là từ nhà.
Anagāriyanti pabbajjaṃ.
Anagāriyaṃ means the state of homelessness.
Anagāriyaṃ có nghĩa là sự xuất gia.
Pabbajjā hi yasmā agārassa hi taṃ kasigorakkhādikammaṃ tattha natthi, tasmā anagāriyanti vuccati.
The homeless life is called anagāriya because the work that benefits a home, such as agriculture and cattle-herding, does not exist in it.
Sự xuất gia được gọi là anagāriya (không nhà) vì không có những công việc như nông nghiệp, chăn nuôi, v.v., là công việc của gia đình.
Pabbajatīti upagacchati.
Pabbajati means he goes forth.
Pabbajati có nghĩa là đi đến.
Tato paraṃ nānussaratīti tato pubbenivāsā paraṃ na sarati, sarituṃ asakkonto tattha ṭhatvā diṭṭhiṃ gaṇhāti.
Tato paraṃ nānussarati means he does not recollect beyond that past life. Being unable to recollect, he stays there and grasps a wrong view.
Tato paraṃ nānussarati có nghĩa là vị ấy không nhớ được những kiếp sống trước đó, không thể nhớ được nên giữ lấy tà kiến đó.
Sati sammussatīti khādanīyabhojanīyesu sati sammussati.
Sati sammussatī means that mindfulness concerning food and drink is forgotten or lost.
Sati sammussatī có nghĩa là sự tỉnh giác về đồ ăn thức uống bị quên lãng.
Te kira puññavisesādhigatena mahantena attano sirivibhavena nakkhattaṃ kīḷantā tāya sampattimahantatāya – ‘‘āhāraṃ paribhuñjimha, na paribhuñjimhā’’tipi na jānanti.
Indeed, those devas, while celebrating a festival with their great splendour and abundance attained through special merits, because of the greatness of that fortune, do not even know "Have we eaten food, or have we not eaten?".
Những vị ấy, khi đang vui chơi lễ hội với sự giàu sang vĩ đại của mình, do phước báu đặc biệt mà có được, không biết rằng “chúng ta đã thọ dụng thức ăn hay chưa thọ dụng”.
Atha ekāhārātikkamanato paṭṭhāya nirantaraṃ khādantāpi pivantāpi cavantiyeva, na tiṭṭhanti.
Then, from the moment one meal is missed, even if they eat and drink continuously, they still pass away; they do not remain.
Sau đó, từ khi bỏ lỡ một bữa ăn, dù liên tục ăn và uống, họ vẫn rơi rụng, không thể duy trì.
Kammajatejassa balavatāya, karajakāyassa mandatāya, manussānañhi kammajatejo mando, karajakāyo balavā.
Because the karma-born vital heat (kammajateja) is powerful, and the physical body (karajakāya) is weak. For humans, the karma-born vital heat is weak, and the physical body is strong.
Vì năng lực của nghiệp quá mạnh, và thân thể vật chất thì yếu kém. Thật vậy, năng lực nghiệp của con người yếu, còn thân thể vật chất thì mạnh.
Tesaṃ tejassa mandatāya karajakāyassa balavatāya sattāhampi atikkamitvā uṇhodakaacchayāguādīhi sakkā vatthuṃ upatthambhetuṃ.
For humans, because their vital heat is weak and their physical body is strong, it is possible to sustain the body for even seven days with warm water gruel and other such things.
Vì năng lực nghiệp của họ yếu và thân thể vật chất mạnh, nên có thể duy trì sự sống bằng nước nóng, cháo loãng, v.v., ngay cả khi đã bỏ lỡ bảy ngày.
Devānaṃ pana tejo balavā hoti, karajaṃ mandaṃ.
But for devas, the vital heat is strong, and the physical body is weak.
Nhưng đối với chư thiên, năng lực nghiệp mạnh, còn thân thể vật chất thì yếu.
Te ekaṃ āhāravelaṃ atikkamitvāva saṇṭhātuṃ na sakkonti.
They are unable to remain (alive) even after missing just one mealtime.
Họ không thể duy trì sự sống nếu bỏ lỡ một bữa ăn.
Yathā nāma gimhānaṃ majjhanhike tattapāsāṇe ṭhapitaṃ padumaṃ vā uppalaṃ vā sāyanhasamaye ghaṭasatenāpi siñciyamānaṃ pākatikaṃ na hoti, vinassatiyeva.
Just as a lotus or water-lily placed on a hot rock at midday in summer, even if watered with a hundred pots in the evening, does not become natural again, but perishes.
Giống như một bông sen hay một bông súng đặt trên tảng đá nóng vào giữa trưa mùa hè, dù được tưới hàng trăm gáo nước vào buổi tối, cũng không trở lại trạng thái bình thường mà sẽ héo tàn.
Evameva pacchā nirantaraṃ khādantāpi pivantāpi cavantiyeva, na tiṭṭhanti.
In the same way, even if they eat and drink continuously afterwards, they still pass away; they do not remain.
Cũng vậy, sau đó, dù liên tục ăn và uống, họ vẫn rơi rụng, không thể duy trì.
Tenāha ‘‘satiyā sammosā te devā tamhā kāyā cavantī’’ti.
Therefore, it is said: "Due to the forgetting of mindfulness, those devas pass away from that realm."
Do đó, Đức Phật nói: “Do sự quên lãng của chánh niệm, những vị thiên ấy rơi rụng khỏi cõi ấy”.
Katame pana te devāti?
Which devas are these?
Vậy những vị thiên ấy là ai?
Ime devāti aṭṭhakathāyaṃ vicāraṇā natthi, ‘‘devānaṃ kammajatejo balavā hoti, karajaṃ manda’’nti avisesena vuttattā pana ye keci kabaḷīkārāhārūpajīvino devā evaṃ karonti, teyeva cavantīti veditabbā.
There is no detailed examination in the commentary regarding "these devas". However, since it is stated generally that "the karma-born vital heat of devas is strong, and the physical body is weak," it should be understood that any devas who subsist on material food and act in this way, they are the ones who pass away.
Không có sự phân tích trong bản chú giải về việc những vị này là ai, nhưng vì đã được nói một cách tổng quát rằng “năng lực nghiệp của chư thiên mạnh, còn thân thể vật chất thì yếu”, nên cần hiểu rằng bất kỳ vị thiên nào sống bằng thức ăn vật chất mà hành động như vậy, thì chính những vị ấy sẽ rơi rụng.
Keci panāhu – ‘‘nimmānaratiparanimmitavasavattino te devā’’ti.
Some say, however, "Those devas are the Nimmānaratī and Paranimmittavasavattī devas."
Một số người nói rằng: “Đó là những vị thiên Nimmānaratī và Paranimmitavasavattī.”
Khiḍḍāpadussanamatteneva hete khiḍḍāpadosikāti vuttā.
These are called Khiḍḍāpadosikā merely by being corrupted through excessive sport.
Những vị này được gọi là khiḍḍāpadosikā chỉ vì họ hư hoại do vui chơi.
Sesamettha purimanayeneva veditabbaṃ.
The rest here should be understood according to the previous method.
Phần còn lại ở đây cần được hiểu theo cách đã nói trước.
47-48. Tatiyavāre manena padussanti vinassantīti manopadosikā, ete cātumahārājikā.
47-48. In the third instance, they are corrupted and perish through the mind, hence Manopadosikā. These are the Cātumahārājika devas.
47-48. Trong trường hợp thứ ba, những vị phạm lỗi do tâm ý, bị hư hoại do tâm ý, được gọi là manopadosikā (những vị phạm lỗi do tâm ý). Đó là chư thiên Tứ Đại Thiên Vương.
Tesu kira eko devaputto – nakkhattaṃ kīḷissāmīti saparivāro rathena vīthiṃ paṭipajjati, athañño nikkhamanto taṃ purato gacchantaṃ disvā – ‘bho ayaṃ kapaṇo’, adiṭṭhapubbaṃ viya etaṃ disvā – ‘‘pītiyā uddhumāto viya bhijjamāno viya ca gacchatī’’ti kujjhati.
Among them, it is said that one devaputta, thinking "I shall celebrate a festival," proceeds along the street with his retinue in a chariot. Then another, coming out, sees him going ahead and becomes angry, thinking, "Oh, this wretched one! Seeing this (splendour) as if never seen before, he goes as if inflated with joy and as if bursting apart."
Người ta kể rằng, trong số họ, một vị thiên tử, nghĩ rằng “ta sẽ vui chơi lễ hội”, cùng tùy tùng đi xe ngựa trên đường. Một vị khác, khi đi ra và thấy vị kia đi trước, liền tức giận nói: “Này, vị này là một kẻ khốn khổ! Hắn ta đi như thể chưa từng thấy điều này trước đây, như thể đang phồng lên vì niềm vui, như thể đang vỡ ra!”
Purato gacchantopi nivattitvā taṃ kuddhaṃ disvā – kuddhā nāma suviditā hontīti kuddhabhāvamassa ñatvā – ‘‘tvaṃ kuddho, mayhaṃ kiṃ karissasi, ayaṃ sampatti mayā dānasīlādīnaṃ vasena laddhā, na tuyhaṃ vasenā’’ti paṭikujjhati.
The one going ahead also turns back and, seeing him angry – for the angry are easily recognizable – knowing his anger, retorts, "You are angry! What will you do to me? This fortune was gained by me through acts of generosity, virtue, etc., not through you."
Vị đi trước cũng quay lại, thấy vị kia đang giận dữ, và biết được sự giận dữ của vị kia – vì những người giận dữ thường dễ nhận biết – liền đáp lại một cách giận dữ: “Ngươi đang giận dữ, ngươi có thể làm gì ta? Sự giàu sang này ta có được nhờ bố thí, trì giới, v.v., chứ không phải nhờ ngươi!”
Ekasmiñhi kuddhe itaro akuddho rakkhati, ubhosu pana kuddhesu ekassa kodho itarassa paccayo hoti.
Indeed, when one is angry, the other, being not angry, protects (from passing away), but when both are angry, the anger of one becomes the cause for the other.
