Atthato pana evaṃsaddo tāva upamūpadesa-sampahaṃsana-garahaṇavacana-sampaṭiggahākāranidassanāvadhāraṇādi-anekatthappabhedo.
In terms of meaning, the word evaṃ has many distinct meanings such as comparison, instruction, encouragement, censure, acceptance of speech, manner, indication, and emphasis.
Về mặt ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như so sánh, chỉ dẫn, tán thán, khiển trách, chấp thuận, chỉ phương cách, minh họa, xác định, v.v.
Tathā hesa ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti evamādīsu (dha. pa. 53) upamāyaṃ āgato.
For instance, it appears in the sense of comparison in passages like "evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu" (By one thus born, much wholesome karma should be done), and so on.
Chẳng hạn, trong câu “evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu” (Pháp Cú 53), từ này mang nghĩa so sánh.
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In the sense of instruction in passages like "Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ" (Thus you should go forward, thus you should retreat), and so on.
Trong câu “evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ” (A. Ni. 4.122), nó mang nghĩa chỉ dẫn.
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In the sense of encouragement in passages like "Evametaṃ bhagavā, evametaṃ sugata" (It is so, Blessed One; it is so, Sugata), and so on.
Trong câu “evametaṃ bhagavā, evametaṃ sugatā” (A. Ni. 3.66), nó mang nghĩa tán thán.
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In the sense of censure in passages like "Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī" (Just so, this wretched woman, wherever she may be, speaks in praise of that shaven-headed ascetic), and so on.
Trong câu “evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsati” (Saṃ. Ni. 1.187), nó mang nghĩa khiển trách.
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In the sense of acceptance of speech in passages like "Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ" (“Yes, venerable sir,” those bhikkhus replied to the Blessed One), and so on.
Trong câu “evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ” (Ma. Ni. 1.1), nó mang nghĩa chấp thuận lời nói.
‘‘Evaṃ byākho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In the sense of manner in passages like "Evaṃ byākho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī" (Indeed, venerable sir, I understand the Dhamma taught by the Blessed One in this manner), and so on.
Trong câu “evaṃ byākho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī” (Ma. Ni. 1.398), nó mang nghĩa chỉ phương cách.
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama; upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ…pe… phāsuvihāraṃ pucchatī’ti, evañca vadehi ‘‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’tiādīsu (dī. ni. 1.445) nidassane.
In the sense of indication in passages like "Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama; upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ…pe… phāsuvihāraṃ pucchatī’ti, evañca vadehi ‘‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’ti" (Come, young man, approach the recluse Ānanda. Having approached, ask in my name about the recluse Ānanda’s freedom from illness, freedom from affliction, lightness of body, strength, and comfortable living, saying: ‘The young man Subha, son of Todeyya, asks the venerable Ānanda about his freedom from illness…pe… comfortable living.’ And also say this: ‘Let the venerable Ānanda, out of compassion, please approach the residence of the young man Subha, son of Todeyya.’), and so on.
Trong câu “Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama; upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ…pe… phāsuvihāraṃ pucchatī’ti, evañca vadehi ‘‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’ti” (Dī. Ni. 1.445), nó mang nghĩa minh họa.
‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti?
In the sense of emphasis in passages like "Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti?
“Này các vị Kālāma, các ông nghĩ thế nào, những pháp này là thiện hay bất thiện?
Akusalā, bhante.
Akusalā, bhante.
Thưa Tôn giả, là bất thiện.
Sāvajjā vā anavajjā vāti?
Sāvajjā vā anavajjā vāti?
Là có tội hay không có tội?
Sāvajjā, bhante.
Sāvajjā, bhante.
Thưa Tôn giả, là có tội.
Viññugarahitā vā viññuppasatthā vāti?
Viññugarahitā vā viññuppasatthā vāti?
Bị người trí chê bai hay được người trí tán thán?
Viññugarahitā, bhante.
Viññugarahitā, bhante.
Thưa Tôn giả, bị người trí chê bai.
Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti?
Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti?
Khi được thực hành và chấp nhận, chúng có dẫn đến bất hạnh và đau khổ không, hay là không? Các ông nghĩ thế nào về điều này?”
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’ti" (What do you think, Kālāmas? Are these things wholesome or unwholesome? Unwholesome, venerable sir. Blameworthy or blameless? Blameworthy, venerable sir. Condemned by the wise or praised by the wise? Condemned by the wise, venerable sir. When taken up and put into practice, do they lead to harm and suffering, or not? How does it seem to you in this matter? When taken up and put into practice, venerable sir, they lead to harm and suffering. This is how it seems to us in this matter.), and so on.
“Thưa Tôn giả, khi được thực hành và chấp nhận, chúng dẫn đến bất hạnh và đau khổ, chúng tôi nghĩ như vậy về điều này.” Trong những câu như thế (A. Ni. 3.66), nó mang nghĩa xác định.
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Here, it should be understood in the sense of manner, indication, and emphasis.
Ở đây, từ này nên được hiểu theo nghĩa chỉ phương cách, minh họa, và xác định.
Avadhāraṇatthena ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, satimantānaṃ, gatimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.219, 223) evaṃ bhagavatā, ‘‘āyasmā ānando atthakusalo dhammakusalo byañjanakusalo niruttikusalo pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti ‘‘evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva, na aññathā daṭṭhabba’’nti.
Wishing to show his own power of retention, in accordance with the praise bestowed by the Blessed One, "Among my bhikkhu disciples, monks, who are learned, Ānanda is foremost; among those who are mindful, Ānanda is foremost; among those who are intelligent, Ānanda is foremost; among those who are resolute, Ānanda is foremost; among those who are attendants, Ānanda is foremost," and by the Dhamma General, "The Venerable Ānanda is skilled in meaning, skilled in Dhamma, skilled in expression, skilled in etymology, skilled in sequence," he generates in beings the desire to hear, saying: "Thus have I heard, and that which was heard should be understood as exactly so, neither less nor more, and not otherwise."
Với ý nghĩa xác định, Đức Thế Tôn đã tán thán rằng: ‘‘Này các Tỳ-kheo, trong số các đệ tử Tỳ-kheo của Ta, những người đa văn, có niệm, có trí, có dũng, và là thị giả, Ānanda là bậc tối thượng’’. Và Đức Pháp Tướng đã tán thán rằng: ‘‘Tôn giả Ānanda thiện xảo về nghĩa, thiện xảo về pháp, thiện xảo về văn, thiện xảo về ngữ nguyên, thiện xảo về trước sau’’. Phù hợp với sự tán thán như vậy, Ngài Ānanda muốn thể hiện năng lực ghi nhớ của mình, khiến chúng sanh khởi tâm muốn nghe, (rằng) ‘‘Như vầy tôi đã nghe, và bài kinh đó không thiếu, không thừa, không sai lệch về nghĩa hay về văn, chỉ là như vậy, không nên hiểu khác’’.
Mesaddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me xuất hiện với ba ý nghĩa.
Tathā hissa ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81; saṃ. ni. 1.194) mayāti attho.
For instance, in phrases such as "That which is obtained by chanting is not for me to eat," the meaning is "by me."
Quả thật, trong các câu như ‘‘Thức ăn do ca tụng mà có, tôi không nên thọ dụng (gāthābhigītaṃ me abhojaneyya)’’, có nghĩa là ‘do tôi’ (mayā).
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In phrases such as "It would be good, venerable sir, if the Blessed One would teach me the Dhamma in brief," the meaning is "for me."
Trong các câu như ‘‘Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp tóm tắt cho con (sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū)’’ có nghĩa là ‘cho tôi’ (mayhaṃ).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases such as "Be heirs to the Dhamma, monks, not heirs to material things," the meaning is "my."
Trong các câu như ‘‘Này các Tỳ-kheo, hãy là người thừa tự Pháp của Ta (dhammadāyādā me, bhikkhave, bhavathā)’’ có nghĩa là ‘của tôi’ (mama).
Idha pana ‘‘mayā suta’’nti ca, ‘‘mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in two meanings: "heard by me" and "my hearing."
Ở đây, nó được dùng với hai ý nghĩa: ‘‘do tôi đã nghe’’ (mayā sutaṃ) và ‘‘sự nghe của tôi’’ (mama sutaṃ).
Sutanti ayaṃ sutasaddo saupasaggo ca anupasaggo ca gamana-vissuta-kilinnaupacitānuyoga-sotaviññeyya-sotadvārānusāraviññātādianekatthappabhedo.
The word sutaṃ (heard) – this word suta (heard), both with and without a prefix, has many different meanings such as going, renowned, wet, accumulated, engaged in, knowable by the ear-consciousness, and known through the ear-door.
Từ suta này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như đi, nổi tiếng, ướt đẫm, tích lũy, tinh tấn, được nhận biết bằng nhĩ thức, được nhận biết theo dòng nhĩ môn, v.v.
Tathā hissa – ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
For instance, in phrases such as "gone forth with the army," the meaning is "going."
Quả thật, trong các câu như ‘‘đi vào quân đội (senāya pasuto)’’, có nghĩa là ‘đi’ (gacchanto).
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases such as "for one who has heard the Dhamma and sees," the meaning is "for one whose Dhamma is renowned."
Trong các câu như ‘‘người thấy Pháp đã được nghe (sutadhammassa passato)’’, có nghĩa là ‘Pháp đã được nghe rõ ràng’ (vissutadhammassa).
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho.
In phrases such as "wet, for the wet one," the meaning is "wet, for the wet one."
Trong các câu như ‘‘ướt đẫm cho người ướt đẫm (avassutā avassutassā)’’, có nghĩa là ‘ướt đẫm’ (kilinnākilinnassa).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7-12) upacitanti attho.
In phrases such as "You have accumulated much merit," the meaning is "accumulated."
Trong các câu như ‘‘Các ông đã tích lũy công đức không ít (tumhehi puññaṃ pasutaṃ anappaka)’’ có nghĩa là ‘đã tích lũy’ (upacitaṃ).
‘‘Ye jhānappasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases such as "Those wise ones who are engaged in jhāna," the meaning is "engaged in jhāna."
Trong các câu như ‘‘những bậc trí tuệ tinh tấn thiền định (ye jhānappasutā dhīrā)’’, có nghĩa là ‘tinh tấn thiền định’ (jhānānuyuttā).
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases such as "seen, heard, sensed," the meaning is "knowable by the ear-consciousness."
Trong các câu như ‘‘thấy, nghe, ngửi, nếm, xúc chạm (diṭṭhaṃ sutaṃ muta)’’ có nghĩa là ‘được nhận biết bằng nhĩ thức’ (sotaviññeyyaṃ).
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases such as "one who retains what is heard, one who accumulates what is heard," the meaning is "one who retains what is known through the ear-door."
Trong các câu như ‘‘người ghi nhớ điều đã nghe, người tích lũy điều đã nghe (sutadharo sutasannicayo)’’, có nghĩa là ‘người ghi nhớ điều đã được nhận biết theo dòng nhĩ môn’ (sotadvārānusāraviññātadharo).
Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vāti attho.
Here, however, its meaning is "retained through the ear-door" or "the act of retaining."
Ở đây, nó có nghĩa là ‘đã được ghi nhớ’ hoặc ‘sự ghi nhớ’ theo dòng nhĩ môn.
Me-saddassa hi mayāti atthe sati ‘‘evaṃ mayā sutaṃ sotadvārānusārena upadhārita’’nti yujjati.
Indeed, when the word me has the meaning "by me," then "Thus, it was heard by me, retained through the ear-door" is appropriate.
Thật vậy, khi từ me có nghĩa là ‘do tôi’ (mayā), thì câu ‘‘Như vầy do tôi đã nghe, đã được ghi nhớ theo dòng nhĩ môn’’ (evaṃ mayā sutaṃ sotadvārānusārena upadhāritaṃ) là hợp lý.
Mamāti atthe sati ‘‘evaṃ mama sutaṃ sotadvārānusārena upadhāraṇa’’nti yujjati.
When it has the meaning "my," then "Thus, my hearing, the act of retaining through the ear-door" is appropriate.
Khi từ me có nghĩa là ‘của tôi’ (mama), thì câu ‘‘Như vầy sự nghe của tôi là sự ghi nhớ theo dòng nhĩ môn’’ (evaṃ mama sutaṃ sotadvārānusārena upadhāraṇaṃ) là hợp lý.
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
In these three words, evaṃ (thus) indicates the function of consciousness, such as ear-consciousness.
Trong ba từ này, evaṃ là sự biểu thị chức năng của thức, như nhĩ thức, v.v.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me (by me/my) indicates the person endowed with the aforesaid consciousness.
Me là sự biểu thị chúng sanh có được thức đã nói.
Sutanti assavanabhāvapaṭikkhepato anūnādhikāviparītaggahaṇanidassanaṃ.
Sutaṃ (heard) indicates the acquisition of knowledge that is neither less nor more, nor distorted, by refuting the state of not having heard.
Sutaṃ là sự biểu thị sự nắm bắt không thiếu, không thừa, không sai lệch, bằng cách bác bỏ trạng thái không nghe.
Tathā evanti tassā sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattabhāvappakāsanaṃ.
Likewise, evaṃ (thus) reveals the state of that consciousness-process, which proceeds through the ear-door, having proceeded in various ways with respect to the object.
Cũng vậy, evaṃ là sự biểu lộ trạng thái thức lộ đó vận hành trên đối tượng một cách đa dạng theo dòng nhĩ môn.
Meti attappakāsanaṃ.
Me (by me/my) reveals oneself.
Me là sự biểu lộ tự ngã.
Sutanti dhammappakāsanaṃ.
Sutaṃ (heard) reveals the Dhamma.
Sutaṃ là sự biểu lộ Pháp.
Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
The summary here is: "By the consciousness-process that proceeded in various ways with respect to the object, I did not do anything else; but this was done; this Dhamma was heard."
Đây là tóm tắt ở đây: ‘‘Bằng thức lộ vận hành trên đối tượng một cách đa dạng, tôi đã không làm gì khác, nhưng tôi đã làm điều này, Pháp này đã được nghe.’’
Tathā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso.
Likewise, evaṃ (thus) is the indication of the various modes of the mind-continuum by whose various modes of activity the apprehension of various meanings and expressions occurs.
Cũng vậy, evaṃ là sự chỉ ra các khía cạnh khác nhau của dòng tâm thức, nhờ sự vận hành đa dạng của nó, mà sự nắm bắt các nghĩa và văn tự khác nhau xảy ra.
Evanti hi ayaṃ ākārapaññatti.
Indeed, this evaṃ (thus) is a designation of mode.
Quả thật, evaṃ này là sự chế định về khía cạnh.
Meti kattuniddeso.
Me (by me/my) is the indication of the agent.
Me là sự chỉ ra chủ thể.
Sutanti visayaniddeso.
Sutaṃ (heard) is the indication of the object.
Sutaṃ là sự chỉ ra đối tượng.
Ettāvatā nānākārappavattena cittasantānena taṃsamaṅgino kattu visaye gahaṇasanniṭṭhānaṃ kataṃ hoti.
By this much, the determination of the agent, endowed with that mind-continuum that proceeds in various modes, having apprehended the object, is made.
Đến đây, sự quyết định về sự nắm bắt đối tượng bởi chủ thể, người có dòng tâm thức vận hành đa dạng, đã được thực hiện.
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
In this phrase, the designations of evaṃ and me are designations for what does not exist by way of true ultimate reality.
Trong đó, evaṃ và me là những chế định không tồn tại theo nghĩa chân đế tuyệt đối.
Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha.
Indeed, what exists in ultimate reality here that could receive the designation of evaṃ or me?