Thật vậy, khi một người giận dữ, người kia không giận dữ thì vẫn bảo vệ được. Nhưng khi cả hai đều giận dữ, sự giận dữ của một người trở thành nguyên nhân cho người kia.
Tassapi kodho itarassa paccayo hotīti ubho kandantānaṃyeva orodhānaṃ cavanti.
And the anger of that other also becomes the cause for this one, and thus both pass away while their consorts are lamenting.
Sự giận dữ của người kia cũng trở thành nguyên nhân cho người này, nên cả hai đều rơi rụng khi các cung nữ của họ đang than khóc.
Ayamettha dhammatā.
This is the natural rule in this case.
Đây là quy luật tự nhiên ở đây.
Sesaṃ vuttanayeneva veditabbaṃ.
The rest should be understood according to the method explained.
Phần còn lại cần được hiểu theo cách đã nói.
49-52. Takkīvāde ayaṃ cakkhādīnaṃ bhedaṃ passati, cittaṃ pana yasmā purimaṃ purimaṃ pacchimassa pacchimassa paccayaṃ datvāva nirujjhati, tasmā cakkhādīnaṃ bhedato balavatarampi cittassa bhedaṃ na passati.
49-52. In the Takkīvāda, this one perceives the breaking up of the eye and so on, but since the mind ceases only after giving rise to the preceding and succeeding (moments), it does not perceive the breaking up of the mind, which is even more powerful than the breaking up of the eye and so on.
49-52. Trong thuyết Takkī (Suy luận), người này thấy sự hoại diệt của mắt, v.v., nhưng vì tâm ý luôn diệt đi sau khi làm duyên cho tâm ý kế tiếp, nên người ấy không thấy sự hoại diệt của tâm ý, dù nó mạnh hơn sự hoại diệt của mắt, v.v.
So taṃ apassanto yathā nāma sakuṇo ekaṃ rukkhaṃ jahitvā aññasmiṃ nilīyati, evameva imasmiṃ attabhāve bhinne cittaṃ aññatra gacchatīti gahetvā evamāha.
Not perceiving that (breaking up of the mind), he thinks that just as a bird abandons one tree and settles in another, so too, when this personality (attabhāva) breaks up, the mind goes elsewhere, and having adopted this view, he speaks thus.
Vì không thấy điều đó, người ấy cho rằng, giống như một con chim rời bỏ cây này đậu vào cây khác, khi thân thể này hoại diệt, tâm ý sẽ đi đến nơi khác, và nói như vậy.
Sesamettha vuttanayeneva veditabbaṃ.
The rest here should be understood according to the method explained.
Phần còn lại ở đây cần được hiểu theo cách đã nói.
61. Na maratīti amarā. Kā sā?
61. That which does not die is amarā. What is that?
61. Không chết có nghĩa là amarā (bất tử). Đó là gì?
Evantipi me notiādinā nayena pariyantarahitā diṭṭhigatikassa diṭṭhi ceva vācā ca.
It is the view and speech of one holding a wrong view (diṭṭhigatika), which is boundless according to the method of "It is not so to me" and so on.
Đó là tà kiến và lời nói của người theo tà kiến, không có giới hạn theo cách “đối với tôi không phải thế này”, v.v.
Vividho khepoti vikkhepo, amarāya diṭṭhiyā vācāya ca vikkhepoti amarāvikkhepo, so etesaṃ atthīti amarāvikkhepikā, aparo nayo – amarā nāma ekā macchajāti, sā ummujjananimujjanādivasena udake sandhāvamānā gahetuṃ na sakkāti, evameva ayampi vādo itocito ca sandhāvati, gāhaṃ na upagacchatīti amarāvikkhepoti vuccati.
Vikkhepa means a varied scattering (of words). Amarāvikkhepa means a scattering through an endless view or speech. Those who have this are Amarāvikkhepikā. Another method is: Amarā is a type of fish that, swimming in the water by emerging and submerging, cannot be caught. In the same way, this doctrine also moves from one point to another and does not come to a conclusion, so it is called Amarāvikkhepa.
Sự phân tán đa dạng là vikkhepo. Sự phân tán do tà kiến và lời nói bất tử là amarāvikkhepo. Những người có điều đó được gọi là amarāvikkhepikā. Một cách khác: Amarā là tên một loài cá, nó không thể bắt được khi bơi lội trong nước bằng cách nổi lên lặn xuống, v.v. Cũng vậy, thuyết này cũng chạy từ chỗ này sang chỗ khác, không thể nắm bắt được, nên được gọi là amarāvikkhepo.
So etesaṃ atthīti amarāvikkhepikā.
Those who have this are Amarāvikkhepikā.
Những người có điều đó được gọi là amarāvikkhepikā.
62. ‘‘Idaṃ kusala’’nti yathābhūtaṃ nappajānātīti dasa kusalakammapathe yathābhūtaṃ nappajānātīti attho.
62. "Idaṃ kusala"nti yathābhūtaṃ nappajānātī means he does not know the ten courses of wholesome action as they truly are.
62. “Idaṃ kusala”nti yathābhūtaṃ nappajānātī có nghĩa là không biết mười thiện nghiệp đạo một cách chân thật.
Akusalepi dasa akusalakammapathāva adhippetā.
In the case of unwholesome actions, the ten courses of unwholesome action are also intended.
Đối với bất thiện, cũng ám chỉ mười bất thiện nghiệp đạo.
So mamassa vighātoti ‘‘musā mayā bhaṇita’’nti vippaṭisāruppattiyā mama vighāto assa, dukkhaṃ bhaveyyāti attho.
So mamassa vighāto means "May it be a distress to me that I have spoken falsely"; it would be suffering, is the meaning.
So mamassa vighāto có nghĩa là “tôi đã nói dối”, do sự hối tiếc mà sự phiền não sẽ xảy đến cho tôi, tức là sẽ có khổ đau.
So mamassa antarāyoti so mama saggassa ceva maggassa ca antarāyo assa.
So mamassa antarāyo means that would be an obstacle to my heavenly rebirth and to the path.
So mamassa antarāyo có nghĩa là điều đó sẽ là chướng ngại cho tôi đối với cõi trời và đạo lộ.
Musāvādabhayā musāvādaparijegucchāti musāvāde ottappena ceva hiriyā ca.
Musāvādabhayā musāvādaparijegucchā means from the fear of falsehood, from a loathing of falsehood, (due to moral shame and moral dread).
Musāvādabhayā musāvādaparijegucchā có nghĩa là do hổ thẹn và ghê tởm lời nói dối.
Vācāvikkhepaṃ āpajjatīti vācāya vikkhepaṃ āpajjati.
Vācāvikkhepaṃ āpajjatī means he falls into a vacillation of speech.
Vācāvikkhepaṃ āpajjatī có nghĩa là rơi vào sự phân tán lời nói.
Kīdisaṃ?
What kind?
Loại nào?
Amarāvikkhepaṃ, apariyantavikkhepanti attho.
Amarāvikkhepa, meaning endless vacillation.
Là amarāvikkhepa, tức là sự phân tán vô biên.
Evantipi me notiādīsu evantipi me noti aniyamitavikkhepo.
In Evantipi me no and so on, "evantipi me no" signifies an indeterminate vacillation.
Trong các câu như Evantipi me no, v.v., evantipi me no là sự phân tán không xác định.
Tathātipi me noti ‘‘sassato attā ca loko cā’’ti vuttaṃ sassatavādaṃ paṭikkhipati.
Tathātipi me no rejects the eternalist view which states "the self and the world are eternal."
Tathātipi me no bác bỏ thuyết thường hằng đã nói “tự ngã và thế giới là thường hằng”.
Aññathātipi me noti sassatato aññathā vuttaṃ ekaccasassataṃ paṭikkhipati.
Aññathātipi me no rejects the partial-eternalist view which states "otherwise than eternal."
Aññathātipi me no bác bỏ thuyết một phần thường hằng đã nói khác với thường hằng.
Notipi me noti – ‘‘na hoti tathāgato paraṃ maraṇā’’ti vuttaṃ ucchedaṃ paṭikkhipati.
Notipi me no rejects the annihilationist view which states "the Tathāgata does not exist after death."
Notipi me no bác bỏ thuyết đoạn diệt đã nói “Đức Như Lai không tồn tại sau khi chết”.
No notipi me noti ‘‘neva hoti na na hotī’’ti vuttaṃ takkīvādaṃ paṭikkhipati.
No notipi me no rejects the Takkīvāda view which states "neither does he exist nor does he not exist."
No notipi me no bác bỏ thuyết Takkī đã nói “không tồn tại cũng không không tồn tại”.
Sayaṃ pana ‘‘idaṃ kusala’’nti vā ‘‘akusala’’nti vā puṭṭho na kiñci byākaroti.
However, when asked "Is this wholesome?" or "unwholesome?", he answers nothing.
Còn bản thân người ấy, khi được hỏi “điều này là thiện” hay “bất thiện”, thì không trả lời gì cả.
‘‘Idaṃ kusala’’nti puṭṭho ‘‘evantipi me no’’ti vadati.
When asked "Is this wholesome?", he says "It is not so to me."
Khi được hỏi “Đây là thiện chăng?”, người ấy đáp: “Đối với tôi, điều đó không phải vậy.”
Tato ‘‘kiṃ akusala’’nti vutte ‘‘tathātipi me no’’ti vadati.
Then, when asked "What is unwholesome?", he says "It is not so either."
Khi đó, nếu được hỏi “Điều gì là bất thiện?”, người ấy đáp: “Đối với tôi, điều đó cũng không phải vậy.”
‘‘Kiṃ ubhayato aññathā’’ti vutte ‘‘aññathātipi me no’’ti vadati.
When asked "What is otherwise than both?", he says "It is not otherwise to me."
Nếu được hỏi “Có phải khác với cả hai không?”, người ấy đáp: “Đối với tôi, điều đó cũng không phải khác.”
Tato ‘‘tividhenāpi na hoti, kiṃ te laddhī’’ti vutte ‘‘notipi me no’’ti vadati.