Thật vậy, ở đây, điều gì tồn tại theo chân đế mà có thể được chỉ ra là ‘như vầy’ hay ‘tôi’?
Sutanti vijjamānapaññatti.
The designation of sutaṃ is a designation for what exists.
Sutaṃ là chế định tồn tại.
Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For that which is apprehended here by the ear exists in ultimate reality.
Vì điều đã được nhận biết bằng tai ở đây, điều đó tồn tại theo chân đế.
Tathā evanti ca meti ca taṃ taṃ upādāya vattabbato upādāpaññatti.
Similarly, evaṃ and me are designations based on appropriation, because they are spoken by appropriating this and that.
Cũng vậy, evaṃ và me là những chế định nương tựa, vì chúng được nói ra dựa trên những điều đó.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a designation based on comparison, because it is spoken by comparing it with seeing and so on.
Sutaṃ là chế định đối chiếu, vì nó được nói ra bằng cách đối chiếu với những điều đã thấy, v.v.
Ettha ca evanti vacanena asammohaṃ dīpeti.
And here, by the word evaṃ, non-confusion is indicated.
Và ở đây, bằng từ evaṃ, Ngài Ānanda biểu lộ sự không mê lầm.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For one who is confused is not capable of penetrating various kinds of meanings.
Vì người mê lầm không có khả năng thấu hiểu đa dạng.
Sutanti vacanena sutassa asammosaṃ dīpeti.
By the word sutaṃ, the non-forgetfulness of what has been heard is indicated.
Bằng từ sutaṃ, Ngài biểu lộ sự không quên lãng điều đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For if what a person has heard is forgotten, that person does not acknowledge later, "I heard this."
Vì người nào quên lãng điều đã nghe, người đó sau này sẽ không xác nhận rằng ‘‘tôi đã nghe’’.
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, by his non-confusion, the attainment of wisdom is accomplished; by his non-forgetfulness, the attainment of mindfulness.
Như vậy, nhờ sự không mê lầm của Ngài mà trí tuệ thành tựu, và nhờ sự không quên lãng mà niệm thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā.
Among these, with mindfulness preceded by wisdom, there is the ability to grasp the syllables; with wisdom preceded by mindfulness, there is the ability to penetrate the meaning.
Trong đó, nhờ niệm được trí tuệ dẫn đầu mà có khả năng ghi nhớ văn tự, và nhờ trí tuệ được niệm dẫn đầu mà có khả năng thấu hiểu nghĩa.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
By being endowed with both these abilities, the attainment of being a custodian of the Dhamma is accomplished, due to being capable of preserving the treasury of Dhamma complete with meaning and syllables.
Nhờ sự kết hợp của khả năng kép đó, và nhờ khả năng bảo vệ kho tàng Pháp đầy đủ cả nghĩa và văn, mà Ngài Ānanda thành tựu vai trò là người giữ kho Pháp.
Aparo nayo – evanti vacanena yoniso manasikāraṃ dīpeti, ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
Another method: by the word evaṃ, proper attention (yoniso manasikāra) is indicated, because for one who attends improperly, there is no penetration of various kinds of meanings.
Một phương pháp khác: bằng từ evaṃ, Ngài Ānanda biểu lộ sự tác ý như lý (yoniso manasikāra), vì người tác ý phi như lý không có khả năng thấu hiểu đa dạng.
Sutanti vacanena avikkhepaṃ dīpeti, vikkhittacittassa savanābhāvato.
By the word sutaṃ, non-distraction is indicated, because there is no listening for one whose mind is distracted.
Bằng từ sutaṃ, Ngài biểu lộ sự không xao lãng, vì người có tâm xao lãng không thể nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Indeed, a person with a distracted mind, even when everything is explained to them, says, "I have not heard; please speak again."
Quả thật, một người có tâm xao lãng, dù được nói cho tất cả mọi thứ, vẫn nói rằng: ‘‘Tôi chưa nghe, xin hãy nói lại.’’
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by proper attention, one accomplishes proper self-application and past meritorious deeds, because these are absent for one whose self is not properly applied or who has not performed meritorious deeds in the past.
Ở đây, nhờ tác ý như lý, Ngài Ānanda thành tựu sự tự định hướng đúng đắn và công đức đã tạo trong quá khứ, vì người không tự định hướng đúng đắn hoặc không tạo công đức trong quá khứ thì không có điều đó.
Tathā avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti.
Similarly, by non-distraction, one accomplishes listening to the Saddhamma and reliance on good people.
Cũng vậy, nhờ sự không xao lãng, Ngài thành tựu sự nghe Chánh Pháp và sự nương tựa bậc thiện hữu.
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthīti.
For a distracted person cannot listen, and there is no listening for one who does not associate with good people.
Vì người có tâm xao lãng không thể nghe, và người không nương tựa bậc thiện hữu thì không có sự nghe.
Aparo nayo – yasmā ‘‘evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ.
Another method: because it is said, "The designation of evaṃ is the designation of various modes for one whose mental continuum, by its various modes of occurrence, grasps various meanings and syllables."
Một phương pháp khác: vì đã nói rằng ‘‘ evaṃ là sự chỉ ra các khía cạnh khác nhau của dòng tâm thức, nhờ sự vận hành đa dạng của nó, mà sự nắm bắt các nghĩa và văn tự khác nhau xảy ra.’’
So ca evaṃ bhaddako ākāro na sammā appaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakenākārena pacchimacakkadvayasampattimattano dīpeti.
And such a good mode does not occur for one whose self is not properly applied or who has not performed meritorious deeds in the past; therefore, by this good mode of evaṃ, he indicates his own attainment of the latter two wheels.
Và khía cạnh tốt đẹp như vậy không có ở người không tự định hướng đúng đắn hoặc không tạo công đức trong quá khứ, do đó, bằng từ evaṃ này, Ngài Ānanda biểu lộ sự thành tựu của hai bánh xe sau (hữu phước và trí tuệ) của chính mình với khía cạnh tốt đẹp này.
Sutanti savanayogena purimacakkadvayasampattiṃ.
By sutaṃ, he indicates the attainment of the former two wheels through the practice of listening.
Bằng từ sutaṃ, Ngài biểu lộ sự thành tựu của hai bánh xe trước (trú xứ thích hợp và thiện hữu) nhờ sự tinh tấn lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no listening for one who lives in an unsuitable place or who is devoid of reliance on good people.
Thật vậy, người sống ở nơi không thích hợp hoặc không có sự nương tựa bậc thiện hữu thì không có sự nghe.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti, purimacakkadvayasiddhiyā payogasuddhi.
Thus, by the accomplishment of the latter two wheels, the purity of intention is accomplished for him; by the accomplishment of the former two wheels, the purity of practice.
Như vậy, nhờ sự thành tựu của hai bánh xe sau, Ngài thành tựu sự thanh tịnh về ý muốn; nhờ sự thành tựu của hai bánh xe trước, Ngài thành tựu sự thanh tịnh về sự nỗ lực.
Tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
And through that purity of intention, the accomplishment of practical realization is achieved; through the purity of effort, the accomplishment of scriptural knowledge is achieved.
Với sự thanh tịnh của ý hướng đó, sự thành tựu về chứng đắc (adhigamabyattisiddhi) được hoàn tất; với sự thanh tịnh của sự tinh tấn, sự thành tựu về giáo pháp (āgamabyattisiddhi) được hoàn tất.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato, yoniso manasikāro viya ca kusalakammassa, arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the utterance of one purified in effort and intention, endowed with both scriptural knowledge and practical realization, is fitting to be a precursor to the Buddha's word, just as the rising of the dawn is to the sun's appearance, and just as proper attention (yoniso manasikāro) is to wholesome action. Therefore, establishing the prologue in its proper place, he said, " Thus have I heard" and so forth.
Như vậy, lời nói của người có sự tinh tấn và ý hướng thanh tịnh, đầy đủ cả giáo pháp (āgama) và chứng đắc (adhigama), xứng đáng là điềm báo trước lời của Đức Thế Tôn, giống như rạng đông báo hiệu mặt trời mọc, và giống như tác ý chân chánh (yoniso manasikāra) là điềm báo trước của thiện nghiệp (kusalakamma). Vì vậy, khi đặt phần Duyên khởi (nidāna) vào chỗ thích hợp, Ngài đã nói câu mở đầu là “Như vầy tôi nghe” (Evaṃ me sutaṃ).
Aparo nayo – evanti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another way: with the word " evaṃ" (thus), which points to penetration of various kinds, he shows his own attainment of the paṭisambhidā of meaning (attha) and analytical knowledge (paṭibhāna).
Một cách giải thích khác – Với lời nói “Như vầy” (Evaṃ) này, biểu thị sự thâm nhập đa dạng, Ngài Ānanda đã biểu lộ sự thành tựu của mình về nghĩa tùy quán (atthapaṭibhānapaṭisambhidā) và biện tài tùy quán (paṭibhānapaṭisambhidā).
Sutanti iminā sotabbabhedapaṭivedhadīpakena vacanena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
With the word " sutaṃ" (heard), which points to the penetration of various categories of what is to be heard, he shows his own attainment of the paṭisambhidā of Dhamma and expression (nirutti).
Với lời nói “tôi nghe” (sutaṃ) này, biểu thị sự thâm nhập vào các loại pháp (dhammanirutti) và ngôn ngữ (niruttipaṭisambhidā), Ngài đã biểu lộ sự thành tựu của mình về pháp tùy quán (dhammapaṭisambhidā) và ngôn ngữ tùy quán (niruttipaṭisambhidā).
Evanti ca idaṃ yoniso manasikāradīpakavacanaṃ bhāsamāno ‘‘ete mayā dhammā manasā anupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
Moreover, by uttering the word " evaṃ", which indicates proper attention, he reveals, "These Dhammas have been repeatedly examined by me with the mind and thoroughly penetrated with wisdom (diṭṭhiyā)."
Hơn nữa, khi nói lời “Như vầy” (Evaṃ) này, một lời biểu thị tác ý chân chánh (yoniso manasikāra), Ngài đã biểu lộ rằng: “Những pháp này đã được tôi quán xét bằng tâm và đã được thâm nhập một cách hoàn hảo bằng tuệ tri (diṭṭhiyā suppaṭividdhā).”
Sutanti idaṃ savanayogadīpakavacanaṃ bhāsamāno ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering the word " sutaṃ", which indicates engagement in listening, he reveals, "Many Dhammas have been heard by me, retained, and familiarized through speech."
Khi nói lời “tôi nghe” (sutaṃ) này, một lời biểu thị sự chuyên cần lắng nghe, Ngài đã biểu lộ rằng: “Nhiều pháp đã được tôi lắng nghe, ghi nhớ và thuần thục bằng lời nói.”
Tadubhayenapi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
Through both of these, showing the completeness of meaning and expression, he generates diligence in listening.
Với cả hai điều đó, Ngài đã biểu lộ sự viên mãn của nghĩa và văn, đồng thời khơi dậy lòng tôn kính đối với việc lắng nghe.
Atthabyañjanaparipuṇṇaṃ hi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabboti.
For one who does not listen respectfully to the Dhamma complete with meaning and expression is excluded from great benefit. Thus, having generated diligence, the Dhamma should be listened to respectfully.
Vì quả thật, người nào không lắng nghe giáo pháp đầy đủ nghĩa và văn một cách tôn kính thì sẽ bị tước mất nhiều lợi ích. Do đó, sau khi khơi dậy lòng tôn kính, Ngài dạy rằng giáo pháp phải được lắng nghe một cách cẩn trọng.
Evaṃ me sutanti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati, sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
Furthermore, with the entire phrase " Evaṃ me sutaṃ" (Thus have I heard), the Venerable Ānanda, by not claiming the Dhamma taught by the Tathāgata as his own, transcends the level of the ignoble, and by acknowledging his status as a disciple, he enters the level of the noble.
Tuy nhiên, với toàn bộ lời nói “Như vầy tôi nghe” (Evaṃ me sutaṃ) này, Tôn giả Ānanda đã vượt qua cảnh giới của những người không cao thượng (asappurisabhūmi) bằng cách không cho rằng giáo pháp do Đức Như Lai thuyết giảng là của mình, và đã bước vào cảnh giới của những người cao thượng (sappurisabhūmi) bằng cách công nhận mình là một đệ tử.
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Similarly, he causes the mind to rise above unwholesome states and establishes the mind in wholesome states.
Cũng vậy, Ngài đã khiến tâm thoát ly khỏi phi chánh pháp (asaddhamma) và an trú tâm vào chánh pháp (saddhamma).
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva pana bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By indicating, "This was merely heard by me; it is solely the word of the Blessed One," he absolves himself, points to the Teacher, establishes the word of the Victor, and sets up the guidance of the Dhamma.
Bằng cách biểu lộ rằng “Đây chỉ là điều tôi đã nghe, nhưng đó là lời của chính Đức Thế Tôn,” Ngài đã tự giải thoát mình, quy chiếu đến Bậc Đạo Sư, xác nhận đó là lời của Đức Phật (jinavacana), và thiết lập đường lối của giáo pháp (dhammanetti).
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kattabbā’’ti sabbadevamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādeti.
Moreover, by not claiming that "evaṃ me sutaṃ" (thus have I heard) was generated by himself, and by elaborating on the preceding statement, he says: "This word was received by me directly from that Blessed One who was intrepid due to the four intrepidities, who possessed the ten powers, who stood in the position of the chief bull, who uttered a lion's roar, who was supreme among all beings, the lord of Dhamma, the king of Dhamma, the chief of Dhamma, the lamp of Dhamma, the refuge of Dhamma, the supreme universal monarch of the True Dhamma, the Perfectly Self-Enlightened One. Therefore, no doubt or perplexity should be entertained here concerning the meaning, the Dhamma, the words, or the phrases." In this way, he eliminates lack of faith in this Dhamma for all devas and humans and generates the attainment of faith.
Hơn nữa, bằng cách không thừa nhận rằng lời “Như vầy tôi nghe” (Evaṃ me sutaṃ) là do chính mình tạo ra, mà là để làm sáng tỏ lời nói trước đó, Ngài đã tuyên bố: “Lời này đã được tôi tiếp nhận trực tiếp từ Đức Thế Tôn, bậc đã thành tựu bốn sự vô úy (catuvesārajja), bậc nắm giữ mười lực (dasabala), bậc an trú ở vị trí tối thượng (āsabhaṭṭhāna), bậc rống tiếng sư tử hống (sīhanādanādī), bậc tối thượng trong tất cả chúng sanh, bậc chủ tể của Pháp (dhammissara), Pháp Vương (dhammarāja), bậc tối cao của Pháp (dhammādhipati), ngọn đèn của Pháp (dhammadīpa), nơi nương tựa của Pháp (dhammasaraṇa), Chuyển Luân Thánh Vương của diệu Pháp (saddhammavaracakkavattī), Đức Chánh Đẳng Giác (sammāsambuddha). Không nên có bất kỳ nghi ngờ hay hoài nghi nào về nghĩa, pháp, từ ngữ hay văn cú trong giáo pháp này.” Bằng cách đó, Ngài đã tiêu trừ sự vô tín (assaddhiyaṃ) của tất cả chư thiên và loài người đối với giáo pháp này, và phát sinh sự thành tựu về đức tin (saddhāsampadaṃ).
Tenetaṃ vuccati –
Therefore, it is said:
Vì thế, có lời nói:
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Thus, in passages like "Perhaps tomorrow we might approach, having regard for the appropriate time and circumstance" (Dīgha Nikāya 1.447), the meaning is 'conjunction of circumstances'.