Then, when asked, "Is it not by any of the three ways? What is your doctrine?", he says, "For me, it is also not not so."
Khi đó, nếu được hỏi “Nếu không phải cả ba cách, vậy quan điểm của ông là gì?”, người ấy đáp: “Đối với tôi, điều đó cũng không phải là không.”
Tato ‘‘kiṃ no noti te laddhī’’ti vutte ‘‘no notipi me no’’ti evaṃ vikkhepameva āpajjati, ekasmimpi pakkhe na tiṭṭhati.
Then, when asked, "What is your doctrine, 'not not so'?", he says, "For me, it is also not not not so," and thus falls into equivocation, not standing on any one side.
Khi đó, nếu được hỏi “Vậy quan điểm của ông là không phải không chăng?”, người ấy đáp: “Đối với tôi, điều đó cũng không phải không phải không”, như vậy người ấy chỉ rơi vào tình trạng phân tán lời nói, không đứng vững ở bất kỳ phe nào.
63. Chando vā rāgo vāti ajānantopi sahasā kusalameva ‘‘kusala’’nti vatvā akusalameva ‘‘akusala’’nti vatvā mayā asukassa nāma evaṃ byākataṃ, kiṃ taṃ subyākatanti aññe paṇḍite pucchitvā tehi – ‘‘subyākataṃ, bhadramukha, kusalameva tayā kusalaṃ, akusalameva akusalanti byākata’’nti vutte natthi mayā sadiso paṇḍitoti evaṃ me tattha chando vā rāgo vā assāti attho.
63. Desire or lust (Chando vā rāgo vā) means: even without understanding, having hastily declared wholesome as "wholesome" and unwholesome as "unwholesome," and then asking other wise persons, "I have thus declared to such and such a person, is that well-declared?", and when they say, "It is well-declared, good sir; you have declared the wholesome as wholesome, and the unwholesome as unwholesome," then the meaning is that I might have desire or lust there, thinking "there is no wise person equal to me."
63. Chanda hay rāga (dục hay tham): Dù không biết rõ, nhưng nếu người ấy vội vàng nói rằng điều thiện là thiện, điều bất thiện là bất thiện, rồi hỏi các bậc hiền trí khác rằng: “Tôi đã tuyên bố điều này cho người kia, lời tuyên bố đó có đúng đắn không?”, và nếu họ đáp: “Thưa ngài, lời tuyên bố đó đúng đắn, ngài đã tuyên bố điều thiện là thiện, điều bất thiện là bất thiện”, thì người ấy sẽ nghĩ rằng: “Không có người hiền trí nào sánh bằng tôi”, và như vậy, chanda hay rāga có thể khởi lên nơi người ấy. Đó là ý nghĩa.
Ettha ca chando dubbalarāgo, rāgo balavarāgo.
Here, chanda is weak lust, and rāga is strong lust.
Ở đây, chanda là rāga yếu, rāga là rāga mạnh.
Doso vā paṭigho vāti kusalaṃ pana ‘‘akusala’’nti, akusalaṃ vā ‘‘kusala’’nti vatvā aññe paṇḍite pucchitvā tehi – ‘‘dubyākataṃ tayā’’ti vutte ettakampi nāma na jānāmīti tattha me assa doso vā paṭigho vāti attho.
Hatred or ill-will (Doso vā paṭigho vā) means: on the other hand, having declared wholesome as "unwholesome" or unwholesome as "wholesome," and then asking other wise persons, and when they say, "You have ill-declared," then the meaning is that I might have hatred or ill-will there, thinking "I don't even know this much."
Dosa hay paṭigha (sân hay oán): Ngược lại, nếu người ấy nói điều thiện là bất thiện, hoặc điều bất thiện là thiện, rồi hỏi các bậc hiền trí khác, và nếu họ đáp: “Ngài đã tuyên bố sai”, thì người ấy sẽ nghĩ: “Mình thậm chí không biết được điều này”, và như vậy, dosa hay paṭigha có thể khởi lên nơi người ấy. Đó là ý nghĩa.
Idhāpi doso dubbalakodho, paṭigho balavakodho.
Here too, dosa is weak anger, and paṭigha is strong anger.
Ở đây, dosa là kodha (giận) yếu, paṭigha là kodha mạnh.
Taṃ mamassa upādānaṃ, so mamassa vighātoti taṃ chandarāgadvayaṃ mama upādānaṃ assa, dosapaṭighadvayaṃ vighāto.
That would be my clinging, that would be my vexation (Taṃ mamassa upādānaṃ, so mamassa vighāto): those two, desire and lust, would be my clinging; those two, hatred and ill-will, would be my vexation.
Điều đó sẽ là sự chấp thủ của tôi, điều đó sẽ là sự phiền não của tôi: Cặp chanda-rāga đó sẽ là sự chấp thủ (upādāna) của tôi, cặp dosa-paṭigha đó sẽ là sự phiền não (vighāta) của tôi.
Ubhayampi vā daḷhaggahaṇavasena upādānaṃ, vihananavasena vighāto.
Or both are upādāna in the sense of firm grasping, and vighāta in the sense of tormenting.
Hoặc cả hai đều là upādāna theo nghĩa bám chặt, và là vighāta theo nghĩa gây tổn hại.
Rāgo hi amuñcitukāmatāya ārammaṇaṃ gaṇhāti jalūkā viya.
For rāga grasps the object, like a leech, out of unwillingness to let go.
Tham (rāga) nắm giữ đối tượng như con đỉa, vì không muốn buông ra.
Doso vināsetukāmatāya āsīviso viya.
Dosa destroys, like a venomous snake, out of a desire to annihilate.
Sân (dosa) như rắn độc, vì muốn hủy diệt.
Ubhopi cete santāpakaṭṭhena vihananti yevāti ‘‘upādāna’’nti ca ‘‘vighāto’’ti ca vuttā.
Since both of these torment in the sense of causing distress, they are called "clinging" and "vexation."
Cả hai điều này đều gây tổn hại theo nghĩa gây khổ đau, nên được gọi là “upādāna” và “vighāta”.
Sesaṃ paṭhamavārasadisameva.
The rest is similar to the first instance.
Phần còn lại tương tự như lần đầu tiên.
64. Paṇḍitāti paṇḍiccena samannāgatā.
64. Wise ones (Paṇḍitā): endowed with wisdom.
64. Paṇḍita (người trí): Là những người có trí tuệ.
Nipuṇāti saṇhasukhumabuddhino sukhumaatthantaraṃ paṭivijjhanasamatthā.
Subtle (Nipuṇā): those with delicate and subtle wisdom, capable of penetrating subtle meanings.
Nipuṇa (tinh tế): Là những người có trí tuệ vi tế, khéo léo, có khả năng thấu hiểu những ý nghĩa sâu xa.
Kataparappavādāti viññātaparappavādā ceva parehi saddhiṃ katavādaparicayā ca.
Those who have refuted others' doctrines (Kataparappavādā): those who have understood others' doctrines and are experienced in debate with others.
Kataparappavāda (đã tranh luận với người khác): Là những người đã hiểu rõ giáo lý của người khác và đã có kinh nghiệm tranh luận với họ.
Vālavedhirūpāti vālavedhidhanuggahasadisā.
Like hair-splitters (Vālavedhirūpā): like archers who can split a hair.
Vālavedhirūpa (như những tay bắn tóc): Tương tự như những cung thủ bắn trúng sợi tóc.
Te bhindantā maññeti vālavedhi viya vālaṃ sukhumānipi paresaṃ diṭṭhigatāni attano paññāgatena bhindantā viya carantīti attho.
They, as if, shatter (Te bhindantā maññe): the meaning is that they move about as if shattering even the subtle views of others with their wisdom, like a hair-splitting archer splitting a hair.
Họ như thể đang phá vỡ (Te bhindantā maññe): Có nghĩa là họ hành xử như những cung thủ bắn trúng sợi tóc, phá vỡ những quan điểm vi tế nhất của người khác bằng trí tuệ của mình.
Te maṃ tatthāti te samaṇabrāhmaṇā maṃ tesu kusalākusalesu.
They there, me (Te maṃ tatthā): those ascetics and brahmins, me, regarding those wholesome and unwholesome things.
Họ ở đó với tôi (Te maṃ tatthā): Những Sa-môn, Bà-la-môn đó, trong những điều thiện và bất thiện đó.
Samanuyuñjeyyunti ‘‘kiṃ kusalaṃ, kiṃ akusalanti attano laddhiṃ vadā’’ti laddhiṃ puccheyyuṃ.
Might interrogate (Samanuyuñjeyyu): they might ask about my doctrine, saying, "What is wholesome, what is unwholesome? State your doctrine."
Samanuyuñjeyyuṃ (có thể chất vấn): Họ có thể hỏi về quan điểm của tôi, rằng “Điều gì là thiện, điều gì là bất thiện, hãy nói lên quan điểm của ông.”
Samanugāheyyunti ‘‘idaṃ nāmā’’ti vutte ‘‘kena kāraṇena etamatthaṃ gāheyyu’’nti kāraṇaṃ puccheyyuṃ.
Might press me (Samanugāheyyu): when I say, "It is this," they might ask for the reason, saying, "For what reason do you uphold this meaning?"
Samanugāheyyuṃ (có thể nắm giữ): Nếu tôi nói “Đó là điều này”, họ có thể hỏi về lý do “Vì lý do gì mà ngài chấp nhận ý nghĩa này?”, tức là họ hỏi về nguyên nhân.
Samanubhāseyyunti ‘‘iminā nāma kāraṇenā’’ti vutte kāraṇe dosaṃ dassetvā ‘‘na tvaṃ idaṃ jānāsi, idaṃ pana gaṇha, idaṃ vissajjehī’’ti evaṃ samanuyuñjeyyuṃ.
Might discuss with me (Samanubhāseyyu): when I say, "It is for this reason," they might point out a fault in the reason and say, "You do not know this. Rather, accept this, abandon that," and thus they might discuss.