Cũng vậy, trong các đoạn như “Có thể ngày mai chúng ta sẽ đến, tùy thuộc vào thời gian và sự hòa hợp (samavāya)” thì samavāya là nghĩa. (Dī. Ni. 1.447)
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
In passages like "Bhikkhus, there is only one opportune moment and one season for the living of the holy life" (Aṅguttara Nikāya 8.29), the meaning is 'opportune moment'.
Trong các đoạn như “Này các Tỳ-khưu, chỉ có một khoảnh khắc (khaṇa) và một thời điểm (samaya) cho đời sống phạm hạnh” thì khaṇa là nghĩa. (A. Ni. 8.29)
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In passages like "hot season, stifling season" (Pācittiya 358), the meaning is 'time'.
Trong các đoạn như “Thời tiết nóng (uṇhasamayo), thời tiết oi bức (pariḷāhasamayo)” thì kāla là nghĩa.
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In passages like "A great assemblage in the forest" (Dīgha Nikāya 2.332), the meaning is 'assemblage'.
Trong các đoạn như “Đại hội (mahāsamayo) trong rừng” thì samūha là nghĩa. (Dī. Ni. 2.332)
‘‘Samayopi kho te bhaddāli appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati ‘bhaddāli nāma bhikkhu satthu sāsane sikkhāya aparipūrakārī’ti, ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
In passages like "Indeed, Bhaddāli, your reason was not penetrated; the Blessed One dwells in Sāvatthī, and the Blessed One will know me: 'A bhikkhu named Bhaddāli is one who does not fully complete the training in the Teacher's Dispensation.' This reason, Bhaddāli, was also not penetrated by you" (Majjhima Nikāya 2.135), the meaning is 'cause'.
Trong các đoạn như “Này Bhaddāli, nguyên nhân (samaya) đó cũng chưa được ông thâm nhập. Đức Thế Tôn đang trú tại Sāvatthī. Đức Thế Tôn cũng sẽ biết về ta: ‘Tỳ-khưu tên Bhaddāli này không hoàn thành giới luật trong giáo pháp của Bậc Đạo Sư.’ Này Bhaddāli, nguyên nhân (samaya) này cũng chưa được ông thâm nhập” thì hetu là nghĩa. (M. Ni. 2.135)
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In passages like "Now at that time, Uggāhamāno, the wanderer, the son of Samaṇamuṇḍikā, was residing at the Mallikā's pleasure park in Tindukācīra, in a single hall, where doctrines were debated" (Majjhima Nikāya 2.260), the meaning is 'view'.
Trong các đoạn như “Vào thời điểm đó, du sĩ Uggāhamāna, con của Samaṇamuṇḍikā, đang trú tại khu vườn của Mallikā, trong một ngôi nhà sàn duy nhất, bên bờ cây Tinduka, nơi những người thuyết giảng các quan điểm (samayappavādaka) cư ngụ” thì diṭṭhi là nghĩa. (M. Ni. 2.260)
Ādīsu (saṃ. ni. 1.129) paṭilābho.
In passages such as these, the meaning is 'acquisition'.
Trong các đoạn như trên, paṭilābha là nghĩa. (Saṃ. Ni. 1.129)
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.28) pahānaṃ.
In passages like "By rightly abandoning conceit, he made an end to suffering" (Majjhima Nikāya 1.28), the meaning is 'abandoning'.
Trong các đoạn như “Do sự thâm nhập hoàn toàn kiêu mạn, đã chấm dứt khổ đau” thì pahāna là nghĩa. (M. Ni. 1.28)
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 2.8) paṭivedho.
In passages like "The meaning of oppression for suffering, the meaning of conditionedness, the meaning of torment, the meaning of changeability, the meaning of penetration" (Paṭisambhidāmagga 2.8), the meaning is 'penetration'.
Trong các đoạn như “Ý nghĩa của sự áp bức, ý nghĩa của sự tạo tác, ý nghĩa của sự nung đốt, ý nghĩa của sự biến đổi, ý nghĩa của sự thâm nhập của khổ đau” thì paṭivedha là nghĩa. (Paṭi. Ma. 2.8)
Idha panassa kālo attho.
Here, however, its meaning is 'time'.
Tuy nhiên, ở đây, kāla là nghĩa của nó.
Tena saṃvacchara-utu-māsa-aḍḍhamāsa-ratti-diva-pubbaṇha-majjhanhika-sāyanha-paṭhama-majjhima- pacchimayāma-muhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Thereby, it indicates "one time" among the times which are divisions of time, such as year, season, month, half-month, night, day, forenoon, midday, afternoon, first, middle, and last watches, and muhutta (moment).
Bằng cách đó, nó biểu thị rằng trong các thời điểm được phân loại thành năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, và khoảnh khắc, v.v., “một thời điểm” (ekaṃ samayaṃ) là một trong số đó.
Tattha kiñcāpi etesu saṃvaccharādīsu yaṃ yaṃ suttaṃ yamhi yamhi saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Although all those suttas, whatever year, season, month, fortnight, night-part, or day-part they were spoken in among these years and so forth, were well-known and well-ascertained by the Elder through wisdom;
Mặc dù trong các năm, v.v., này, bất kỳ bài kinh nào được thuyết giảng vào năm nào, mùa nào, tháng nào, nửa tháng nào, phần đêm nào hay phần ngày nào, tất cả những điều đó đều được Tôn giả Ānanda biết rõ và sắp xếp rõ ràng bằng trí tuệ.
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
however, since it would not be possible to easily remember, recite, or cause to be recited if it were said: "Thus have I heard in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a night-part, or in such and such a day-part," and much would have to be said, therefore, having encompassed that meaning with a single phrase, he said, " Ekaṃ samayaṃ."
Tuy nhiên, vì khi nói “Như vầy tôi nghe vào năm đó, mùa đó, tháng đó, nửa tháng đó, phần đêm đó hay phần ngày đó,” thì không thể dễ dàng ghi nhớ, giảng dạy hay khiến người khác giảng dạy, và sẽ có nhiều điều phải nói, do đó Ngài đã tổng hợp ý nghĩa đó trong một từ duy nhất và nói “Ekaṃ samayaṃ” (một thời điểm).
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya suppakāsā anekakālappabhedā eva samayā, tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Or it indicates "one time" as one of the times, which are indeed various divisions of time and are exceedingly well-known among devas and humans concerning the Blessed One, such as the time of conception, the time of birth, the time of spiritual urgency, the time of the great renunciation, the time of ascetic practices, the time of Māra's defeat, the time of full enlightenment, the time of pleasant abiding in this very life, the time of discourse, and the time of parinibbāna.
Hoặc, trong số các thời điểm như thời điểm nhập thai (gabbhokkantisamayo), thời điểm đản sanh (jātisamayo), thời điểm khởi tâm xao động (saṃvegasamayo), thời điểm xuất gia (abhinikkhamanasamayo), thời điểm thực hành khổ hạnh (dukkarakārikasamayo), thời điểm chiến thắng Ma vương (māravijayasamayo), thời điểm thành tựu Chánh Giác (abhisambodhisamayo), thời điểm an trú hạnh phúc trong hiện tại (diṭṭhadhammasukhavihārasamayo), thời điểm thuyết pháp (desanāsamayo), thời điểm nhập Niết Bàn (parinibbānasamayo), v.v., là những thời điểm rất nổi bật đối với chư thiên và loài người, và là nhiều loại thời gian khác nhau của Đức Thế Tôn, Ngài đã biểu thị “một thời điểm” (ekaṃ samayaṃ) là thời điểm thuyết pháp (desanāsamayasaṅkhātaṃ) trong số các thời điểm đó.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahita-paṭipattisamayesu parahita-paṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
And referring to one of these times – the time of the duty of compassion among the times of the duties of knowledge and compassion; the time of practice for the welfare of others among the times of practice for one's own welfare and the welfare of others; the time of Dhamma talk among the times of two duties for those assembled; the time of discourse among the times of discourse and practice – he said, " Ekaṃ samayaṃ."
Và trong số các thời điểm của hoạt động trí tuệ (ñāṇakicca) và hoạt động từ bi (karuṇākicca), đó là thời điểm của hoạt động từ bi; trong số các thời điểm thực hành lợi ích cho mình (attahita-paṭipatti) và lợi ích cho người khác (parahita-paṭipatti), đó là thời điểm thực hành lợi ích cho người khác; trong số các thời điểm của hai việc cần làm khi hội họp, đó là thời điểm thuyết pháp (dhammikathāsamayo); trong số các thời điểm thuyết pháp (desanā) và thực hành (paṭipatti), đó là thời điểm thuyết pháp. Ngài cũng đã nói “ekaṃ samayaṃ” (một thời điểm) để chỉ một trong các thời điểm đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti ca, ito aññesu ca suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena niddeso kato, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacanena niddeso katoti.
Why, then, in the Abhidhamma, is the designation made with the locative case, such as "in whichever time associated with the sensuous realm," and in other sutta passages, "Bhikkhus, in whichever time a bhikkhu is secluded from sense pleasures," and in the Vinaya, the designation is made with the instrumental case, "at that time, the Buddha, the Blessed One," but here, it is not done so, and the designation is made with the accusative case, " ekaṃ samayaṃ"?
Tại sao ở đây, không giống như trong Abhidhamma, nơi có sự chỉ định bằng cách dùng cách dùng vị cách (bhummavacana) như “Vào thời điểm nào, cõi dục…” (yasmiṃ samaye kāmāvacara), và trong các đoạn kinh khác như “Này các Tỳ-khưu, vào thời điểm nào, Tỳ-khưu ly dục…” (yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī), và trong Vinaya, nơi có sự chỉ định bằng cách dùng cách dùng cụ cách (karaṇavacana) như “Vào thời điểm đó, Đức Phật, Thế Tôn…” (tena samayena buddho bhagavā), mà lại có sự chỉ định bằng cách dùng cách dùng nghiệp cách (upayogavacana) là “ekaṃ samayaṃ” (một thời điểm)?
Tattha tathā, idha ca aññathā atthasambhavato.
Because the meaning is thus in those places, and otherwise here.
Ở đó là như vậy, và ở đây là khác, vì có sự khả dĩ về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvenabhāvalakkhaṇattho ca sambhavati.
For there, in the Abhidhamma and in other Sutta passages, the meaning of location (adhikaraṇa) and the meaning of "when one thing exists, another exists" (bhāvenabhāvalakkhaṇa) are possible.
Trong Abhidhamma và các đoạn kinh khác ngoài kinh này, ý nghĩa của sự y cứ (adhikaraṇa) và ý nghĩa của việc đánh dấu một hành động bằng một hành động khác (bhāvenabhāvalakkhaṇa) đều có thể xảy ra.
Adhikaraṇaṃ hi kālattho samūhattho ca samayo, tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati, tasmā tadatthajotanatthaṃ tattha bhummavacanena niddeso kato.
Indeed, samaya means time and collection, and it is the location for the phenomena such as contact (phassa) mentioned therein; and by the existence of samaya, which is called the condition of momentary concomitance, the existence of those phenomena is indicated. Therefore, to illuminate that meaning, a designation using the locative case is made there.
Quả thật, thời gian (kālattha) và thời điểm tập hợp (samūhattha) là sự y cứ (adhikaraṇa), và sự hiện hữu của các pháp như xúc (phassa) được đề cập trong đó được đánh dấu bởi sự hiện hữu của thời điểm được gọi là nhân duyên hợp nhất khoảnh khắc (khaṇasamavāyahetu). Do đó, để làm rõ ý nghĩa đó, một sự chỉ định đã được thực hiện bằng cách sử dụng cách dùng từ chỉ định nơi chốn (bhummavacana).
Vinaye ca hetuattho karaṇattho ca sambhavati.
And in the Vinaya, the meaning of cause (hetu) and the meaning of instrument (karaṇa) are possible.
Trong Vinaya, ý nghĩa nhân duyên (hetuattha) và ý nghĩa công cụ (karaṇattha) đều có thể xảy ra.
Yo hi so sikkhāpadapaññattisamayo sāriputtādīhipi dubbiññeyyo, tena samayena hetubhūtena karaṇabhūtena ca sikkhāpadāni paññāpayanto sikkhāpadapaññattihetuñca apekkhamāno bhagavā tattha tattha vihāsi.
For the time of the promulgation of the training rule, which was difficult even for Sāriputta and others to discern, the Blessed One dwelled in various places, promulgating training rules with that time as the cause and as the instrument, and having regard for the cause of the promulgation of the training rules.
Quả thật, thời điểm giới luật được chế định, khó hiểu ngay cả đối với Sāriputta và các vị khác, chính vào thời điểm đó, Đức Thế Tôn đã trú ngụ ở các nơi khác nhau, xem xét thời điểm đó như một nhân duyên và công cụ, và cũng xem xét nhân duyên chế định giới luật, khi Ngài chế định các giới luật.
Tasmā tadatthajotanatthaṃ tattha karaṇavacanena niddeso kato.
Therefore, to illuminate that meaning, a designation using the instrumental case is made there.
Do đó, để làm rõ ý nghĩa đó, một sự chỉ định đã được thực hiện bằng cách sử dụng cách dùng từ chỉ định công cụ (karaṇavacana).
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ dassento bhagavato dhammasarīraṃ paccakkhaṃ karoti.
Thus far, with the phrase evaṃ me sutaṃ (Thus have I heard), by demonstrating the Dhamma as heard, he makes the Dhamma-body of the Bhagavā manifest.
Đến đây, bằng câu “ Evaṃ me sutaṃ” (Như vầy tôi nghe), Tôn giả Ānanda đã chứng thực pháp đã được nghe, và làm cho Pháp thân của Đức Thế Tôn hiển lộ.
Tena ‘‘na idaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
Thereby, he reassures the people who are disheartened by the absence of the Teacher, saying, "This teaching is not without a Teacher; this is your Teacher."
Điều này an ủi những người đang buồn rầu vì không được thấy Đức Bổn Sư, rằng “Lời dạy này không phải là không có Bổn Sư, đây là Bổn Sư của các con.”
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti.
By the phrase ekaṃ samayaṃ Bhagavā (At one time the Bhagavā), by showing the non-existence of the Bhagavā at that time, he establishes the parinibbāna of the rūpakāya.
Bằng câu “ Ekaṃ samayaṃ Bhagavā” (Một thời Đức Thế Tôn), Tôn giả Ānanda đã chứng minh sự nhập Niết Bàn của sắc thân, bằng cách chỉ ra rằng Đức Thế Tôn không còn hiện hữu vào thời điểm đó.
Tena ‘‘evaṃvidhassa nāma ariyadhammassa desako dasabaladharo vajirasaṅghātasamānakāyo sopi bhagavā parinibbuto, kena aññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
Thereby, he stirs up emotion in those intoxicated by the pride of life, thinking, "Even such a noble Dhamma-teacher, endowed with the ten powers, whose body is like a diamond, even that Bhagavā attained parinibbāna; by whom else should hope for life be generated?" and he generates enthusiasm for the Saddhamma in them.
Điều này khiến những người say mê sự sống phải kinh sợ, rằng “Một bậc thuyết pháp về Chánh pháp cao thượng như vậy, một bậc Thập Lực, một thân thể kiên cố như kim cương, mà Ngài cũng đã nhập Niết Bàn, thì ai có thể hy vọng vào sự sống nữa?” và tạo ra sự nhiệt tâm trong Chánh pháp cho họ.
Evanti ca bhaṇanto desanāsampattiṃ niddisati.
And by saying evaṃ (thus), he indicates the perfection of the teaching.
Và khi nói “ Evaṃ” (Như vầy), Tôn giả Ānanda chỉ ra sự viên mãn của bài thuyết pháp.
Me sutanti sāvakasampattiṃ.