Samanubhāseyyuṃ (có thể tranh luận): Nếu tôi nói “Vì lý do này”, họ có thể chỉ ra lỗi trong lý do đó và nói “Ngài không biết điều này, hãy chấp nhận điều này, hãy từ bỏ điều kia”, như vậy họ sẽ chất vấn.
Na sampāyeyyanti na sampādeyyaṃ, sampādetvā kathetuṃ na sakkuṇeyyanti attho.
I would not be able to produce it (Na sampāyeyya): I would not be able to produce it; I would not be able to explain it after producing it.
Na sampāyeyyaṃ (không thể hoàn thành): Tôi sẽ không thể hoàn thành, không thể trình bày một cách trọn vẹn.
So mamassa vighātoti yaṃ taṃ punappunaṃ vatvāpi asampāyanaṃ nāma, so mama vighāto assa, oṭṭhatālujivhāgalasosanadukkhameva assāti attho.
That would be my vexation (So mamassa vighāto): the repeated inability to explain, that would be my vexation; it would be the suffering of parched lips, palate, tongue, and throat.
Điều đó sẽ là sự phiền não của tôi (So mamassa vighāto): Việc không thể hoàn thành dù đã nói đi nói lại nhiều lần, điều đó sẽ là sự phiền não của tôi, tức là sự khô môi, khô lưỡi, khô cổ họng, và sự đau khổ sẽ đến với tôi.
Sesametthāpi paṭhamavārasadisameva.
Here too, the rest is similar to the first instance.
Phần còn lại ở đây cũng tương tự như lần đầu tiên.
68-73. Asaññasattāti desanāsīsametaṃ, acittuppādā rūpamattakaattabhāvāti attho.
68-73. Non-percipient beings (Asaññasattā): this is the heading of the discourse, meaning beings whose existence is merely form, without mental formations.
68-73. Asaññasatta (Vô Tưởng Hữu): Đây là tiêu đề của bài giảng, có nghĩa là những chúng sinh chỉ có thân thể vật chất mà không có tâm sinh khởi.
Tesaṃ evaṃ uppatti veditabbā – ekacco hi titthāyatane pabbajitvā vāyokasiṇe parikammaṃ katvā catutthajjhānaṃ nibbattetvā jhānā vuṭṭhāya – ‘‘citte dosaṃ passati, citte sati hatthacchedādidukkhañceva sabbabhayāni ca honti, alaṃ iminā cittena, acittakabhāvova santo’’ti, evaṃ citte dosaṃ passitvā aparihīnajjhāno kālaṃ katvā asaññasattesu nibbattati, cittamassa cuticittanirodhena idheva nivattati, rūpakkhandhamattameva tattha pātubhavati.
Their origination should be understood thus: a certain person, having gone forth into an ascetic path, having practiced the air kasiṇa, having attained the fourth jhāna, and having emerged from the jhāna, perceives a fault in consciousness. He thinks, "When consciousness exists, there are sufferings like the cutting off of hands, and all fears. Enough with this consciousness; a state without consciousness is peaceful." Having thus seen the fault in consciousness, and without falling away from the jhāna, he passes away and is reborn among the non-percipient beings. His consciousness ceases here with the cessation of the dying consciousness, and only a mere aggregate of form appears there.
Sự sinh khởi của họ cần được hiểu như sau: Có một người xuất gia trong giáo phái tà giáo, thực hành kasiṇa về gió, đạt được Tứ Thiền. Sau khi xuất thiền, người ấy thấy lỗi lầm trong tâm: “Khi có tâm, có những đau khổ như bị chặt tay và mọi nỗi sợ hãi. Tâm này vô ích, trạng thái vô tâm mới là an tịnh.” Như vậy, sau khi thấy lỗi lầm trong tâm, người ấy chết mà không bị mất thiền, và tái sinh vào cõi Vô Tưởng Hữu. Tâm của người ấy chấm dứt ngay tại đây cùng với sự diệt của tâm chết, chỉ có sắc uẩn hiện hữu ở đó.
Te tattha yathā nāma jiyāvegakkhitto saro yattako jiyāvego, tattakameva ākāse gacchati.
Just as an arrow shot by the force of a bowstring travels through the air for as long as the force of the bowstring lasts,
Ở đó, họ tồn tại như một mũi tên được bắn ra từ dây cung, bay trong không trung chỉ trong khoảng thời gian tương ứng với lực bắn của dây cung.
Evameva jhānavegakkhittā upapajjitvā yattako jhānavego, tattakameva kālaṃ tiṭṭhanti, jhānavege pana parihīne tattha rūpakkhandho antaradhāyati, idha pana paṭisandhisaññā uppajjati.
so too, these beings, projected by the force of jhāna, are reborn and endure for as long as the force of jhāna lasts. But when the force of jhāna declines, the aggregate of form disappears there, and here, percipient rebirth arises.
Cũng vậy, họ tái sinh nhờ lực thiền định và tồn tại trong khoảng thời gian tương ứng với lực thiền định. Khi lực thiền định suy yếu, sắc uẩn ở đó biến mất, và ở đây, tưởng tái sinh (paṭisandhisaññā) khởi lên.
Yasmā pana tāya idha uppannasaññāya tesaṃ tattha cuti paññāyati, tasmā ‘‘saññuppādā ca pana te devā tamhā kāyā cavantī’’ti vuttaṃ.
Because it is due to this perception arising here that their death there is known, it is said, "And those devas pass away from that body upon the arising of perception."
Vì sự chết của họ ở đó được nhận biết qua sự khởi sinh của tưởng này ở đây, nên đã nói: “Khi tưởng khởi lên, những vị trời đó rời khỏi thân đó.”
Santatāyāti santabhāvāya.
For the sake of being (Santatāyā): for the sake of existence.
Santatāya (để tồn tại): Để có sự tồn tại.
Sesamettha uttānameva.
The rest here is clear.
Phần còn lại ở đây đều rõ ràng.
Takkīvādopi vuttanayeneva veditabboti.
The doctrine of the investigator (Takkīvāda) should also be understood in the manner explained.
Thuyết Takkīvāda cũng cần được hiểu theo cách đã nói.
76-77. Rūpī attātiādīsu kasiṇarūpaṃ ‘‘attā’’ti tattha pavattasaññañcassa ‘‘saññā’’ti gahetvā vā ājīvakādayo viya takkamatteneva vā ‘‘rūpī attā hoti, arogo paraṃ maraṇā saññī’’ti naṃ paññapenti.
Saññī (percipient) is the prevailing doctrine, the saññīvāda (doctrine of the percipient). Those who hold this view are saññīvādā (adherents of the percipient doctrine).
76-77. Trong các câu như Rūpī attā (Tự ngã có sắc), họ tuyên bố rằng “Tự ngã có sắc, không bệnh sau khi chết, có tưởng”, hoặc là do chấp thủ hình sắc kasiṇa là “tự ngã” và tưởng về nó là “tưởng”, hoặc là do suy đoán như các Ājīvaka.
Tattha arogoti nicco.
76-77. In phrases like the self is material (Rūpī attā), they declare it as "the self is material, healthy after death, percipient," either by taking the kasiṇa-form as "self" and the perception arising from it as "perception," or simply by inference, like the Ājīvakas and others.
Ở đây, aroga có nghĩa là thường hằng.
Arūpasamāpattinimittaṃ pana ‘‘attā’’ti samāpattisaññañcassa ‘‘saññā’’ti gahetvā vā nigaṇṭhādayo viya takkamatteneva vā ‘‘arūpī attā hoti, arogo paraṃ maraṇā saññī’’ti naṃ paññapenti.
Here, healthy (arogo) means eternal.
Hoặc họ tuyên bố rằng “Tự ngã vô sắc, không bệnh sau khi chết, có tưởng”, hoặc là do chấp thủ cảnh giới vô sắc là “tự ngã” và tưởng về thiền định là “tưởng”, hoặc là do suy đoán như các Ni-kiền-tử.
Tatiyā pana missakagāhavasena pavattā diṭṭhi.
On the other hand, they declare it as "the self is immaterial, healthy after death, percipient," either by taking the immaterial attainment as "self" and the perception of attainment as "perception," or simply by inference, like the Nigaṇṭhas and others.
Quan điểm thứ ba là quan điểm hỗn hợp.
Catutthā takkagāheneva.
The third view is a doctrine arising from a mixed grasping.
Quan điểm thứ tư chỉ là do suy đoán.
Dutiyacatukkaṃ antānantikavāde vuttanayeneva veditabbaṃ.
The fourth is based solely on inferential grasping.
Nhóm bốn loại thứ hai cần được hiểu theo cách đã nói trong thuyết Antānantika.
Tatiyacatukke samāpannakavasena ekattasaññī, asamāpannakavasena nānattasaññī, parittakasiṇavasena parittasaññī, vipulakasiṇavasena appamāṇasaññīti veditabbā.
In the third tetrad, it should be understood that by way of one who has attained absorption, one is a perceiver of oneness; by way of one who has not attained absorption, a perceiver of diversity; by way of a limited kasiṇa, a perceiver of the limited; and by way of an extensive kasiṇa, a perceiver of the immeasurable.
Trong nhóm bốn thứ ba, cần hiểu rằng: do cách nhập thiền định (samāpanna), là nhất niệm (ekattasaññī); do cách không nhập thiền định (asamāpanna), là đa niệm (nānattasaññī); do cách kasiṇa nhỏ, là tiểu niệm (parittasaññī); do cách kasiṇa rộng lớn, là vô lượng niệm (appamāṇasaññī).
Catutthacatukke pana dibbena cakkhunā tikacatukkajjhānabhūmiyaṃ nibbattamānaṃ disvā ‘‘ekantasukhī’’ti gaṇhāti.
In the fourth tetrad, however, having seen with the divine eye a being reborn in the plane of the third and fourth jhānas, one holds the view: "exclusively happy."
Còn trong nhóm bốn thứ tư, với thiên nhãn (dibba cakkhu), khi thấy một chúng sinh tái sinh trong cảnh giới thiền tam thiền hoặc tứ thiền, người ấy chấp thủ rằng: “Chắc chắn là an lạc tuyệt đối.”