By me sutaṃ (I heard), the perfection of the disciple.
“ Me sutaṃ” (Tôi nghe) chỉ ra sự viên mãn của thính chúng.
Ekaṃ samayanti kālasampattiṃ.
By ekaṃ samayaṃ (at one time), the perfection of time.
“ Ekaṃ samayaṃ” (Một thời) chỉ ra sự viên mãn của thời gian.
Bhagavāti desakasampattiṃ.
By Bhagavā, the perfection of the teacher.
“ Bhagavā” (Đức Thế Tôn) chỉ ra sự viên mãn của bậc thuyết pháp.
Sāvatthiyanti evaṃnāmake nagare.
Sāvatthiyaṃ means in a city of that name.
Sāvatthiyaṃ (Tại Sāvatthī) có nghĩa là tại thành phố có tên như vậy.
Samīpatthe cetaṃ bhummavacanaṃ.
And this locative case is used in the sense of proximity.
Đây là cách dùng từ chỉ định nơi chốn với ý nghĩa gần kề.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgiparidīpanametaṃ.
Viharatī (dwells) is a general indication of being endowed with one of the postures, divine abidings, brahmavihāras, or noble abidings.
Viharatī (trú ngụ) là sự biểu thị sự kết hợp với một trong các tư thế đi đứng, thiền định, Phạm trú, hoặc Thánh trú mà không có sự phân biệt.
Idha pana ṭhānagamananisajjāsayanappabhedesu iriyāpathesu aññatarairiyāpathasamāyogaparidīpanaṃ, tena ṭhitopi gacchantopi nisinnopi sayānopi bhagavā viharaticceva veditabbo.
Here, however, it indicates being endowed with one of the postures, namely standing, walking, sitting, or lying down; therefore, whether standing, walking, sitting, or lying down, the Bhagavā should be understood as "viharatī" (dwelling).
Tuy nhiên, ở đây, nó biểu thị sự kết hợp với một trong các tư thế đi đứng, đứng, ngồi, hoặc nằm. Do đó, cần hiểu rằng Đức Thế Tôn trú ngụ dù Ngài đang đứng, đi, ngồi hay nằm.
So hi ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā ‘‘viharatī’’ti vuccati.
For he carries and maintains his body, preventing its decay by interrupting one posture with another; therefore, he is called "viharatī" (dwelling).
Ngài đã loại bỏ sự khó chịu của một tư thế bằng một tư thế khác, và duy trì thân thể không bị đổ vỡ, do đó được gọi là “viharatī” (trú ngụ).
Jetavaneti jetassa rājakumārassa vane.
Jetavane means in the grove of Prince Jeta.
Jetavane (Trong Jetavana) có nghĩa là trong khu vườn của hoàng tử Jeta.
Tañhi tena ropitaṃ saṃvaḍḍhitaṃ paripālitaṃ, so cassa sāmī ahosi, tasmā jetavananti saṅkhaṃ gataṃ, tasmiṃ jetavane.
For it was planted, cultivated, and protected by him, and he was its owner; therefore, it came to be known as Jetavana, in that Jetavana.
Khu vườn đó đã được Ngài trồng, nuôi dưỡng và bảo vệ, và Ngài là chủ của nó, do đó nó được gọi là Jetavana; tại Jetavana đó.
Anāthapiṇḍikassa ārāmeti anāthapiṇḍikena gahapatinā catupaññāsahiraññakoṭipariccāgena buddhappamukhassa bhikkhusaṅghassa niyyātitattā anāthapiṇḍikassāti saṅkhaṃ gate ārāme.
Anāthapiṇḍikassa ārāme means in the monastery that came to be known as Anāthapiṇḍika's, because it was dedicated by the householder Anāthapiṇḍika to the community of bhikkhus, with the Buddha at its head, through the donation of fifty-four crores of gold.
Anāthapiṇḍikassa ārāme (Trong tu viện của Anāthapiṇḍika) có nghĩa là trong tu viện đã được gia chủ Anāthapiṇḍika cúng dường cho Tăng đoàn do Đức Phật đứng đầu, với sự bố thí năm mươi bốn triệu đồng vàng, do đó nó được gọi là tu viện của Anāthapiṇḍika.
Ayamettha saṅkhepo, vitthāro pana papañcasūdaniyā majjhimaṭṭhakathāya sabbāsavasuttavaṇṇanāyaṃ (ma. ni. aṭṭha. 1.14 ādayo) vutto.
This is a summary here; the detailed explanation is given in the Papñcasūdanī, the Majjhima Aṭṭhakathā, in the commentary on the Sabbāsava Sutta.
Đây là phần tóm tắt ở đây; phần chi tiết đã được nói trong Chú giải Sabbāsava Sutta của Chú giải Trung Bộ, Papñcasūdanī.
Tattha siyā – yadi tāva bhagavā sāvatthiyaṃ viharati, ‘‘jetavane’’ti na vattabbaṃ.
There might be a question: If the Bhagavā dwells in Sāvatthī, then "Jetavane" should not be stated.
Ở đó có thể có một câu hỏi: Nếu Đức Thế Tôn trú ngụ tại Sāvatthī, thì không cần nói “trong Jetavana”.
Atha tattha viharati, ‘‘sāvatthiya’’nti na vattabbaṃ.
If he dwells there, then "Sāvatthiyaṃ" should not be stated.
Nếu Ngài trú ngụ ở đó, thì không cần nói “tại Sāvatthī”.
Na hi sakkā ubhayattha ekaṃ samayaṃ viharitunti.
For it is not possible to dwell in both places at the same time.
Vì không thể trú ngụ ở cả hai nơi cùng một lúc.
Na kho panetaṃ evaṃ daṭṭhabbaṃ.
However, this should not be understood in that way.
Tuy nhiên, điều này không nên được hiểu như vậy.
Nanu avocumha ‘‘samīpatthe bhummavacana’’nti.
Did we not say that "the locative case is used in the sense of proximity"?
Chẳng phải chúng ta đã nói “cách dùng từ chỉ định nơi chốn với ý nghĩa gần kề” sao?
Tasmā yathā gaṅgāyamunādīnaṃ samīpe goyūthāni carantāni ‘‘gaṅgāya caranti, yamunāya carantī’’ti vuccanti, evamidhāpi yadidaṃ sāvatthiyā samīpe jetavanaṃ, tattha viharanto vuccati ‘‘sāvatthiyaṃ viharati jetavane’’ti.
Therefore, just as herds of cattle grazing near the Gaṅgā and Yamunā rivers are said to "graze in the Gaṅgā, graze in the Yamunā," so too here, the Bhagavā, dwelling in Jetavana which is near Sāvatthī, is said to "dwell in Sāvatthī, in Jetavana."
Do đó, giống như những đàn bò đang gặm cỏ gần sông Gaṅgā và Yamunā được gọi là “gặm cỏ trên sông Gaṅgā, gặm cỏ trên sông Yamunā”, thì ở đây cũng vậy, Đức Thế Tôn trú ngụ tại Jetavana, nằm gần Sāvatthī, được gọi là “trú ngụ tại Sāvatthī, trong Jetavana”.
Gocaragāmanidassanatthaṃ hissa sāvatthivacanaṃ, pabbajitānurūpanivāsanaṭṭhānanidassanatthaṃ sesavacanaṃ.
The mention of Sāvatthī is to indicate his alms-round village, and the remaining phrase is to indicate a suitable dwelling place for renunciants.
Việc đề cập đến Sāvatthī là để chỉ ra nơi đi khất thực của Ngài, còn các từ còn lại là để chỉ ra nơi trú ngụ phù hợp cho các vị xuất gia.
Tattha sāvatthivacanena āyasmā ānando bhagavato gahaṭṭhānuggahakaraṇaṃ dasseti, jetavanādikittanena pabbajitānuggahakaraṇaṃ.
Among those words beginning with Sāvatthī, by the word Sāvatthī, Venerable Ānanda shows the Blessed One's act of favoring householders; by mentioning Jetavana and so on, he shows the act of favoring renunciants.
Ở đó, bằng việc đề cập đến Sāvatthī, Tôn giả Ānanda chỉ ra sự giúp đỡ của Đức Thế Tôn đối với các gia chủ, và bằng việc đề cập đến Jetavana và các nơi khác, Ngài chỉ ra sự giúp đỡ đối với các vị xuất gia.
Tathā purimena paccayaggahaṇato attakilamathānuyogavivajjanaṃ, pacchimena vatthukāmappahānato kāmasukhallikānuyogavivajjanūpāyadassanaṃ.
Furthermore, by the former, due to receiving requisites, the avoidance of self-mortification; by the latter, due to abandoning material sensual pleasures, the showing of the means to avoid indulgence in sensual pleasures.
Tương tự, bằng cách trước, Ngài chỉ ra sự tránh xa việc tự hành khổ do nhận các vật dụng; bằng cách sau, Ngài chỉ ra phương tiện tránh xa việc đắm mình trong lạc thú dục vọng do từ bỏ các dục cảnh.
Purimena ca dhammadesanābhiyogaṃ, pacchimena vivekādhimuttiṃ.
And by the former, diligence in teaching the Dhamma; by the latter, inclination towards seclusion.
Bằng cách trước, Ngài chỉ ra sự chuyên tâm thuyết pháp; bằng cách sau, Ngài chỉ ra sự thiên về độc cư.
Purimena karuṇāya upagamanaṃ, pacchimena paññāya apagamanaṃ.
By the former, approach through compassion; by the latter, departure through wisdom.
Bằng cách trước, Ngài chỉ ra sự tiếp cận bằng lòng bi mẫn; bằng cách sau, Ngài chỉ ra sự rời bỏ bằng trí tuệ.
Purimena sattānaṃ hitasukhanipphādanādhimuttitaṃ, pacchimena parahitasukhakaraṇe nirupalepataṃ.
By the former, the inclination to bring about the welfare and happiness of beings; by the latter, detachment in bringing about the welfare and happiness of others.
Bằng cách trước, Ngài chỉ ra sự quyết tâm mang lại lợi ích và hạnh phúc cho chúng sinh; bằng cách sau, Ngài chỉ ra sự không dính mắc khi làm lợi ích và hạnh phúc cho người khác.
Purimena dhammikasukhāpariccāganimittaphāsuvihāraṃ, pacchimena uttarimanussadhammānuyoganimittaṃ.
By the former, a comfortable dwelling due to not abandoning righteous happiness; by the latter, the basis for applying oneself to superhuman states.
Bằng cách trước, Ngài chỉ ra sự an trú thoải mái do không từ bỏ hạnh phúc hợp pháp; bằng cách sau, Ngài chỉ ra sự chuyên tâm vào các pháp siêu nhân.
Purimena manussānaṃ upakārabahulataṃ, pacchimena devatānaṃ.
By the former, the abundance of benefit for humans; by the latter, for devas.
Bằng cách trước, Ngài chỉ ra sự giúp đỡ rộng lớn đối với loài người; bằng cách sau, Ngài chỉ ra sự giúp đỡ đối với chư thiên.
Purimena loke jātassa loke saṃvaḍḍhabhāvaṃ, pacchimena lokena anupalittataṃ.
By the former, being born in the world and growing up in the world; by the latter, being unsoiled by the world.
Bằng cách trước, Ngài chỉ ra sự sinh ra trong thế gian và sự trưởng thành trong thế gian; bằng cách sau, Ngài chỉ ra sự không bị thế gian làm ô nhiễm.
Purimena ‘‘ekapuggalo, bhikkhave, loke uppajjamāno uppajjati bahujanahitāya bahujanasukhāya lokānukampāya atthāya hitāya sukhāya devamanussānaṃ.
By the former, the accomplishment of the purpose for which the Blessed One arose, as stated: "Bhikkhus, one person, arising in the world, arises for the welfare of many, for the happiness of many, out of compassion for the world, for the good, for the benefit, for the happiness of devas and humans.
Bằng cách trước, Ngài chỉ ra sự hoàn thành mục đích mà Đức Thế Tôn đã xuất hiện, theo lời dạy: “Này các Tỳ-kheo, một người xuất hiện trong thế gian, xuất hiện vì lợi ích của nhiều người, vì hạnh phúc của nhiều người, vì lòng từ bi đối với thế gian, vì lợi ích, vì hạnh phúc của chư thiên và loài người.
Katamo ekapuggalo?
Who is that one person?
Người duy nhất đó là ai?
Tathāgato arahaṃ sammāsambuddho’’ti (a. ni. 1.170) vacanato yadatthaṃ bhagavā uppanno, tadatthaparinipphādanaṃ, pacchimena yattha uppanno, tadanurūpavihāraṃ.
The Tathāgata, Arahant, Perfectly Self-Enlightened One"; by the latter, dwelling in a manner appropriate to where he arose.
Đó là Như Lai, bậc A-la-hán, Chánh Đẳng Giác.” Bằng cách sau, Ngài chỉ ra sự an trú phù hợp với nơi Ngài đã xuất hiện.
Bhagavā hi paṭhamaṃ lumbinivane, dutiyaṃ bodhimaṇḍeti lokiyalokuttarāya uppattiyā vaneyeva uppanno.
Indeed, the Blessed One first arose in the Lumbini Grove, and secondly at the Bodhimaṇḍa; thus, by way of both mundane and supramundane arising, he arose only in a forest.
Thật vậy, Thế Tôn, lần đầu tiên Ngài sinh ra tại rừng Lumbinī, lần thứ hai Ngài sinh ra tại Bồ Đề Đạo Tràng, như vậy, sự xuất hiện của Ngài, dù là thế gian hay siêu thế, đều diễn ra trong rừng.
Tenassa vaneyeva vihāraṃ dassetīti evamādinā nayenettha atthayojanā veditabbā.
Therefore, it shows His dwelling only in a forest; in this way and other similar ways, the application of meaning here should be understood.
Vì vậy, việc Ngài trú ngụ trong rừng được thể hiện qua cách này, và ý nghĩa của câu nói này cần được hiểu theo cách đó.
Tatrāti desakālaparidīpanaṃ.
Tatrāti indicates the place and time.
Tatrā (ở đó) là từ chỉ rõ nơi chốn và thời gian.
Tañhi yaṃ samayaṃ viharati, tatra samaye.
For at whatever time he dwells, at that time.
Thật vậy, nó chỉ rõ thời gian mà Ngài trú ngụ, là vào thời điểm đó.
Yasmiñca ārāme viharati, tatra ārāmeti dīpeti.
And in whatever monastery he dwells, it indicates that he dwells in that monastery.
Và nó chỉ rõ khu vườn mà Ngài trú ngụ, là trong khu vườn đó.
Bhāsitabbayutte vā desakāle dīpeti.
Or it indicates the suitable place and time for speaking.
Hoặc nó chỉ rõ nơi chốn và thời gian thích hợp để thuyết pháp.
Na hi bhagavā ayutte dese vā kāle vā dhammaṃ bhāsati.
For the Blessed One does not speak the Dhamma in an unsuitable place or at an unsuitable time.
Thật vậy, Thế Tôn không thuyết pháp ở nơi chốn hay thời gian không thích hợp.
‘‘Akālo kho tāva, bāhiyā’’tiādi (udā. 10) cettha sādhakaṃ.
The statement “It is not the right time yet, Bāhiya” is indeed proof of this.
Câu nói “Này Bāhiya, chưa phải lúc” là bằng chứng cho điều này.
Khoti padapūraṇamatte avadhāraṇe ādikālatthe vā nipāto.
Khoti is a particle used merely for emphasis, for ascertainment, or in the sense of a beginning time.
Kho là một từ ngữ chỉ để làm đầy câu, hoặc để nhấn mạnh, hoặc để chỉ thời điểm bắt đầu.