Niraye nibbattamānaṃ disvā ‘‘ekantadukkhī’’ti.
Having seen a being reborn in hell, one holds the view: "exclusively miserable."
Khi thấy một chúng sinh tái sinh trong địa ngục, người ấy chấp thủ rằng: “Chắc chắn là khổ đau tuyệt đối.”
Manussesu nibbattamānaṃ disvā ‘‘sukhadukkhī’’ti.
Having seen a being reborn among humans, one holds the view: "both happy and miserable."
Khi thấy một chúng sinh tái sinh trong loài người, người ấy chấp thủ rằng: “Có an lạc và có khổ đau.”
Vehapphaladevesu nibbattamānaṃ disvā ‘‘adukkhamasukhī’’ti gaṇhāti.
Having seen a being reborn among the Vehapphala devas, one holds the view: "neither-miserable-nor-happy."
Khi thấy một chúng sinh tái sinh trong chư thiên Tịnh Cư (Vehapphala), người ấy chấp thủ rằng: “Không khổ không lạc.”
Visesato hi pubbenivāsānussatiñāṇalābhino pubbantakappikā honti, dibbacakkhukā aparantakappikāti.
Indeed, those who have specifically gained the knowledge of recollecting past lives are speculators on the past, while those with the divine eye are speculators on the future.
Thật vậy, những người có được túc mạng minh (pubbenivāsānussatiñāṇa) là những người chấp thủ về quá khứ (pubbantakappika), còn những người có thiên nhãn (dibbacakkhuka) là những người chấp thủ về tương lai (aparantakappika).
78-83. Asaññīvādo saññīvāde ādimhi vuttānaṃ dvinnaṃ catukkānaṃ vasena veditabbo.
78-83. The doctrine of non-perception should be understood by way of the two tetrads mentioned at the beginning of the doctrine of perception.
Thuyết Vô Tưởng (Asaññīvāda) cần được hiểu theo hai nhóm bốn thứ đã nói ở phần đầu của Thuyết Hữu Tưởng (Saññīvāda).
Tathā nevasaññīnāsaññīvādo.
Likewise, the doctrine of neither-perception-nor-non-perception.
Cũng vậy, Thuyết Phi Tưởng Phi Phi Tưởng (Nevasaññīnāsaññīvāda).
Kevalañhi tattha ‘‘saññī attā’’ti gaṇhantānaṃ tā diṭṭhiyo, idha ‘‘asaññī’’ti ca ‘‘nevasaññīnāsaññī’’ti ca.
The only difference is that there, those views belong to those who hold that "the self is percipient," whereas here, they hold that the self is "non-percipient" and "neither-percipient-nor-non-percipient."
Chỉ khác là, ở đó, những tà kiến đó thuộc về những người chấp thủ rằng “tự ngã là hữu tưởng”, còn ở đây, là “vô tưởng” và “phi tưởng phi phi tưởng”.
Tattha na ekantena kāraṇaṃ pariyesitabbaṃ.
One should not search for a specific reason for this.
Ở đó, không cần phải tìm kiếm nguyên nhân một cách tuyệt đối.
Diṭṭhigatikassa hi gāho ummattakapacchisadisoti vuttametaṃ.
For it has been said that the grasping of one who holds a wrong view is like the basket of a madman.
Điều này đã được nói rằng sự chấp thủ của người có tà kiến giống như cái giỏ của người điên.
84. Ucchedavāde satoti vijjamānassa.
84. In the annihilationist doctrine, of an existing being means of one that is present.
Trong Thuyết Đoạn Kiến (Ucchedavāda), sato nghĩa là của cái đang hiện hữu.
Ucchedanti upacchedaṃ.
Annihilation means being cut off.
Uccheda nghĩa là sự đoạn tuyệt.
Vināsanti adassanaṃ.
Destruction means disappearance.
Vināsa nghĩa là sự không còn thấy.
Vibhavanti bhāvavigamaṃ.
Non-existence means cessation of being.
Vibhava nghĩa là sự chấm dứt hiện hữu.
Sabbānetāni aññamaññavevacanāneva.
All these are synonyms for one another.
Tất cả những từ này đều là đồng nghĩa của nhau.
Tattha dve janā ucchedadiṭṭhiṃ gaṇhanti, lābhī ca alābhī ca.
Therein, two kinds of people hold the annihilationist view: one who has psychic attainments and one who does not.
Ở đây, có hai loại người chấp thủ tà kiến đoạn kiến: người có thần thông và người không có thần thông.
Lābhī arahato dibbena cakkhunā cutiṃ disvā upapattiṃ apassanto, yo vā cutimattameva daṭṭhuṃ sakkoti, na upapātaṃ; so ucchedadiṭṭhiṃ gaṇhāti.
One with psychic attainments, having seen with the divine eye the passing away of an Arahant but not seeing their rebirth, or one who is only able to see the passing away but not the rebirth, holds the annihilationist view.
Người có thần thông, khi dùng thiên nhãn thấy sự chết của một A-la-hán nhưng không thấy sự tái sinh, hoặc người chỉ có thể thấy sự chết mà không thấy sự tái sinh; người ấy chấp thủ tà kiến đoạn kiến.
Alābhī ca ‘‘ko paralokaṃ na jānātī’’ti kāmasukhagiddhatāya vā.
And one without psychic attainments may hold this view out of attachment to sensual pleasures, thinking "Who knows about the next world?"
Còn người không có thần thông thì do tham đắm lạc thú dục vọng, nghĩ rằng “ai biết được thế giới bên kia?”
‘‘Yathā rukkhato paṇṇāni patitāni na puna viruhanti, evameva sattā’’tiādinā takkena vā ucchedaṃ gaṇhāti.
Or one holds the annihilationist view through reasoning, such as: "Just as leaves that have fallen from a tree do not grow back, so it is with beings."
Hoặc do suy luận rằng “như lá cây rụng rồi không mọc lại, chúng sinh cũng vậy,” v.v., người ấy chấp thủ đoạn kiến.
Idha pana taṇhādiṭṭhīnaṃ vasena tathā ca aññathā ca vikappetvāva imā satta diṭṭhiyo uppannāti veditabbā.
Here, however, it should be understood that these seven views have arisen from speculating in various ways through the power of craving and wrong views.
Tuy nhiên, ở đây, cần hiểu rằng bảy tà kiến này phát sinh do sự suy diễn khác nhau dựa trên tham ái và tà kiến.
94. Pañcahi kāmaguṇehīti manāpiyarūpādīhi pañcahi kāmakoṭṭhāsehi bandhanehi vā.
94. By the five cords of sensual pleasure means by the five portions or bonds of sensual pleasure, such as delightful forms and so on.
94. Pañcahi kāmaguṇehī nghĩa là với năm loại dục lạc như sắc đẹp, v.v., hoặc với năm loại trói buộc của dục lạc.
Samappitoti suṭṭhu appito allīno hutvā.
Provided means being well applied, immersed.
Samappito nghĩa là hoàn toàn gắn bó, bám víu.
Samaṅgībhūtoti samannāgato.
Endowed means possessed of.
Samaṅgībhūto nghĩa là đầy đủ.
Paricāretīti tesu kāmaguṇesu yathāsukhaṃ indriyāni cāreti sañcāreti itocito ca upaneti.
Indulges means one directs the sense faculties in those cords of sensual pleasure as one pleases, causing them to wander, leading them from here to there.
Paricāretī nghĩa là tự do vận hành các căn trong các dục lạc đó, di chuyển chúng từ đây đến đó.
Atha vā laḷati ramati kīḷati.
Or else, one enjoys, delights, and plays.
Hoặc là vui chơi, hưởng thụ, đùa giỡn.
Ettha ca duvidhā kāmaguṇā – mānusakā ceva dibbā ca.
And here, the cords of sensual pleasure are of two kinds: human and divine.
Ở đây, có hai loại dục lạc: của loài người và của chư thiên.
Mānusakā mandhātukāmaguṇasadisā daṭṭhabbā, dibbā paranimmitavasavattidevarājassa kāmaguṇasadisāti.
The human ones should be seen as similar to the sensual pleasures of King Mandhātu, and the divine ones as similar to the sensual pleasures of the king of the devas who wield power over the creations of others.
Dục lạc của loài người cần được hiểu như dục lạc của vua Mandhātu, dục lạc của chư thiên như dục lạc của vị Thiên vương Paranimmitavasavattī.
Evarūpe kāme upagatānañhi te diṭṭhadhammanibbānasampattiṃ paññapenti.
For they proclaim the attainment of Nibbāna in this very life for those who have reached such sensual pleasures.
Những người đã đạt đến các dục lạc như vậy thì các vị đó tuyên bố sự thành tựu Niết bàn Hiện pháp.
95. Dutiyavāre hutvā abhāvaṭṭhena aniccā paṭipīḷanaṭṭhena dukkhā, pakatijahanaṭṭhena vipariṇāmadhammāti veditabbā.
95. In the second section, they should be understood as impermanent in the sense of ceasing to exist after having been; miserable in the sense of being oppressive; and subject to change in the sense of abandoning their intrinsic nature.
95. Trong lần thứ hai, cần hiểu rằng: aniccā (vô thường) do trạng thái đã có rồi không còn; dukkhā (khổ) do trạng thái bị áp bức; vipariṇāmadhammā (có pháp biến hoại) do trạng thái từ bỏ bản chất.
Tesaṃ vipariṇāmaññathābhāvāti tesaṃ kāmānaṃ vipariṇāmasaṅkhātā aññathābhāvā, yampi me ahosi, tampi me natthīti vuttanayena uppajjanti sokaparidevadukkhadomanassupāyāsā. Tattha antonijjhāyanalakkhaṇo soko, tannissitalālappanalakkhaṇo paridevo, kāyappaṭipīḷanalakkhaṇaṃ dukkhaṃ, manovighātalakkhaṇaṃ domanassaṃ, visādalakkhaṇo upāyāso, vivicceva kāmehītiādīnamattho visuddhimagge vutto.