Bhagavāti lokagarudīpanaṃ.
Bhagavāti indicates the World's Teacher.
Bhagavā (Thế Tôn) là từ chỉ bậc Thầy của thế gian.
Bhikkhūti kathāsavanayuttapuggalavacanaṃ.
Bhikkhūti is a word for individuals suitable for listening to a discourse.
Bhikkhū (các Tỳ-kheo) là từ chỉ những người thích hợp để nghe pháp.
Api cettha ‘‘bhikkhakoti bhikkhu, bhikkhācariyaṃ ajjhupagatoti bhikkhū’’tiādinā (pārā. 45; vibha. 511) nayena vacanattho veditabbo.
Furthermore, here the meaning of the word should be understood in ways such as "one who begs is a bhikkhu; one who has undertaken the ascetic practice of begging for alms is a bhikkhu."
Và ở đây, ý nghĩa của từ này cần được hiểu theo cách như “Tỳ-kheo là người khất thực, Tỳ-kheo là người thực hành hạnh khất thực.”
Āmantesīti ālapi abhāsi sambodhesīti ayamettha attho.
Āmantesīti here means called, spoke, or informed.
Āmantesī (Ngài gọi) ở đây có nghĩa là Ngài nói, Ngài thuyết, Ngài làm cho biết.
Aññatra pana ñāpanepi hoti.
But elsewhere it also means to make known.
Tuy nhiên, ở những nơi khác, nó cũng có nghĩa là làm cho biết.
Yathāha – ‘‘āmantayāmi vo, bhikkhave, paṭivedayāmi vo, bhikkhave’’ti.
As it is said, “I exhort you, bhikkhus, I declare to you, bhikkhus.”
Như đã nói: “Này các Tỳ-kheo, Ta thông báo cho các con, này các Tỳ-kheo, Ta tuyên bố cho các con.”
Pakkosanepi.
Also for summoning.
Cũng có nghĩa là triệu tập.
Yathāha – ‘‘ehi tvaṃ, bhikkhu, mama vacanena sāriputtaṃ āmantehī’’ti (a. ni. 9.11; saṃ. ni. 2.32).
As it is said, “Come, bhikkhu, summon Sāriputta in my name.”
Như đã nói: “Này Tỳ-kheo, hãy đến và thay lời Ta gọi Tôn giả Sāriputta.”
Bhikkhavoti āmantanākāraparidīpanaṃ.
Bhikkhavoti is an indication of the manner of addressing.
Bhikkhavo (Này các Tỳ-kheo) là từ chỉ rõ cách thức xưng hô.
Tañca bhikkhanasīlatādiguṇayogasiddhattā vuttaṃ.
And that was said because it is established by the quality of being accustomed to begging, etc.
Và từ này được nói ra vì nó được thành tựu bởi sự kết hợp với các đức tính như hạnh khất thực.
Bhikkhanasīlatāguṇayuttopi hi bhikkhu, bhikkhanadhammatāguṇayuttopi bhikkhu, bhikkhane sādhukāritāguṇayuttopīti saddavidū maññanti.
Indeed, those learned in grammar consider one who possesses the quality of being accustomed to begging a bhikkhu; one who possesses the quality of the nature of begging a bhikkhu; and one who possesses the quality of being skilled in begging a bhikkhu.
Các nhà ngữ pháp cho rằng một Tỳ-kheo là người có đức tính của hạnh khất thực, một Tỳ-kheo là người có bản chất của hạnh khất thực, và một Tỳ-kheo là người khéo léo trong việc khất thực.
Tena ca nesaṃ bhikkhanasīlatādiguṇayogasiddhena vacanena hīnādhikajanasevitaṃ vuttiṃ pakāsento uddhatadīnabhāvaniggahaṃ karoti.
And by that word, established by their quality of being accustomed to begging, etc., He restrains their arrogance and dejection, by revealing a livelihood frequented by both inferior and superior people.
Và bằng lời nói được thành tựu bởi sự kết hợp với các đức tính như hạnh khất thực, Ngài loại bỏ sự kiêu ngạo và sự yếu đuối bằng cách công bố lối sống được cả người thấp kém và người cao thượng thực hành.
Bhikkhavoti iminā karuṇāvipphārasommahadayanayananipātapubbaṅgamena vacanena te attano mukhābhimukhe karoti.
By the word Bhikkhavo, which is preceded by a serene expression of compassion, a pleasant heart, and a gaze, He makes them face Him.
Bằng lời nói Này các Tỳ-kheo này, được dẫn dắt bởi sự tràn đầy lòng bi mẫn, sự an lạc của trái tim và ánh mắt, Ngài làm cho họ hướng mặt về phía mình.
Teneva ca kathetukamyatādīpakena vacanena tesaṃ sotukamyataṃ janeti.
And by that very word, which indicates His desire to speak, He arouses their desire to listen.
Và bằng lời nói thể hiện ý muốn thuyết giảng, Ngài khơi dậy ý muốn lắng nghe nơi họ.
Teneva ca sambodhanatthena sādhukaṃ savanamanasikārepi te niyojeti.
And by that very word, which means to instruct, He engages them in careful listening and attention.
Và bằng ý nghĩa của sự thức tỉnh, Ngài cũng khuyến khích họ lắng nghe và chú tâm một cách cẩn thận.
Sādhukaṃ savanamanasikārāyattā hi sāsanasampatti.
For the success of the Dispensation depends on careful listening and attention.
Thật vậy, sự thành công của giáo pháp phụ thuộc vào việc lắng nghe và chú tâm một cách cẩn thận.
Aparesupi devamanussesu vijjamānesu kasmā bhikkhūyeva āmantesīti ce?
If it is asked, “Why did he address the bhikkhus only, when there were other devas and humans present?”
Nếu hỏi: “Trong khi có những chư thiên và loài người khác, tại sao Ngài chỉ gọi các Tỳ-kheo?”
Jeṭṭhaseṭṭhāsannasadāsannihitabhāvato.
Because of their seniority, excellence, proximity, and constant presence.
Là vì họ là những người lớn tuổi nhất, cao quý nhất, gần gũi nhất và luôn ở gần Ngài.
Sabbaparisasādhāraṇā hi bhagavato dhammadesanā.
For the Dhamma discourse of the Blessed One is common to all assemblies.
Thật vậy, lời thuyết pháp của Thế Tôn là chung cho tất cả chúng hội.
Parisāya ca jeṭṭhā bhikkhū paṭhamuppannattā, seṭṭhā anagāriyabhāvaṃ ādiṃ katvā satthucariyānuvidhāyakattā sakalasāsanapaṭiggāhakattā ca.
And among the assembly, the bhikkhus are senior because they arose first, and excellent because they undertook the homeless life, followed the Teacher's conduct, and embraced the entire Dispensation.
Và trong chúng hội, các Tỳ-kheo là lớn tuổi nhất vì họ xuất hiện đầu tiên, cao quý nhất vì họ từ bỏ đời sống gia đình và noi theo hạnh của Bậc Đạo Sư, và vì họ là những người tiếp nhận toàn bộ giáo pháp.
Āsannā te tattha nisinnesu satthusantikattā.
They were near because they were seated close to the Teacher.
Họ gần gũi vì họ ngồi gần Bậc Đạo Sư.
Sadāsannihitā satthusantikāvacarattāti.
They were constantly present because they frequented the Teacher's vicinity.
Họ luôn ở gần vì họ thường xuyên ở bên Bậc Đạo Sư.
Apica te dhammadesanāya bhājanaṃ yathānusiṭṭhaṃ paṭipattisabbhāvatotipi te eva āmantesi.
Furthermore, He addressed them because they were recipients of the Dhamma discourse and capable of practicing as instructed.
Hơn nữa, Ngài chỉ gọi các Tỳ-kheo vì họ là những người xứng đáng với lời thuyết pháp, và vì họ thực hành đúng theo những gì đã được chỉ dạy.
Kimatthaṃ pana bhagavā dhammaṃ desento paṭhamaṃ bhikkhū āmantesi, na dhammameva desesīti?
But why did the Blessed One, when delivering the Dhamma, first address the bhikkhus, and not just deliver the Dhamma?
Vậy tại sao Thế Tôn lại gọi các Tỳ-kheo trước khi thuyết pháp, mà không thuyết pháp ngay lập tức?
Satijananatthaṃ.
For the purpose of arousing mindfulness.
Để khơi dậy chánh niệm.
Bhikkhū hi aññaṃ cintentāpi vikkhittacittāpi dhammaṃ paccavekkhantāpi kammaṭṭhānaṃ manasikarontāpi nisinnā honti, te anāmantetvā dhamme desiyamāne ‘‘ayaṃ desanā kiṃnidānā kiṃpaccayā katamāya aṭṭhuppattiyā desitā’’ti sallakkhetuṃ asakkontā duggahitaṃ vā gaṇheyyuṃ, na vā gaṇheyyuṃ.
For bhikkhus, even while thinking of something else, or having distracted minds, or reflecting on the Dhamma, or attending to a meditation subject, are seated. If the Dhamma were to be delivered without addressing them, they would be unable to discern "what is the origin of this teaching, what is its condition, what is the occasion for its delivery?" and might misunderstand it or not grasp it at all.
Thật vậy, các Tỳ-kheo có thể đang ngồi suy nghĩ về điều khác, hoặc tâm trí đang xao nhãng, hoặc đang quán xét giáo pháp, hoặc đang chú tâm vào đề mục thiền định. Nếu Ngài thuyết pháp mà không gọi họ, họ sẽ không thể nhận ra rằng “Bài thuyết pháp này có nguyên nhân gì, có duyên cớ gì, được thuyết ra trong hoàn cảnh nào,” và có thể hiểu sai hoặc không hiểu gì cả.
Tena nesaṃ satijananatthaṃ bhagavā paṭhamaṃ āmantetvā pacchā dhammaṃ deseti.
Therefore, to arouse their mindfulness, the Blessed One first addresses them and then delivers the Dhamma.
Vì vậy, để khơi dậy chánh niệm nơi họ, Thế Tôn gọi họ trước rồi sau đó mới thuyết pháp.
Bhadanteti gāravavacanametaṃ, satthu paṭivacanadānaṃ vā.
Bhadante is a term of respect, or a reply given to the Teacher.
Bhadante là lời kính trọng, hoặc là lời đáp lại Bậc Đạo Sư.
Api cettha ‘‘bhikkhavo’’ti vadamāno bhagavā te bhikkhū ālapati.
Furthermore, here, when the Blessed One says "Bhikkhavo," he addresses the bhikkhus.
Và ở đây, khi Thế Tôn nói “Này các Tỳ-kheo,” Ngài đang xưng hô với các Tỳ-kheo đó.
‘‘Bhadante’’ti vadamānā te bhagavantaṃ paccālapanti.
When they say "Bhadante," they address the Blessed One in return.
Khi các Tỳ-kheo nói “Bhadante,” họ đang đáp lại Thế Tôn.
Tathā ‘‘bhikkhavo’’ti bhagavā ādimhi bhāsati, ‘‘bhadante’’ti te paccābhāsanti.
Similarly, the Blessed One speaks "Bhikkhavo" at the beginning, and they reply "Bhadante."
Tương tự, Thế Tôn nói “Này các Tỳ-kheo” ở đầu, và họ đáp lại “Bhadante.”
‘‘Bhikkhavo’’ti paṭivacanaṃ dāpeti, ‘‘bhadante’’ti paṭivacanaṃ denti.
The Blessed One causes them to reply "Bhikkhavo," and they reply "Bhadante."
Ngài làm cho họ đáp lại “Này các Tỳ-kheo,” và họ đáp lại “Bhadante.”
Te bhikkhūti ye bhagavā āmantesi, te.
Te bhikkhū refers to those bhikkhus whom the Blessed One addressed.
Te bhikkhū (các Tỳ-kheo đó) là những Tỳ-kheo mà Thế Tôn đã gọi.
Bhagavato paccassosunti bhagavato āmantanaṃ paṭiassosuṃ, abhimukhā hutvā suṇiṃsu sampaṭicchiṃsu paṭiggahesunti attho.
Bhagavato paccassosu means they listened to the Blessed One's address, they listened attentively, accepted, and received it.
Bhagavato paccassosuṃ (họ đã lắng nghe Thế Tôn) có nghĩa là họ đã lắng nghe lời gọi của Thế Tôn, họ đã hướng mặt về phía Ngài để lắng nghe, chấp nhận và tiếp nhận.
Bhagavā etadavocāti bhagavā etaṃ idāni vattabbaṃ sakalaṃ suttaṃ avoca.
Bhagavā etadavocā means the Blessed One spoke this entire Sutta, which is now to be uttered.
Bhagavā etadavocā (Thế Tôn đã nói điều này) có nghĩa là Thế Tôn đã nói toàn bộ bài kinh sẽ được nói ra bây giờ.
Ettāvatā ca yaṃ āyasmatā ānandena imassa suttassa sukhāvagāhaṇatthaṃ kāladesadesakaparisāpadesapaṭimaṇḍitaṃ nidānaṃ bhāsitaṃ, tassa atthavaṇṇanā samattāti.
With this much, the explanation of the meaning of the introduction, adorned with references to time, place, speaker, and assembly, which Venerable Ānanda spoke for the easy comprehension of this Sutta, is concluded.
Đến đây, lời giải thích ý nghĩa của phần dẫn nhập đã hoàn tất, phần dẫn nhập này được Tôn giả Ānanda thuyết giảng để dễ dàng hiểu bài kinh này, được trang hoàng bằng thời gian, địa điểm, người thuyết giảng và chúng hội.
Idāni nāhaṃ, bhikkhave, aññaṃ ekarūpampi samanupassāmītiādinā nayena bhagavatā nikkhittassa suttassa vaṇṇanāya okāso anuppatto, sā panesā suttavaṇṇanā yasmā suttanikkhepaṃ vicāretvāva vuccamānā pākaṭā hoti, tasmā suttanikkhepavicāraṇā tāva veditabbā.
Now, the opportunity has arisen for the explanation of the Sutta set forth by the Blessed One in the manner of " Nāhaṃ, bhikkhave, aññaṃ ekarūpampi samanupassāmī" (I, bhikkhus, do not see any other single form). However, since this explanation of the Sutta becomes clear only when it is examined in conjunction with the Sutta's classifications, the classification of the Sutta should first be understood.
Bây giờ, đã đến lúc giải thích bài kinh được Thế Tôn thuyết giảng theo cách như “Này các Tỳ-kheo, Ta không thấy một sắc nào khác,” nhưng vì lời giải thích bài kinh này sẽ rõ ràng hơn khi quán xét cách trình bày bài kinh, nên trước tiên cần phải biết cách quán xét cách trình bày bài kinh.
Cattāro hi suttanikkhepā attajjhāsayo parajjhāsayo pucchāvasiko aṭṭhuppattikoti.
For there are four classifications of Suttas: those based on one's own intention, those based on others' intentions, those based on questions, and those based on occasion of arising.
Thật vậy, có bốn cách trình bày bài kinh: do ý muốn của chính mình, do ý muốn của người khác, do câu hỏi, và do hoàn cảnh phát sinh.
Tattha yāni suttāni bhagavā parehi anajjhiṭṭho kevalaṃ attano ajjhāsayeneva kathesi, seyyathidaṃ – ākaṅkheyyasuttaṃ vatthasuttanti evamādīni, tesaṃ attajjhāsayo nikkhepo.
Among these, Suttas which the Blessed One spoke solely of His own accord, not being requested by others, such as the Ākaṅkheyyasutta, the Vatthasutta, and so on—their classification is based on His own intention.