Due to their change and alteration means due to the alteration, called change, of those sensual pleasures, in the manner described as "What I once had, I no longer have," there arise sorrow, lamentation, pain, grief, and despair. Therein, sorrow has the characteristic of inner burning; lamentation, the characteristic of wailing dependent on that; pain, the characteristic of bodily affliction; grief, the characteristic of mental distress; despair, the characteristic of despondency. The meaning of "quite secluded from sensual pleasures," etc., is stated in the Visuddhimagga.
Tesaṃ vipariṇāmaññathābhāvā nghĩa là do sự biến hoại, sự thay đổi của các dục lạc đó, theo cách đã nói rằng “những gì tôi đã có, nay tôi không còn nữa”, thì sokaparidevadukkhadomanassupāyāsā (sầu, bi, khổ, ưu, não) phát sinh. Ở đây, sầu (soka) có đặc tính là sự thiêu đốt bên trong; bi (parideva) có đặc tính là sự than khóc dựa trên sầu; khổ (dukkha) có đặc tính là sự áp bức thân thể; ưu (domanassa) có đặc tính là sự phiền não của tâm; não (upāyāsa) có đặc tính là sự thất vọng. Ý nghĩa của “vivicceva kāmehī” v.v. đã được giải thích trong Thanh Tịnh Đạo.
100-104. Idāni – ‘‘imehi kho te, bhikkhave’’ti iminā vārena sabbepi te aparantakappike ekajjhaṃ niyyātetvā sabbaññutaññāṇaṃ vissajjeti.
100-104. Now, with the passage "For these, O bhikkhus," He concludes by gathering together all those speculators on the future and expounds the knowledge of omniscience.
100-104. Bây giờ, với đoạn văn “Này các Tỳ-khưu, những pháp này là gì?” Đức Phật đã quy tụ tất cả những người chấp thủ về tương lai (aparantakappika) lại một chỗ và giải thích về trí tuệ toàn tri (sabbaññutañāṇa).
Puna – ‘‘imehi, kho te bhikkhave’’tiādinā vārena sabbepi te pubbantāparantakappike ekajjhaṃ niyyātetvā tadeva ñāṇaṃ vissajjeti.
Again, with the passage starting "For these, O bhikkhus," He concludes by gathering together all those speculators on the past and the future and expounds that same knowledge.
Sau đó, với đoạn văn “Này các Tỳ-khưu,” v.v., Đức Phật đã quy tụ tất cả những người chấp thủ về quá khứ và tương lai (pubbantāparantakappika) lại một chỗ và giải thích chính trí tuệ đó.
Iti ‘‘katame ca te, bhikkhave, dhammā’’tiādimhi pucchamānopi sabbaññutaññāṇameva pucchitvā vissajjamānopi sattānaṃ ajjhāsayaṃ tulāya tulayanto viya sinerupādato vālukaṃ uddharanto viya dvāsaṭṭhi diṭṭhigatāni uddharitvā sabbaññutaññāṇameva vissajjeti.
Thus, although He asks the question starting "And what, O bhikkhus, are those dhammas?", He asks about the knowledge of omniscience itself. And when answering, as if weighing the dispositions of beings on a scale, as if extracting a grain of sand from the foot of Mount Sineru, He extracts the sixty-two grounds of wrong view and expounds the knowledge of omniscience itself.
Như vậy, dù được hỏi “Này các Tỳ-khưu, những pháp này là gì?”, Đức Phật vẫn hỏi về trí tuệ toàn tri, và khi giải thích, Ngài như cân đo ý chí của chúng sinh trên một cái cân, như lấy cát từ chân núi Sineru, Ngài đã loại bỏ sáu mươi hai tà kiến và giải thích chính trí tuệ toàn tri.
Evamayaṃ yathānusandhivasena desanā āgatā.
In this way, this teaching has proceeded according to the appropriate connection.
Như vậy, bài giảng này đã được trình bày theo sự liên kết.
Tayo hi suttassa anusandhī – pucchānusandhi, ajjhāsayānusandhi, yathānusandhīti.
For there are three kinds of connections in a sutta: the connection of the question, the connection of the disposition, and the appropriate connection.
Thật vậy, có ba loại liên kết của bài kinh: liên kết câu hỏi (pucchānusandhi), liên kết ý chí (ajjhāsayānusandhi), và liên kết theo sự trình bày (yathānusandhi).
Tattha ‘‘evaṃ vutte aññataro bhikkhu bhagavantaṃ etadavoca – kiṃ nu kho, bhante, orimaṃ tīraṃ, kiṃ pārimaṃ tīraṃ, ko majjhe saṃsīdo, ko thale ussādo, ko manussaggāho, ko amanussaggāho, ko āvaṭṭaggāho, ko antopūtibhāvo’’ti (saṃ. ni. 4.241) evaṃ pucchantānaṃ bhagavatā vissajjitasuttavasena pucchānusandhi veditabbo.
Therein, the connection by question should be understood by means of the sutta answered by the Blessed One to those who asked: ‘When this was said, a certain bhikkhu said this to the Blessed One: “Venerable sir, what is the near shore, what is the far shore, what is sinking in the middle, what is running aground on high ground, what is seizure by humans, what is seizure by non-humans, what is seizure by a whirlpool, what is being inwardly rotten?”’
Ở đây, cần hiểu sự liên kết theo câu hỏi (pucchānusandhi) là theo bài kinh mà Đức Thế Tôn đã giải đáp cho những người hỏi như sau: “Thưa Tôn giả, đâu là bờ bên này, đâu là bờ bên kia, ai chìm đắm ở giữa, ai nổi lên trên cạn, ai bị người nắm giữ, ai bị phi nhân nắm giữ, ai bị xoáy nước cuốn đi, ai bị hư hoại từ bên trong?”
Atha kho aññatarassa bhikkhuno evaṃ cetaso parivitakko udapādi – ‘‘iti kira bho rūpaṃ anattā…, vedanā…, saññā…, saṅkhārā …, viññāṇaṃ anattā, anattakatāni kira kammāni kamattānaṃ phusissantī’’ti.
Then a reflection of mind arose thus in a certain bhikkhu: “It seems, sirs, that form is not-self…, feeling…, perception…, formations…, consciousness is not-self. What self, then, will actions done by not-self touch?”
Rồi một Tỳ-khưu nọ có ý nghĩ trong tâm như sau: “Thật vậy, này chư hiền, sắc là vô ngã… thọ… tưởng… các hành… thức là vô ngã. Vậy các nghiệp không do ngã tạo ra sẽ chạm đến ngã nào?”
Atha kho bhagavā tassa bhikkhuno cetasā ceto parivitakkamaññāya bhikkhū āmantesi – ‘‘ṭhānaṃ kho panetaṃ, bhikkhave, vijjati, yaṃ idhekacco moghapuriso avidvā avijjāgato taṇhādhipateyyena cetasā satthusāsanaṃ atidhāvitabbaṃ maññeyya – ‘‘iti kira bho rūpaṃ anattā…pe… phusissantī’’ti.
Then the Blessed One, knowing with his mind the reflection in that bhikkhu's mind, addressed the bhikkhus: “It is possible, bhikkhus, that some worthless person here, being ignorant, overcome by ignorance, with a mind dominated by craving, might think the Teacher’s teaching should be overstepped, thinking: ‘It seems, sirs, that form is not-self… what self, then, will they touch?’”
Rồi Đức Thế Tôn, biết được ý nghĩ trong tâm của Tỳ-khưu ấy bằng tâm của Ngài, liền gọi các Tỳ-khưu và nói: “Này chư Tỳ-khưu, có trường hợp một kẻ ngu si, vô minh, bị vô minh bao phủ, với tâm bị ái chi phối, có thể nghĩ rằng giáo pháp của bậc Đạo sư cần phải vượt qua – ‘Thật vậy, này chư hiền, sắc là vô ngã… (v.v.)… sẽ chạm đến ngã nào?’”
Taṃ kiṃ maññatha, bhikkhave, rūpaṃ niccaṃ vā aniccaṃ vā’’ti (ma. ni. 3.10).
“What do you think, bhikkhus, is form permanent or impermanent?”
“Này chư Tỳ-khưu, các ông nghĩ sao, sắc là thường hay vô thường?”
Evaṃ paresaṃ ajjhāsayaṃ viditvā bhagavatā vuttasuttavasena ajjhāsayānusandhi veditabbo.
In this way, the connection by disposition should be understood by means of the sutta spoken by the Blessed One after knowing the disposition of others.
Như vậy, cần hiểu sự liên kết theo sở nguyện (ajjhāsayānusandhi) là theo bài kinh mà Đức Thế Tôn đã thuyết giảng sau khi biết được ý muốn của người khác.
Yena pana dhammena ādimhi desanā uṭṭhitā, tassa dhammassa anurūpadhammavasena vā paṭipakkhavasena vā yesu suttesu upari desanā āgacchati, tesaṃ vasena yathānusandhi veditabbo.
By whatever Dhamma the teaching arose in the beginning, the connection as appropriate should be understood by means of those suttas where the teaching comes later, either through a Dhamma that is suitable to that Dhamma or through its opposite.
Còn theo pháp mà lời dạy được bắt đầu, thì cần hiểu sự liên kết theo pháp tương ứng hoặc theo pháp đối nghịch mà lời dạy tiếp tục được trình bày trong các bài kinh phía trên.
Seyyathidaṃ, ākaṅkheyyasutte heṭṭhā sīlena desanā uṭṭhitā, upari cha abhiññā āgatā.
For instance, in the Ākaṅkheyyasutta, the teaching arose below with virtue, and the six higher knowledges came later.
Ví dụ như trong kinh Ākaṅkheyya (Ước Nguyện), lời dạy bắt đầu từ giới (sīla) ở phần dưới, và sáu thắng trí (abhiññā) xuất hiện ở phần trên.
Vatthasutte heṭṭhā kilesena desanā uṭṭhitā, upari brahmavihārā āgatā.
In the Vatthasutta, the teaching arose below with defilement, and the divine abodes came later.
Trong kinh Vattha (Tấm Vải), lời dạy bắt đầu từ phiền não (kilesa) ở phần dưới, và các Phạm trú (brahmavihārā) xuất hiện ở phần trên.
Kosambakasutte heṭṭhā bhaṇḍanena uṭṭhitā, upari sāraṇīyadhammā āgatā.
In the Kosambakasutta, it arose below with quarreling, and the principles of cordiality came later.
Trong kinh Kosambaka, lời dạy bắt đầu từ sự tranh cãi (bhaṇḍana) ở phần dưới, và các pháp đáng ghi nhớ (sāraṇīyadhammā) xuất hiện ở phần trên.
Kakacūpame heṭṭhā akkhantiyā uṭṭhitā, upari kakacūpamā āgatā.
In the Kakacūpama Sutta, it arose below with intolerance, and the simile of the saw came later.
Trong kinh Kakacūpama (Ví Dụ Cưa), lời dạy bắt đầu từ sự không nhẫn nại (akkhantiyā) ở phần dưới, và ví dụ về cái cưa (kakacūpamā) xuất hiện ở phần trên.
Imasmimpi brahmajāle heṭṭhā diṭṭhivasena desanā uṭṭhitā, upari suññatāpakāsanaṃ āgataṃ.
In this very Brahmajāla Sutta, the teaching arose below by way of views, and the exposition of emptiness came later.
Trong kinh Phạm Võng (Brahmajāla) này cũng vậy, lời dạy bắt đầu từ tà kiến (diṭṭhi) ở phần dưới, và sự tuyên bố về tánh không (suññatāpakāsanaṃ) xuất hiện ở phần trên.
Tena vuttaṃ – ‘‘evamayaṃ yathānusandhivasena desanā āgatā’’ti.
Therefore it was said: “Thus this teaching has come by way of the appropriate connection.”
Do đó, đã nói rằng: “Như vậy, lời dạy này xuất hiện theo sự liên kết.”
105-117. Idāni mariyādavibhāgadassanatthaṃ – ‘‘tatra bhikkhave’’tiādikā desanā āraddhā.
105-117. Now, to show the division of the boundary, the teaching beginning with “Therein, bhikkhus” was started.
105-117. Bây giờ, để chỉ ra sự phân chia ranh giới, lời dạy bắt đầu với “Này chư Tỳ-khưu, ở đây…” (tatra bhikkhave).
Tadapi tesaṃ bhavataṃ samaṇabrāhmaṇānaṃ ajānataṃ apassataṃ vedayitaṃ taṇhāgatānaṃ paritassitavipphanditamevāti yena diṭṭhiassādena diṭṭhisukhena diṭṭhivedayitena te somanassajātā sassataṃ attānañca lokañca paññapenti catūhi vatthūhi, tadapi tesaṃ bhavantānaṃ samaṇabrāhmaṇānaṃ yathābhūtaṃ dhammānaṃ sabhāvaṃ ajānantānaṃ apassantānaṃ vedayitaṃ taṇhāgatānaṃ kevalaṃ taṇhāgatānaṃyeva taṃ vedayitaṃ, tañca kho panetaṃ paritassitavipphanditameva.
That too, for those venerable samaṇas and brāhmaṇas, is the feeling of those who do not know, who do not see, who are overcome by craving; it is but agitated floundering. By whatever pleasure of view, happiness of view, feeling of view they become glad and proclaim the self and the world to be eternal on four grounds—that too is the feeling of those venerable samaṇas and brāhmaṇas who do not know, who do not see the true nature of dhammas, who are overcome by craving. It is merely the feeling of those who are overcome by craving, and indeed, it is but agitated floundering.
“Ngay cả điều đó cũng là sự lo âu và dao động của những Sa-môn, Bà-la-môn ấy, những người không biết, không thấy, bị ái chi phối bởi cảm thọ” – Với niềm vui thích về tà kiến (diṭṭhiassādena), với sự an lạc về tà kiến (diṭṭhisukhena), với cảm thọ về tà kiến (diṭṭhivedayitena) mà họ vui mừng, tuyên bố về tự ngã và thế gian là thường còn qua bốn trường hợp, ngay cả cảm thọ đó của những Sa-môn, Bà-la-môn ấy, những người không biết, không thấy bản chất của các pháp như thực, chỉ là cảm thọ bị ái chi phối, và cảm thọ đó cũng chỉ là sự lo âu và dao động.
Diṭṭhisaṅkhātena ceva taṇhāsaṅkhātena ca paritassitena vipphanditameva calitameva kampitameva thusarāsimhi nikhātakhāṇusadisaṃ, na sotāpannassa dassanamiva niccalanti dasseti.
He shows that through the agitation designated as view and designated as craving, it is merely floundering, merely wavering, merely trembling, like a stake driven into a pile of chaff; it is not unshakeable like the vision of a stream-enterer.
Điều đó có nghĩa là sự dao động, rung chuyển, lay động bởi sự lo âu, tức là tà kiến và ái, giống như một cái cọc đóng trong đống trấu, không vững chắc như cái thấy của bậc Nhập lưu (Sotāpanna).
Esa nayo ekaccasassatavādādīsupi.
This is the method also in the cases of the partial-eternalist views and so on.
Nguyên tắc này cũng tương tự đối với các trường hợp như nhất phần thường kiến (ekaccasassatavāda) và các trường hợp khác.
131-143. Idāni tassa paccayassa diṭṭhivedayite balavabhāvadassanatthaṃ puna – ‘‘tatra, bhikkhave, ye te samaṇabrāhmaṇā sassatavādā’’tiādimāha.
131-143. Now, to show the powerful nature of that condition in the feeling of view, he again said the passage beginning with “Therein, bhikkhus, those samaṇas and brāhmaṇas who are eternalists.”
131-143. Bây giờ, để chỉ ra sức mạnh của duyên đó đối với cảm thọ về tà kiến, Đức Thế Tôn lại nói: “Này chư Tỳ-khưu, ở đây, những Sa-môn, Bà-la-môn nào là thường kiến giả…”
Tattha te vata aññatra phassāti te vata samaṇabrāhmaṇā taṃ vedayitaṃ vinā phassena paṭisaṃvedissantīti kāraṇametaṃ natthīti.
Therein, that they, apart from contact: that those samaṇas and brāhmaṇas will experience that feeling without contact—this is no cause.
Ở đây, “họ không thể cảm thọ nếu không có xúc” – Điều đó có nghĩa là không có lý do gì để những Sa-môn, Bà-la-môn ấy cảm thọ cảm thọ đó mà không có xúc.
Yathā hi patato gehassa upatthambhanatthāya thūṇā nāma balavapaccayo hoti, na taṃ thūṇāya anupatthambhitaṃ ṭhātuṃ sakkoti, evameva phassopi vedanāya balavapaccayo, taṃ vinā idaṃ diṭṭhivedayitaṃ natthīti dasseti.
Just as a pillar is a powerful condition for propping up a collapsing house, and that house cannot stand unpropped by the pillar, so too is contact a powerful condition for feeling. He shows that without it, this feeling of view does not exist.
Giống như một cây cột là duyên mạnh mẽ để chống đỡ một ngôi nhà sắp đổ, không có cây cột đó thì ngôi nhà không thể đứng vững; cũng vậy, xúc là duyên mạnh mẽ cho cảm thọ, không có xúc thì cảm thọ về tà kiến này không tồn tại.
Esa nayo sabbattha.
This is the method in all cases.
Nguyên tắc này áp dụng cho tất cả.
144. Idāni tatra bhikkhave, ye te samaṇabrāhmaṇā sassatavādā sassataṃ attānañca lokañca paññapenti catūhi vatthūhi, yepi te samaṇabrāhmaṇā ekaccasassatikātiādinā nayena sabbadiṭṭhivedayitāni sampiṇḍeti.
144. Now, with the passage starting “Therein, bhikkhus, those samaṇas and brāhmaṇas who are eternalists and proclaim the self and the world to be eternal on four grounds; and also those samaṇas and brāhmaṇas who are partial-eternalists,” by this method, he summarizes all feelings of views.
144. Bây giờ, Đức Thế Tôn tổng hợp tất cả các cảm thọ về tà kiến theo cách: “Này chư Tỳ-khưu, ở đây, những Sa-môn, Bà-la-môn nào là thường kiến giả, tuyên bố về tự ngã và thế gian là thường còn qua bốn trường hợp; và những Sa-môn, Bà-la-môn nào là nhất phần thường kiến giả…”
Upari phasse pakkhipanatthāya.
For the purpose of including them in contact later on.
Để đưa chúng vào xúc ở phần trên.
Kathaṃ?
How?
Bằng cách nào?
Sabbe te chahi phassāyatanehi phussa phussa paṭisaṃvedentīti.
All of them experience by repeatedly making contact through the six bases for contact.
Tất cả họ đều cảm thọ bằng cách liên tục tiếp xúc với sáu xứ xúc.
Tattha cha phassāyatanāni nāma – cakkhuphassāyatanaṃ, sotaphassāyatanaṃ, ghānaphassāyatanaṃ, jivhāphassāyatanaṃ, kāyaphassāyatanaṃ, manophassāyatananti imāni cha.
Therein, the six bases for contact are these six: the base for eye-contact, the base for ear-contact, the base for nose-contact, the base for tongue-contact, the base for body-contact, and the base for mind-contact.
Ở đây, sáu xứ xúc (phassāyatana) là: xứ xúc nhãn, xứ xúc nhĩ, xứ xúc tỷ, xứ xúc thiệt, xứ xúc thân, xứ xúc ý – đây là sáu.
Sañjāti-samosaraṇa-kāraṇa-paṇṇattimattatthesu hi ayaṃ āyatanasaddo pavattati.
For this term āyatana functions in the meanings of place of origin, place of meeting, cause, and mere designation.
Thật vậy, từ “āyatana” này được dùng trong các nghĩa: nơi phát sinh, nơi hội tụ, nguyên nhân, và chỉ là sự quy ước.
Tattha – ‘‘kambojo assānaṃ āyatanaṃ, gunnaṃ dakkhiṇāpatho’’ti sañjātiyaṃ pavattati, sañjātiṭṭhāneti attho.