Trong đó, những bài kinh mà Thế Tôn thuyết giảng chỉ do ý muốn của chính Ngài mà không do người khác thỉnh cầu, chẳng hạn như kinh Ākaṅkheyya, kinh Vatthasutta, v.v., thì cách trình bày của chúng là do ý muốn của chính mình.
Yāni pana ‘‘paripakkā kho rāhulassa vimuttiparipācanīyā dhammā, yaṃnūnāhaṃ rāhulaṃ uttari āsavānaṃ khaye vineyya’’nti (saṃ. ni. 4.121; ma. ni. 3.416) evaṃ paresaṃ ajjhāsayaṃ khantiṃ manaṃ abhinīhāraṃ bujjhanabhāvañca oloketvā parajjhāsayavasena kathitāni, seyyathidaṃ – rāhulovādasuttaṃ dhammacakkappavattananti evamādīni, tesaṃ parajjhāsayo nikkhepo.
However, Suttas that were spoken in accordance with the intentions of others, after observing their inclination, patience, mental disposition, aspiration, and capacity for understanding—such as the Rāhulovādasutta, the Dhammacakkappavattana, and so on—their classification is based on others' intentions.
Còn những bài kinh được thuyết giảng do ý muốn của người khác, sau khi quán xét ý muốn, sự chấp nhận, tâm ý, sự mong muốn và khả năng thấu hiểu của họ, chẳng hạn như kinh Rāhulovāda, kinh Dhammacakkappavattana, v.v., thì cách trình bày của chúng là do ý muốn của người khác.
Bhagavantaṃ pana upasaṅkamitvā te te devamanussā tathā tathā pañhaṃ pucchanti.
But when various devas and humans approached the Blessed One and asked questions in various ways.
Còn những bài kinh được Thế Tôn thuyết giảng khi các chư thiên và loài người đến gần và hỏi những câu hỏi khác nhau.
Evaṃ puṭṭhena bhagavatā yāni kathitāni devatāsaṃyuttabojjhaṅgasaṃyuttādīni, tesaṃ pucchāvasiko nikkhepo.
The Suttas spoken by the Blessed One in response to such questions, such as the Devatāsaṃyutta, Bojjhaṅgasaṃyutta, and so on—their classification is based on questions.
Những bài kinh như Devatāsaṃyutta, Bojjhaṅgasaṃyutta, v.v., thì cách trình bày của chúng là do câu hỏi.
Yāni pana uppannaṃ kāraṇaṃ paṭicca kathitāni dhammadāyādasuttaputtamaṃsūpamādīni, tesaṃ aṭṭhuppattiko nikkhepo.
However, Suttas that were spoken in dependence on an arisen occasion, such as the Dhammadāyādasutta, the Puttamaṃsūpamasutta, and so on—their classification is based on occasion of arising.
Còn những bài kinh được thuyết giảng do một nguyên nhân phát sinh, chẳng hạn như kinh Dhammadāyāda, kinh Puttamaṃsūpama, v.v., thì cách trình bày của chúng là do hoàn cảnh phát sinh.
Evamimesu catūsu nikkhepesu imassa suttassa parajjhāsayo nikkhepo.
Thus, among these four classifications, the classification of this Sutta is based on others' intentions.
Như vậy, trong bốn cách trình bày này, cách trình bày của bài kinh này là do ý muốn của người khác.
Parajjhāsayavasena hetaṃ nikkhittaṃ.
For it was set forth in accordance with the intentions of others.
Thật vậy, bài kinh này được thuyết giảng do ý muốn của người khác.
Kesaṃ ajjhāsayenāti?
Whose intentions?
Do ý muốn của ai?
Rūpagarukānaṃ purisānaṃ.
Of men who were attached to rūpa (form).
Của những người trọng hình sắc.
Tattha nāhaṃ, bhikkhavetiādīsu nakāro paṭisedhattho.
Among the phrases nāhaṃ, bhikkhave and so on, the particle "na" carries the meaning of negation.
Trong đó, trong các từ nāhaṃ, bhikkhave (này các Tỳ-kheo, Ta không), âm “na” có nghĩa là phủ định.
Ahanti attānaṃ niddisati.
Ahaṃ refers to oneself.
Ahaṃ (Ta) chỉ về chính mình.
Bhikkhaveti bhikkhū ālapati.
Bhikkhave addresses the bhikkhus.
Bhikkhave (Này các Tỳ-kheo) là lời xưng hô với các Tỳ-kheo.
Aññanti idāni vattabbā itthirūpato aññaṃ.
Aññaṃ means other than the form of a woman, which is now to be mentioned.
Aññaṃ (khác) là khác với hình sắc của người nữ sẽ được nói đến bây giờ.
Ekarūpampīti ekampi rūpaṃ.
Ekarūpampi means even a single form.
Ekarūpampi (dù chỉ một hình sắc) là dù chỉ một hình sắc.
Samanupassāmīti dve samanupassanā ñāṇasamanupassanā ca diṭṭhisamanupassanā ca.
Samanupassāmi: there are two kinds of close observation: observation by wisdom (ñāṇasamanupassanā) and observation by wrong view (diṭṭhisamanupassanā).
Samanupassāmī (Ta thấy) có hai loại quán sát: quán sát bằng trí tuệ và quán sát bằng tà kiến.
Tattha ‘‘aniccato samanupassati, no niccato’’ti (paṭi. ma. 3.35) ayaṃ ñāṇasamanupassanā nāma.
Among these, "one observes impermanence, not permanence" is called observation by wisdom.
Trong đó, “quán sát vô thường, không phải thường” thì được gọi là quán sát bằng trí tuệ.
‘‘Rūpaṃ attato samanupassatī’’tiādikā (paṭi. ma. 1.130) pana diṭṭhisamanupassanā nāma.
But such* as, ‘one repeatedly contemplates material form as self,’ and so on, is called view-contemplation (diṭṭhisamanupassanā).
Tuy nhiên, sự quán sát như: “Quán sát sắc là tự ngã” và những điều tương tự là diṭṭhisamanupassanā (quán sát bằng tà kiến).
Tāsu idha ñāṇasamanupassanā adhippetā.
Among these, here, wisdom-contemplation (ñāṇasamanupassanā) is intended.
Trong số đó, ở đây, sự quán sát bằng tuệ (ñāṇasamanupassanā) được đề cập.
Imassa pana padassa nakārena sambandho veditabbo.
However, the connection of this word should be understood with the negative particle 'na'.
Tuy nhiên, đối với từ này, cần hiểu rằng nó có liên hệ với tiếp đầu ngữ 'na'.
Idaṃ hi vuttaṃ hoti – ahaṃ, bhikkhave, sabbaññutaññāṇena olokentopi aññaṃ ekarūpampi na samanupassāmīti.
For this is what is said: “Monks, even when I look with omniscience, I do not repeatedly contemplate even a single other material form.”
Điều này có nghĩa là: “Này các Tỳ-khưu, ngay cả khi Ta quán sát bằng tuệ Toàn giác, Ta cũng không thấy có một sắc nào khác.”
Yaṃ evaṃ purisassa cittaṃ pariyādāya tiṭṭhatīti yaṃ rūpaṃ rūpagarukassa purisassa catubhūmakakusalacittaṃ pariyādiyitvā gaṇhitvā khepetvā tiṭṭhati.
"Which thus thoroughly seizes the mind of a man" means that material form which seizes, takes hold of, and destroys the four-level wholesome mind of a man who is attached to material form.
Yaṃ evaṃ purisassa cittaṃ pariyādāya tiṭṭhatīti (sắc) nào chiếm đoạt, nắm giữ và tiêu diệt tâm thiện bốn cõi của người nặng về sắc.
‘‘Sabbaṃ hatthikāyaṃ pariyādiyitvā’’tiādīsu (saṃ. ni. 1.126) hi gahaṇaṃ pariyādānaṃ nāma.
For in phrases like, "having completely seized the body of the elephant," taking is called pariyādāna.
Trong các câu như: “Chiếm đoạt toàn bộ thân voi”, thì sự nắm giữ được gọi là pariyādānaṃ.
‘‘Aniccasaññā, bhikkhave, bhāvitā bahulīkatā sabbaṃ kāmarāgaṃ pariyādiyatī’’tiādīsu (saṃ. ni. 3.102) khepanaṃ.
In phrases like, "Monks, the perception of impermanence, developed and cultivated, completely destroys all sensual passion," destroying is meant.
Trong các câu như: “Này các Tỳ-khưu, vô thường tưởng được tu tập, được làm cho sung mãn, sẽ tiêu diệt mọi dục ái”, là sự tiêu diệt.
Idha ubhayampi vaṭṭati.
Here, both are suitable.
Ở đây, cả hai nghĩa đều phù hợp.
Tattha idaṃ rūpaṃ catubhūmakakusalacittaṃ gaṇhantaṃ na nīluppalakalāpaṃ puriso viya hatthena gaṇhāti, nāpi khepayamānaṃ aggi viya uddhane udakaṃ santāpetvā khepeti.
In this regard, this material form, when seizing the four-level wholesome mind, does not seize it with the hand like a man seizing a bundle of blue water lilies; nor, when destroying it, does it destroy it by heating and exhausting water in a stove like fire.
Trong đó, sắc này khi nắm giữ tâm thiện bốn cõi thì không nắm giữ như người dùng tay nắm bó hoa sen xanh, cũng không tiêu diệt như lửa làm nóng nước trong lò rồi làm cho nó cạn khô.
Uppattiñcassa nivārayamānameva catubhūmakampi kusalacittaṃ gaṇhāti ceva khepeti cāti veditabbaṃ.
But it should be understood that, by preventing its arising, it both seizes and destroys even the four-level wholesome mind.
Cần hiểu rằng, chính khi ngăn cản sự phát sinh của nó, sắc này vừa nắm giữ vừa tiêu diệt tâm thiện bốn cõi.
Tena vuttaṃ – ‘‘purisassa cittaṃ pariyādāya tiṭṭhatī’’ti.
Therefore, it is said: "it thoroughly seizes the mind of a man."
Do đó, có lời dạy: “Chiếm đoạt tâm của người.”
Yathayidanti yathā idaṃ.
"Just as this" (yathāyidaṃ) means "just as this" (yathā idaṃ).
Yathayidaṃ có nghĩa là yathā idaṃ (như thế này).
Itthirūpanti itthiyā rūpaṃ.
"Woman's form" (itthirūpaṃ) means the form of a woman.
Itthirūpaṃ có nghĩa là sắc của phụ nữ.
Tattha ‘‘kiñca, bhikkhave, rūpaṃ vadetha?
In this regard, "And what, bhikkhus, do you call form?
Trong đó, “Này các Tỳ-khưu, các ông gọi là sắc gì?
Ruppatīti kho, bhikkhave, tasmā rūpanti vuccati.
'It changes,' bhikkhus, therefore it is called form.
Này các Tỳ-khưu, vì nó biến hoại, nên gọi là sắc.
Kena ruppati?
By what does it change?
Biến hoại bởi cái gì?
Sītenapi ruppati uṇhenapi ruppatī’’ti (saṃ. ni. 3.79) suttānusārena rūpassa vacanattho ceva sāmaññalakkhaṇañca veditabbaṃ.
It changes by cold, it changes by heat," and so on, according to the Sutta, the etymological meaning of rūpa and its general characteristic should be understood.
Biến hoại bởi lạnh, biến hoại bởi nóng”, theo kinh này, cần hiểu nghĩa của từ sắc và đặc tính chung của nó.
Ayaṃ pana rūpasaddo khandhabhavanimittapaccayasarīravaṇṇasaṇṭhānādīsu anekesu atthesu vattati.
But this word rūpa is used in many meanings such as aggregate, existence, sign, condition, body, color, shape, and so on.
Tuy nhiên, từ rūpa này được dùng với nhiều nghĩa khác nhau như uẩn, hữu, tướng, duyên, thân, sắc, hình dáng, v.v.
Ayañhi ‘‘yaṃ kiñci rūpaṃ atītānāgatapaccuppanna’’nti (vibha. 2; mahāva. 22) ettha rūpakkhandhe vattati.
For here, in "whatever form, past, future, or present," it refers to the aggregate of form (rūpakkhandha).
Từ này được dùng với nghĩa sắc uẩn trong câu: “Bất cứ sắc nào, quá khứ, vị lai, hiện tại”.
‘‘Rūpūpapattiyā maggaṃ bhāvetī’’ti (dha. sa. 161; vibha. 624) ettha rūpabhave.
In "he develops the path to rebirth in the form realm," it refers to existence in the form realm (rūpabhava).
Trong câu: “Tu tập con đường dẫn đến tái sanh vào cõi sắc”, được dùng với nghĩa sắc hữu.
‘‘Ajjhattaṃ arūpasaññī bahiddhā rūpāni passatī’’ti (dha. sa. 204-232 ādayo) ettha kasiṇanimitte.
In "having the perception of formlessness internally, he sees forms externally," it refers to the kasiṇa sign.
Trong câu: “Nội tâm không có tưởng về vô sắc, bên ngoài thấy các sắc”, được dùng với nghĩa kasiṇanimitta (tướng đất).
‘‘Sarūpā, bhikkhave, uppajjanti pāpakā akusalā dhammā no arūpā’’ti (a. ni. 2.83) ettha paccaye.
In "Bhikkhus, evil unwholesome states arise with conditions (sarūpā), not without conditions (arūpā)," it refers to condition.
Trong câu: “Này các Tỳ-khưu, các pháp bất thiện, ác pháp sanh khởi có duyên, không phải vô duyên”, được dùng với nghĩa duyên.
‘‘Ākāso parivārito rūpanteva saṅkhaṃ gacchatī’’ti (ma. ni. 1.306) ettha sarīre.
In "space surrounded by them is reckoned as body (rūpaṃ)," it refers to body.
Trong câu: “Không gian bị bao bọc được gọi là thân”, được dùng với nghĩa thân.
‘‘Cakkhuñca paṭicca rūpe ca uppajjati cakkhuviññāṇa’’nti (ma. ni. 1.400; 3.421) ettha vaṇṇe.
In "dependent on the eye and forms, eye-consciousness arises," it refers to color.
Trong câu: “Nương vào mắt và các sắc, nhãn thức sanh khởi”, được dùng với nghĩa sắc (màu sắc).
‘‘Rūpappamāṇo rūpappasanno’’ti (a. ni. 4.65) ettha saṇṭhāne.
In "one whose measure is form, one who is pleased with form," it refers to shape.
Trong câu: “Rūpappamāṇo rūpappasanno (người lấy hình dáng làm chuẩn mực, người hoan hỷ với hình dáng)”, được dùng với nghĩa hình dáng.
Ādisaddena ‘‘piyarūpaṃ sātarūpaṃ, arasarūpo’’tiādīnipi saṅgaṇhitabbāni.
By the term 'and so on,' also "agreeable form, pleasurable form, unpleasant form," and so on, should be included.
Với từ “v.v.”, cần bao gồm cả các từ như: “piyarūpaṃ sātarūpaṃ (sắc đáng yêu, sắc khả ý), arasarūpo (vô vị)”.
Idha panesa itthiyā catusamuṭṭhāne rūpāyatanasaṅkhāte vaṇṇe vattati.
But here, this refers to the color of a woman, which is called the rūpāyatana (visible object), arising from four causes.
Tuy nhiên, ở đây, từ này được dùng với nghĩa sắc (màu sắc) thuộc sắc xứ, do bốn nguyên nhân phát sinh của phụ nữ.
Apica yo koci itthiyā nivatthanivāsanassa vā alaṅkārassa vā gandhavaṇṇakādīnaṃ vā piḷandhanamālādīnaṃ vāti kāyappaṭibaddho ca vaṇṇo purisassa cakkhuviññāṇassa ārammaṇaṃ hutvā upakappati, sabbametaṃ itthirūpanteva veditabbaṃ.