Therein, in “Kamboja is the āyatana for horses, the Deccan for cattle,” it functions in the sense of place of origin; the meaning is place of birth.
Ở đây, “Kamboja là xứ của ngựa, Dakkhināpatha là xứ của bò” – được dùng theo nghĩa nơi phát sinh, tức là nơi sinh ra.
‘‘Manorame āyatane, sevanti naṃ vihaṅgamā’’ti (a. ni. 5.38) samosaraṇe.
In “Birds frequent it in the delightful āyatana,” it is in the sense of a meeting place.
“Ở nơi āyatana an lạc, chim chóc tụ tập” – theo nghĩa nơi hội tụ.
‘‘Sati satiāyatane’’ti (a. ni. 3.102) kāraṇe.
In “When there is an āyatana for mindfulness,” it is in the sense of cause.
“Khi có āyatana, có chánh niệm” – theo nghĩa nguyên nhân.
‘‘Araññāyatane paṇṇakuṭīsu sammantī’’ti (saṃ. ni. 1.255) paṇṇattimatte.
In “They dwell peacefully in leaf huts in the āyatana of the forest,” it is in the sense of a mere designation.
“Trong các āyatana rừng, họ sống an lạc trong các túp lều lá” – theo nghĩa chỉ là sự quy ước.
Svāyamidha sañjātiādiatthattayepi yujjati.
Here, it is suitable in all three meanings beginning with place of origin.
Từ này ở đây phù hợp với cả ba nghĩa: nơi phát sinh, v.v.
Cakkhādīsu hi phassapañcamakā dhammā sañjāyanti samosaranti, tāni ca tesaṃ kāraṇanti āyatanāni.
For in the eye and so on, the dhammas of which contact is the fifth originate and meet, and these are their cause; hence, they are āyatanas.
Thật vậy, trong nhãn, v.v., các pháp có xúc là thứ năm phát sinh và hội tụ; và chúng là nguyên nhân của những pháp đó, nên chúng được gọi là āyatana.
Idha pana ‘‘cakkhuñca paṭicca rūpe ca uppajjati cakkhuviññāṇaṃ, tiṇṇaṃ saṅgati phasso’’ti (saṃ. ni. 2.43) iminā nayena phassasīseneva desanaṃ āropetvā phassaṃ ādiṃ katvā paccayaparamparaṃ dassetuṃ phassāyatanādīni vuttāni.
Here, however, the bases for contact and so on are mentioned to show the succession of conditions beginning with contact, after having presented the teaching with contact itself as the head by the method of “Conditioned by the eye and forms, eye-consciousness arises; the meeting of the three is contact.”
Tuy nhiên, ở đây, bằng cách đưa lời dạy lên hàng đầu với xúc, và lấy xúc làm khởi điểm để chỉ ra duyên hệ tương tục theo cách “do duyên nhãn và sắc mà nhãn thức phát sinh, sự hòa hợp của ba thứ là xúc”, các xứ xúc, v.v., đã được nói đến.
Tesaṃ vedanāpaccayā taṇhātiādīsu vedanāti cha phassāyatanasambhavā vedanā.
In the passage “Conditioned by their feeling, craving arises,” and so on, feeling means the feeling that arises from the six bases for contact.
Trong các câu như “Do duyên cảm thọ mà có ái”, cảm thọ là cảm thọ phát sinh từ sáu xứ xúc.
Sā rūpataṇhādibhedāya taṇhāya upanissayakoṭiyā paccayo hoti.
It is a condition, as a decisive support condition, for craving, which is differentiated as craving for forms and so on.
Thọ ấy là duyên theo cách cận y duyên cho ái, có sự phân biệt như sắc ái, v.v.
Tena vuttaṃ – ‘‘tesaṃ vedanāpaccayā taṇhā’’ti.
Therefore it was said: “For them, with feeling as condition, craving*.”
Do đó, đã nói rằng: “Do duyên thọ mà có ái của các pháp ấy.”
Sā pana catubbidhassa upādānassa upanissayakoṭiyā ceva sahajātakoṭiyā ca paccayo hoti.
And it is a condition for the fourfold clinging both as a decisive support condition and as a conascence condition.
Còn thọ ấy là duyên theo cách cận y duyên và đồng sanh duyên cho bốn loại thủ.
Tathā upādānaṃ bhavassa.
Similarly, clinging is for becoming.
Tương tự, thủ là duyên cho hữu.
Bhavo jātiyā upanissayakoṭiyā paccayo hoti.
Becoming is a condition, as a decisive support condition, for birth.
Hữu là duyên theo cách cận y duyên cho sanh.
Jātīti panettha savikārā pañcakkhandhā daṭṭhabbā, jāti jarāmaraṇassa ceva sokādīnañca upanissayakoṭiyā paccayo hoti.
Here, by birth, the five aggregates along with their modifications should be understood. Birth is a condition, as a decisive support condition, for aging and death, and also for sorrow and so on.
Ở đây, cần hiểu sanh (jāti) là năm uẩn có sự biến đổi; sanh là duyên theo cách cận y duyên cho già, chết và sầu khổ, v.v.
Ayamettha saṅkhepo, vitthārato pana paṭiccasamuppādakathā visuddhimagge vuttā.
This is the summary here; but the detailed exposition on dependent origination is given in the Visuddhimagga.
Đây là tóm tắt ở đây, còn chi tiết về câu chuyện duyên khởi đã được nói trong Thanh Tịnh Đạo.
Idha panassa payojanamattameva veditabbaṃ.
Here, however, only its purpose should be understood.
Ở đây, chỉ cần biết mục đích của nó.
Bhagavā hi vaṭṭakathaṃ kathento – ‘‘purimā, bhikkhave, koṭi na paññāyati avijjāya, ‘ito pubbe avijjā nāhosi, atha pacchā samabhavī’ti evañcetaṃ, bhikkhave, vuccati, atha ca pana paññāyati ‘‘idappaccayā avijjā’’ti (a. ni. 10.61) evaṃ avijjāsīsena vā, purimā, bhikkhave, koṭi na paññāyati bhavataṇhāya…pe… ‘‘idappaccayā bhavataṇhā’’ti (a. ni. 10.62) evaṃ taṇhāsīsena vā, purimā, bhikkhave, koṭi na paññāyati bhavadiṭṭhiyā…pe… ‘‘idappaccayā bhavadiṭṭhī’’ti evaṃ diṭṭhisīsena vā kathesi’’.
For the Blessed One, when speaking on the cycle of existence, spoke either with ignorance as the head, thus: “Monks, the prior point of ignorance is not discerned,* ‘Before this, ignorance was not; it came to be afterwards.’ And yet, monks, although this is said, it is still discerned that ‘Ignorance is conditioned by this.’ (A. Ni. 10.61)”; or with craving as the head, thus: “Monks, the prior point of craving for becoming is not discerned… and so on… ‘Craving for becoming is conditioned by this.’ (A. Ni. 10.62)”; or with view as the head, thus: “Monks, the prior point of the view of becoming is not discerned… and so on… ‘The view of becoming is conditioned by this.’”
Khi Đức Thế Tôn thuyết về vòng luân hồi, Ngài đã nói: “Này các tỳ khưu, không thể biết được điểm khởi đầu của vô minh, không thể nói rằng ‘trước đây không có vô minh, sau đó mới sanh khởi’, nhưng này các tỳ khưu, có thể biết rằng ‘do duyên này mà có vô minh’,” như vậy là Ngài đã thuyết theo cách lấy vô minh làm đầu, hoặc “Này các tỳ khưu, không thể biết được điểm khởi đầu của hữu ái… do duyên này mà có hữu ái,” như vậy là Ngài đã thuyết theo cách lấy ái làm đầu, hoặc “Này các tỳ khưu, không thể biết được điểm khởi đầu của hữu kiến… do duyên này mà có hữu kiến,” như vậy là Ngài đã thuyết theo cách lấy kiến làm đầu.
Idha pana diṭṭhisīsena kathento vedanārāgena uppajjamānā diṭṭhiyo kathetvā vedanāmūlakaṃ paṭiccasamuppādaṃ kathesi.
Here, however, speaking with view as the head, having spoken of the views that arise through delight in feeling, he spoke of dependent origination with feeling as its root.
Ở đây, khi thuyết theo cách lấy kiến làm đầu, Ngài đã nói về các tà kiến sanh khởi do tham ái đối với thọ, rồi thuyết về duyên khởi có gốc là thọ.
Tena idaṃ dasseti – ‘‘evamete diṭṭhigatikā, idaṃ dassanaṃ gahetvā tīsu bhavesu catūsu yonīsu pañcasu gatīsu sattasu viññāṇaṭṭhitīsu navasu sattāvāsesu ito ettha etto idhāti sandhāvantā saṃsarantā yante yuttagoṇo viya, thambhe upanibaddhakukkuro viya, vātena vippannaṭṭhanāvā viya ca vaṭṭadukkhameva anuparivattanti, vaṭṭadukkhato sīsaṃ ukkhipituṃ na sakkontī’’ti.
By this he shows: “Thus these holders of views, having grasped this view, wander and transmigrate through the three kinds of becoming, the four kinds of birth, the five destinations, the seven stations of consciousness, and the nine abodes of beings,* ‘from here to there, from there to here.’ Like an ox yoked to a mill, like a dog tied to a post, and like a ship lost at sea in a storm, they just revolve through the suffering of the cycle of existence; they are unable to lift their heads from the suffering of the cycle of existence.”
Do đó, điều này được chỉ ra: “Những người theo tà kiến như vậy, chấp thủ cái thấy này, lang thang, luân chuyển trong ba cõi, bốn loài, năm đường, bảy trú xứ của thức, chín trú xứ của chúng sanh, từ đây đến đó, từ đó đến đây, giống như con bò kéo xe dầu, giống như con chó bị cột vào cột, giống như con thuyền bị gió thổi lạc hướng, chỉ xoay vần trong khổ đau của luân hồi, không thể ngẩng đầu thoát khỏi khổ đau của luân hồi.”