Furthermore, whatever color connected to a woman's clothing, adornments, perfumes, dyes, garlands, and so on, serves as an object for a man's eye-consciousness, all of that should be understood as 'woman's form'.
Hơn nữa, bất cứ màu sắc nào liên quan đến thân của người phụ nữ, như y phục, trang sức, hương liệu, phấn son, vòng hoa, v.v., trở thành đối tượng của nhãn thức của người đàn ông và trở nên hữu ích (cho sự chiếm đoạt), tất cả những điều này đều được hiểu là sắc của phụ nữ.
Itthirūpaṃ, bhikkhave, purisassa cittaṃ pariyādāya tiṭṭhatīti idaṃ purimasseva daḷhīkaraṇatthaṃ vuttaṃ.
"Woman's form, bhikkhus, thoroughly seizes the mind of a man"—this is stated to reinforce the former statement.
Này các Tỳ-khưu, sắc của phụ nữ chiếm đoạt tâm của người đàn ông – câu này được nói để củng cố ý nghĩa đã nói trước đó.
Purimaṃ vā ‘‘yathayidaṃ, bhikkhave, itthirūpa’’nti evaṃ opammavasena vuttaṃ, idaṃ pariyādānānubhāvadassanavasena.
Or, the former statement, "just as this woman's form, bhikkhus," was made by way of analogy, while this is by way of demonstrating the power of seizure.
Hoặc, câu trước “Này các Tỳ-khưu, sắc của phụ nữ như thế này” được nói theo nghĩa ví dụ, còn câu này được nói theo nghĩa thể hiện sức mạnh của sự chiếm đoạt.
Tatridaṃ itthirūpassa pariyādānānubhāve vatthu – mahādāṭhikanāgarājā kira cetiyagirimhi ambatthale mahāthūpaṃ kārāpetvā giribhaṇḍapūjaṃ nāma katvā kālena kālaṃ orodhagaṇaparivuto cetiyagiriṃ gantvā bhikkhusaṅghassa mahādānaṃ deti.
In this connection, here is a story about the power of woman's form to seize: It is said that Mahādāṭhika Nāgarāja, after having a great stupa built at Cetiyagiri in Ambatthala and performing a Giribhaṇḍa-pūjā, would from time to time go to Cetiyagiri surrounded by his retinue of royal women and offer great alms to the Saṅgha of bhikkhus.
Liên quan đến sức mạnh chiếm đoạt của sắc nữ, có một câu chuyện như sau: Vua Mahādāṭhika Nāgarāja, sau khi xây dựng Đại Tháp trên núi Cetiyagiri tại Ambatthala, đã tổ chức lễ cúng dường Giribhaṇḍapūjā và thường xuyên cùng đoàn tùy tùng hoàng gia đến núi Cetiyagiri để cúng dường đại thí cho Tăng đoàn.
Bahūnaṃ sannipātaṭṭhāne nāma na sabbesaṃ sati sūpaṭṭhitā hoti, rañño ca damiḷadevī nāma mahesī paṭhamavaye ṭhitā dassanīyā pāsādikā.
In a place where many gather, not everyone's mindfulness is well-established, and the king's chief queen, Damiḷadevī, was in the prime of her youth, beautiful and charming.
Ở nơi tụ họp đông người, không phải ai cũng giữ được chánh niệm. Hoàng hậu của nhà vua, tên là Damiḷadevī, đang ở tuổi xuân sắc, có dung mạo khả ái và đáng yêu.
Atheko cittatthero nāma vuḍḍhapabbajito asaṃvaraniyāmena olokento tassā rūpārammaṇe nimittaṃ gahetvā ummādappatto viya ṭhitanisinnaṭṭhānesu ‘‘handa damiḷadevī, handa damiḷadevī’’ti vadanto vicarati.
Then a certain elder named Citta Thera, an old bhikkhu who had ordained late in life, looking without restraint, took a mental sign (nimitta) from her form-object and, as if mad, would wander around saying, "Oh, Damiḷadevī! Oh, Damiḷadevī!" in places where he stood or sat.
Một vị Trưởng lão tên là Cittatthera, một vị xuất gia lớn tuổi, nhìn bà một cách phóng túng, đã nắm giữ tướng sắc (nimitta) của bà, và trở nên như người điên, đi lại khắp nơi, ngồi đứng đều lẩm bẩm: “Ôi Damiḷadevī, ôi Damiḷadevī!”
Tato paṭṭhāya cassa daharasāmaṇerā ummattakacittattherotveva nāmaṃ katvā vohariṃsu.
From that time onwards, the young novices called him 'Ummattaka Citta Thera' (Mad Citta Thera).
Từ đó, các Sa-di trẻ gọi ông là “Trưởng lão Cittatthera điên”.
Atha sā devī nacirasseva kālamakāsi.
Then, that queen passed away not long after.
Sau đó, vị hoàng hậu ấy không lâu sau đã qua đời.
Bhikkhusaṅghe sivathikadassanaṃ gantvā āgate daharasāmaṇerā tassa santikaṃ gantvā evamāhaṃsu – ‘‘bhante cittatthera, yassatthāya tvaṃ vilapasi, mayaṃ tassā deviyā sivathikadassanaṃ gantvā āgatā’’ti.
When the young novices returned from visiting the charnel ground with the Saṅgha, they went to him and said, "Venerable Citta Thera, for whose sake you lament, we have returned from visiting that queen's charnel ground."
Các Sa-di trẻ, sau khi cùng Tăng đoàn đi xem thi thể ở bãi tha ma trở về, đến gặp vị Trưởng lão ấy và nói: “Bạch Trưởng lão Cittatthera, vì ai mà ngài than vãn, chúng con đã đi xem thi thể của vị hoàng hậu ấy ở bãi tha ma về rồi.”
Evaṃ vuttepi assaddahanto ‘‘yassā vā tassā vā tumhe sivathikadassanatthāya gatā, mukhaṃ tumhākaṃ dhūmaṇṇa’’nti.
Even when this was said, not believing it, he said, "Whether it was for her or for another that you went to see the charnel ground, your faces are smoke-colored,"
Dù được nói như vậy, ông vẫn không tin và nói: “Dù các ngươi đi xem thi thể của ai đó, mặt các ngươi đen như khói.”
Ummattakavacanameva avoca.
and spoke only the words of a madman.
Ông chỉ nói những lời của người điên.
Evaṃ ummattakacittattherassa cittaṃ pariyādāya aṭṭhāsi idaṃ itthirūpaṃ.
Thus, this woman's form thoroughly seized the mind of Ummattaka Citta Thera.
Như vậy, sắc của người phụ nữ này đã chiếm đoạt tâm của Trưởng lão Cittatthera điên.
Aparampi vatthu – saddhātissamahārājā kira ekadivasaṃ orodhagaṇaparivuto vihāraṃ āgato.
Another story: It is said that King Saddhātissa, surrounded by his retinue, came to the monastery one day.
Một câu chuyện khác: Vua Saddhātissa, một ngày nọ, cùng đoàn tùy tùng hoàng gia đến một ngôi tịnh xá.
Eko daharo lohapāsādadvārakoṭṭhake ṭhatvā asaṃvare ṭhito ekaṃ itthiṃ olokesi.
A young bhikkhu stood at the gateway of the Brazen Palace and, being unrestrained, looked at a woman.
Một vị Tỳ-khưu trẻ đứng ở cổng tháp Loṇapāsāda, trong trạng thái phóng túng, đã nhìn một người phụ nữ.
Sāpi gamanaṃ pacchinditvā taṃ olokesi.
She too stopped her going and looked at him.
Người phụ nữ ấy cũng dừng bước và nhìn lại vị Tỳ-khưu.
Ubhopi abbhantare uṭṭhitena rāgagginā ḍayhitvā kālamakaṃsu.
Both, consumed by the fire of passion that had arisen within them, passed away.
Cả hai đều bị ngọn lửa ái dục bùng cháy bên trong thiêu đốt và đã qua đời.
Evaṃ itthirūpaṃ daharassa cittaṃ pariyādāya tiṭṭhati.
Thus, woman's form thoroughly seizes the mind of a young man.
Như vậy, sắc của người phụ nữ đã chiếm đoạt tâm của vị Tỳ-khưu trẻ.
Aparampi vatthu – kalyāṇiyamahāvihārato kireko daharo uddesatthāya kāḷadīghavāpigāmadvāravihāraṃ gantvā niṭṭhituddesakicco atthakāmānaṃ vacanaṃ aggahetvā ‘‘gataṭṭhāne daharasāmaṇerehi puṭṭhena gāmassa niviṭṭhākāro kathetabbo bhavissatī’’ti gāme piṇḍāya caranto visabhāgārammaṇe nimittaṃ gahetvā attano vasanaṭṭhānaṃ gato tāya nivatthavatthaṃ sañjānitvā ‘‘kahaṃ, bhante, idaṃ laddha’’nti pucchanto tassā matabhāvaṃ ñatvā ‘‘evarūpā nāma itthī maṃ nissāya matā’’ti cintento antouṭṭhitena rāgagginā ḍayhitvā jīvitakkhayaṃ pāpuṇi.
Another story: It is said that a certain young bhikkhu from Kalyāṇī Mahāvihāra went to Kāḷadīghavāpi Village-gate Monastery for his studies, and after completing his task of learning, disregarded the advice of those who wished him well. Thinking, "When questioned by the young novices in the place I have gone to, I will have to describe the situation of the village," he went on alms round in the village and, taking a mental sign from an unsuitable object, returned to his lodging. Recognizing the clothes worn by that woman, he asked, "Venerable sir, where did you obtain these?" When he heard this, knowing of her death, he thought, "Such a woman died because of me," and being consumed by the fire of passion that arose within him, he met his end of life.
Một câu chuyện khác: Có một vị Tỳ-khưu trẻ từ Đại Tịnh Xá Kalyāṇiya đã đến Tịnh Xá Kāḷadīghavāpigāma để học Pali. Sau khi hoàn thành việc học, ông không nghe lời khuyên của các vị sư có lòng tốt, nghĩ rằng: “Khi trở về nơi đã đến, các Sa-di trẻ sẽ hỏi ta về tình hình của ngôi làng”, nên ông đi khất thực trong làng. Ông đã nắm giữ tướng (nimitta) của một đối tượng không phù hợp (một người phụ nữ), rồi trở về nơi ở của mình. Khi nhận ra chiếc áo mà người phụ nữ ấy đã mặc, ông hỏi: “Bạch thầy, chiếc áo này được tìm thấy ở đâu?” Khi biết được người phụ nữ ấy đã chết, ông nghĩ: “Một người phụ nữ như vậy đã chết vì ta”, và bị ngọn lửa ái dục bùng cháy từ bên trong thiêu đốt, rồi ông đã mất mạng.
Evampi idaṃ itthirūpaṃ purisassa cittaṃ pariyādāya tiṭṭhatīti veditabbaṃ.
In this way too, it should be understood that this woman's form thoroughly seizes the mind of a man.
Như vậy, sắc của người phụ nữ này cũng chiếm đoạt tâm của người đàn ông, cần được hiểu như thế.
2. Dutiyādīni saddagarukādīnaṃ āsayavasena vuttāni.
2. The second and subsequent* were taught according to the disposition of those who were attached to sounds, and so on.
2. Các kinh thứ hai trở đi được nói tùy theo khuynh hướng của những người nặng về tiếng, v.v.
Tesu itthisaddoti itthiyā cittasamuṭṭhāno kathitagītavāditasaddo.
Among these, "woman's sound" (itthisaddo) refers to the spoken, sung, or played sound of a woman, which arises from the mind.
Trong số đó, itthisaddo là tiếng nói, tiếng hát, tiếng nhạc cụ do tâm của người phụ nữ tạo ra.
Apica itthiyā nivatthanivāsanassāpi alaṅkatālaṅkārassāpi itthipayoganipphādito vīṇāsaṅkhapaṇavādisaddopi itthisaddotveva veditabbo.
Furthermore, any sound that is connected with a woman's clothes or adornments, or the sound of a lute, conch, drum, etc., produced by a woman's effort, should also be understood as "woman's sound."
Hơn nữa, tiếng của y phục, trang sức của người phụ nữ, cũng như tiếng đàn hạc, tù và, trống, v.v., được tạo ra do sự tác động của người phụ nữ, đều được hiểu là itthisadda (tiếng của người phụ nữ).
Sabbopi heso purisassa cittaṃ pariyādāya tiṭṭhati.
All of this thoroughly seizes the mind of a man.
Tất cả những điều này đều chiếm đoạt tâm của người đàn ông.
Tattha suvaṇṇakakkaṭakasuvaṇṇamoradaharabhikkhuādīnaṃ vatthūni veditabbāni.
In this context, the stories of the golden crab, the golden peacock, the young bhikkhu, and others should be known.
Trong đó, cần hiểu các câu chuyện về cua vàng, công vàng, và vị Tỳ-khưu trẻ, v.v.
Pabbatantaraṃ kira nissāya mahantaṃ hatthināgakulaṃ vasati.
It is said that a large herd of noble elephants lived relying on a mountain range.
Nghe nói, có một đàn voi lớn sống nương tựa giữa hai ngọn núi.
Avidūraṭṭhāne cassa mahāparibhogasaro atthi, tasmiṃ kāyūpapanno suvaṇṇakakkaṭako atthi.
And not far from there, there was a large lake used by many beings, and in that lake lived a golden crab endowed with a huge body.
Và ở một nơi không xa, có một hồ nước lớn được nhiều loài voi chúa sử dụng, trong hồ nước đó có một con cua vàng với thân thể to lớn.
So taṃ saraṃ otiṇṇotiṇṇe saṇḍāsena viya aḷehi pāde gahetvā attano vasaṃ netvā māreti.
Whatever beings descended into that lake, it would seize them by the feet with its claws, as if with pincers, drag them to its dwelling place, and kill them.
Con cua vàng đó, những chúng sinh nào xuống hồ, nó liền dùng càng kẹp lấy chân như thể dùng cái kẹp, rồi mang về nơi ở của mình và giết chết.
Tassa otārāpekkhā hatthināgā ekaṃ mahāhatthiṃ jeṭṭhakaṃ katvā vicaranti.
The lordly elephants, wary of the crab, made one great elephant their leader and wandered about.
Những con voi chúa chờ đợi cơ hội của nó, đã chọn một con voi chúa lớn làm thủ lĩnh và đi lang thang.
So ekadivasaṃ taṃ hatthināgaṃ gaṇhi.
One day, that crab seized this lordly elephant.
Một ngày nọ, con cua vàng đó đã bắt lấy con voi chúa ấy.
Thāmasatisampanno hatthināgo cintesi – ‘‘sacāhaṃ bhītaravaṃ ravissāmi, sabbe yathāruciyā akīḷitvā palāyissantī’’ti niccalova aṭṭhāsi.
The lordly elephant, endowed with strength and mindfulness, thought: "If I utter a cry of fear, all will flee without enjoying themselves." So it remained motionless.
Con voi chúa đầy sức mạnh và chánh niệm suy nghĩ: “Nếu ta phát ra tiếng kêu sợ hãi, tất cả (những con voi khác) sẽ bỏ chạy mà không vui đùa theo ý muốn.” Vậy là nó đứng yên không lay động.
Atha sabbesaṃ uttiṇṇabhāvaṃ ñatvā tena gahitabhāvaṃ attano bhariyaṃ jānāpetuṃ viravitvā evamāha –
Then, knowing that all the other elephants had gone up, and wishing to inform its mate that it had been seized, it cried out and spoke thus:
Sau đó, khi biết tất cả (những con voi khác) đã lên bờ, để cho vợ mình biết việc nó bị bắt, nó liền rống lên và nói như sau:
Kuḷīro saha itthisaddassavanena gahaṇaṃ sithilamakāsi.
Upon hearing the female's voice, the crab loosened its grip.
Ngay khi nghe tiếng voi cái, con cua liền nới lỏng sự kẹp giữ. Sau đó, voi chúa nghĩ: “Đây chính là cơ hội của ta,” liền giữ nguyên một chân như thể đang bị kẹp, nhấc chân thứ hai lên, giẫm lên mai cua, nghiền nát nó, kéo một chút lên bờ rồi quăng xuống. Sau đó, tất cả những con voi khác tụ tập lại và nghiền nát nó, nói: “Đây là kẻ thù của chúng ta.” Như vậy, tiếng nói của phụ nữ đã chi phối tâm trí của con cua vàng.
Atha hatthināgo ‘‘ayamevetassa okāso’’ti ekaṃ pādaṃ gahitākāreneva ṭhapetvā dutiyaṃ ukkhipitvā taṃ piṭṭhikapāle akkamitvā vicuṇṇikaṃ katvā thokaṃ ākaḍḍhitvā tīre khipi.
Then the lordly elephant, thinking "This is my opportunity," kept one foot as if still caught, lifted the second, stepped on the crab's shell, crushed it to powder, dragged it a little, and threw it onto the bank.
Sau đó, voi chúa nghĩ: “Đây chính là cơ hội của nó,” liền giữ nguyên một chân như thể đang bị kẹp, nhấc chân thứ hai lên, giẫm lên mai cua, nghiền nát nó, kéo một chút lên bờ rồi quăng xuống.
Atha naṃ sabbahatthino sannipatitvā ‘‘amhākaṃ verī’’ti vicuṇṇayiṃsu.
Then all the elephants gathered and cried, "This is our enemy!" and crushed it to powder.
Sau đó, tất cả những con voi khác tụ tập lại và nghiền nát nó, nói: “Đây là kẻ thù của chúng ta.”
Evaṃ tāva itthisaddo suvaṇṇakakkaṭakassa cittaṃ pariyādiyitvā tiṭṭhati.
Thus, the female voice first completely captivated the mind of the golden crab.
Như vậy, tiếng nói của phụ nữ đã chi phối tâm trí của con cua vàng.
Iminā niyāmena satta vassasatāni vītināmetvā ekadivasaṃ parittakammato puretarameva morakukkuṭikāya saddaṃ sutvā parittakammaṃ asaritvā raññā pesitassa luddakassa vasaṃ upagato.
In this manner, having passed seven hundred years, one day, just before performing the protective chant, it heard the voice of a peahen, forgot its protective chant, and fell into the power of a hunter sent by the king.
Theo cách này, sau khi trải qua bảy trăm năm, một ngày nọ, nó nghe tiếng con công mái ngay trước khi thực hiện nghi thức bảo hộ, và vì không nhớ đến nghi thức bảo hộ, nó đã rơi vào tay của người thợ săn do nhà vua phái đến.
Evaṃ itthisaddo suvaṇṇamorassa cittaṃ pariyādiyitvā tiṭṭhatīti.
Thus, the female voice completely captivated the mind of the golden peacock.
Như vậy, tiếng nói của phụ nữ đã chi phối tâm trí của con công vàng.
Chātapabbatavāsī daharo pana sudhāmuṇḍakavāsī daharo ca itthisaddaṃ sutvā anayabyasanaṃ pattāti.
Moreover, the young bhikkhu dwelling at Chātapabbata and the young bhikkhu dwelling at Sudhāmuṇḍaka, upon hearing a female voice, met with ruin and misfortune.
Còn vị tỳ khưu trẻ sống ở núi Chāta và vị tỳ khưu trẻ sống ở Sudhāmuṇḍaka, sau khi nghe tiếng nói của phụ nữ, đã rơi vào sự bất hạnh và tai họa.
3. Tatiye itthigandhoti itthiyā catusamuṭṭhānikaṃ gandhāyatanaṃ.
3. In the third Sutta, female scent (itthigandho) refers to the scent sense-sphere of a woman, which arises from four causes.
3. Ở phần thứ ba, itthigandho (hương của phụ nữ) là đối tượng mùi hương (gandhāyatana) phát sinh từ bốn yếu tố của phụ nữ.
Svāyaṃ itthiyā sarīragandho duggandho hoti, kāyāruḷho pana āgantukaanulepanādigandho idha adhippeto.
Although the natural body odor of a woman is malodorous, the adventitious scents of perfume, anointing, and so on, applied to her body, are intended here.
Mùi hương tự nhiên của cơ thể phụ nữ là mùi hôi, nhưng ở đây, ý muốn nói đến mùi hương từ nước hoa, dầu thơm, v.v., được thoa lên cơ thể.
Ekaccā hi itthī assagandhinī hoti, ekaccā meṇḍakagandhinī, ekaccā sedagandhinī, ekaccā soṇitagandhinī.
Indeed, some women have the scent of a horse, some the scent of a goat, some the scent of sweat, and some the scent of menstrual blood.
Thật vậy, một số phụ nữ có mùi như ngựa, một số có mùi như cừu, một số có mùi mồ hôi, một số có mùi máu.
Ekacco andhabālo evarūpāyapi itthiyā rajjateva.
And some foolish blind person becomes infatuated even with such a woman.
Một số người ngu si vẫn bị mê hoặc bởi những phụ nữ có mùi hương như vậy.
Cakkavattino pana itthiratanassa kāyato candanagandho vāyati, mukhato ca uppalagandho.
However, from the body of a universal monarch’s wife-jewel (itthiratana), the scent of sandalwood wafts, and from her mouth, the scent of a blue lotus.
Tuy nhiên, từ thân thể của nữ bảo châu của một vị Chuyển Luân Thánh Vương, mùi hương của gỗ đàn hương tỏa ra, và từ miệng thì mùi hương của hoa sen xanh.
Ayaṃ na sabbāsaṃ hoti, āgantukaanulepanādigandhova idha adhippeto.
This is not common to all women; only the adventitious scents of perfume, anointing, and so on, are intended here.
Điều này không phải có ở tất cả phụ nữ; ở đây, ý muốn nói đến mùi hương từ nước hoa, dầu thơm, v.v., được thoa lên cơ thể.
Tiracchānagatā pana hatthiassagoṇādayo tiracchānagatānaṃ sajātiitthīnaṃ utugandhena yojanadviyojanatiyojanacatuyojanampi gacchanti.
But among animals, elephants, horses, cattle, and others will travel one, two, three, or four yojanas due to the estrous scent of females of their own species.
Còn các loài động vật như voi, ngựa, bò, v.v., có thể đi một, hai, ba, hoặc bốn dojana theo mùi hương động dục của con cái cùng loài.
Itthikāye gandho vā hotu itthiyā nivatthanivāsanaanulittālepanapiḷandhamālādigandho vā, sabbopi itthigandhotveva veditabbo.
Whether it be the scent of a woman’s body or the scent of her worn clothes, her anointing, her adornments, her garlands, and so on, all should be understood as female scent (itthigandho).
Dù là mùi hương trên cơ thể phụ nữ, hay mùi hương từ quần áo, trang sức, dầu thơm, vòng hoa, v.v., được phụ nữ mặc, thoa, đeo, tất cả đều nên được hiểu là hương của phụ nữ.
4. Catutthe itthirasoti itthiyā catusamuṭṭhānikaṃ rasāyatanaṃ.
4. In the fourth Sutta, female taste (itthiraso) refers to the taste sense-sphere of a woman, which arises from four causes.
4. Ở phần thứ tư, itthiraso (vị của phụ nữ) là đối tượng vị giác (rasāyatana) phát sinh từ bốn yếu tố của phụ nữ.
Tipiṭakacūḷanāgacūḷābhayattherā pana ‘‘svāyaṃ itthiyā kiṃkārapaṭissāvitādivasena savanaraso ceva paribhogaraso ca, ayaṃ itthiraso’’ti vadanti.
However, the Theras Tipiṭaka Cūḷanāga and Cūḷābhayathera say: "This refers to the taste of hearing (savanaraso) and the taste of enjoyment (paribhogaraso) concerning a woman, for example, when she asks, 'What shall I do?' This is female taste (itthiraso)."
Tuy nhiên, các vị trưởng lão Tipiṭakacūḷanāga và Cūḷābhayatthera nói: “Vị của phụ nữ này là vị nghe được từ những lời nói như ‘Tôi nên làm gì?’, v.v., và vị hưởng thụ, đó là vị của phụ nữ.”
Kiṃ tena?
What is the use of that?
Điều đó có ý nghĩa gì?
Yo panāyaṃ itthiyā oṭṭhamaṃsasammakkhanakheḷādirasopi, sāmikassa dinnayāgubhattādīnaṃ rasopi, sabbo so itthirasotveva veditabbo.
But all the taste, such as the taste of saliva mixed with the flesh of a woman’s lips, and also the taste of gruel, rice, and so on, given by her to her husband, should all be understood as female taste (itthiraso).
Tuy nhiên, vị của nước bọt, v.v., dính trên môi thịt của phụ nữ, và vị của cháo, cơm, v.v., được vợ dâng cho chồng, tất cả đều nên được hiểu là vị của phụ nữ.
Aneke hi sattā attano mātugāmena yaṃkiñci sahatthā dinnameva madhuranti gahetvā anayabyasanaṃ pattāti.
Indeed, many beings, taking whatever is given by a woman with her own hand as sweet, have met with ruin and misfortune.
Thật vậy, nhiều chúng sinh đã nhận lấy bất cứ thứ gì được người phụ nữ tự tay dâng cho, cho rằng đó là ngọt ngào, và đã rơi vào sự bất hạnh và tai họa.
Iti satthā sattānaṃ āsayānusayavasena rūpādīsu ekekaṃ gahetvā aññaṃ īdisaṃ na passāmīti āha.
Thus, the Teacher, according to the predispositions and underlying tendencies of beings, took each of form and so on, and said, "I do not see any other such (object)."
Như vậy, Đức Đạo Sư đã chọn từng đối tượng trong sắc, v.v., tùy theo khuynh hướng và tiềm ẩn của chúng sinh, và nói rằng Ngài không thấy đối tượng nào khác tương tự.
Yathā hi rūpagarukassa purisassa itthirūpaṃ cittuppādaṃ gameti palibundhati bajjhāpeti baddhāpeti moheti saṃmoheti, na tathā sesā saddādayo.
For just as the form of a woman gives rise to a thought-occurrence, binds, ties, fetters, bewilders, and utterly bewilders a man who is attached to form, sounds and so on do not do so.
Thật vậy, đối với người nặng về sắc, sắc của phụ nữ làm phát sinh ý nghĩ, trói buộc, giam cầm, khiến bị trói buộc, làm mê muội, làm mê mẩn; các đối tượng khác như tiếng, v.v., không như vậy.
Yathā ca saddādigarukānaṃ saddādayo, na tathā rūpādīni ārammaṇāni.
And just as sounds and so on affect those who are attached to sounds and so on, forms and so on do not affect them.
Và đối với những người nặng về tiếng, v.v., tiếng, v.v., là như vậy, nhưng các đối tượng như sắc, v.v., thì không.
Ekaccassa ca rūpādīsu ekamevārammaṇaṃ cittaṃ pariyādiyati, ekaccassa dvepi tīṇipi cattāripi pañcapi.
For some, only one of the objects—form and so on—completely captivates the mind; for others, two, three, four, or five objects do.
Và đối với một số người, chỉ một đối tượng trong sắc, v.v., chi phối tâm trí; đối với một số người, hai, ba, bốn, hoặc cả năm đối tượng.
Iti ime pañca suttantā pañcagarukavasena kathitā, na pañcagarukajātakavasena.
Therefore, these five Suttas were taught based on the five types of strong attachment (pañcagaruka), not based on the Pañcagaruka Jātaka.
Như vậy, năm bài kinh này được thuyết giảng theo khuynh hướng năm đối tượng nặng, không phải theo câu chuyện Jātaka về năm đối tượng nặng.
Pañcagarukajātakaṃ pana sakkhibhāvatthāya āharitvā kathetabbaṃ.
However, the Pañcagaruka Jātaka should be recounted as corroborating evidence.
Tuy nhiên, Pañcagarukajātaka (Câu chuyện Jātaka về năm đối tượng nặng) nên được kể ra để làm chứng.
Tatra hi amanussehi kantāramajjhe katāya āpaṇādivicāraṇāya mahāpurisassa pañcasu sahāyesu rūpagaruko rūpārammaṇe bajjhitvā anayabyasanaṃ patto, saddādigarukā saddārammaṇādīsu.
In that Jātaka, among the five companions of the Great Being, during an investigation of a market and so on, created by non-humans in the middle of a wilderness, the one attached to form became entangled in the object of form and met with ruin and misfortune, and those attached to sound and so on became entangled in the objects of sound and so on.
Trong câu chuyện đó, khi những phi nhân đã sắp đặt một khu chợ, v.v., giữa sa mạc, trong số năm người bạn của Đại Nhân (Bồ Tát), người nặng về sắc đã bị trói buộc bởi đối tượng sắc và rơi vào sự bất hạnh và tai họa; những người nặng về tiếng, v.v., thì bị trói buộc bởi đối tượng tiếng, v.v.
Iti taṃ sakkhibhāvatthāya āharitvā kathetabbaṃ.
Therefore, that Jātaka should be recounted as corroborating evidence.
Như vậy, câu chuyện đó nên được kể ra để làm chứng.
Ime pana pañca suttantā pañcagarukavaseneva kathitā.
But these five Suttas were taught based on the five types of strong attachment (pañcagaruka) alone.
Còn năm bài kinh này được thuyết giảng theo khuynh hướng năm đối tượng nặng.
7. Dutiyasutte bārāṇasiyaṃ rūpūpajīvino mātugāmassa vatthu veditabbaṃ.
7. In the second sutta, the story of the courtesan living in Bārāṇasī should be understood.
7. Trong Tụng thứ hai, câu chuyện về người phụ nữ hành nghề mại dâm ở Bārāṇasī nên được hiểu.
Guttilavīṇāvādako kirekissā itthiyā sahassaṃ pahiṇi, sā taṃ uppaṇḍetvā gaṇhituṃ na icchi.
It is said that Guttila the lute-player sent a thousand* to a certain woman, but she scorned it and did not wish to accept it.
Người chơi đàn Guttila đã gửi một ngàn đồng cho một người phụ nữ, nhưng cô ấy không muốn nhận nó một cách chế nhạo.
So ‘‘karissāmettha kattabba’’nti sāyanhakālasamanantare alaṅkatapaṭiyatto tassā gehassa abhimukhaṭṭhāne aññasmiṃ gehadvāre nisinno vīṇāya tantiyo same guṇe patiṭṭhāpetvā tantissarena gītassaraṃ anatikkamanto gāyi.
So, thinking, “I will do what needs to be done here,” immediately after the evening, adorned and prepared, he sat at the doorway of another house facing her house, tuned the strings of his lute to the proper pitch, and sang, not letting the sound of his singing exceed the sound of the lute strings.
Ông ấy nghĩ: “Ta sẽ làm điều cần làm ở đây,” rồi vào buổi tối, sau khi trang điểm và chuẩn bị xong, ông ngồi ở cửa một ngôi nhà khác đối diện nhà cô ấy, đặt dây đàn vīnā vào đúng nốt, và hát, không vượt quá âm điệu của dây đàn.
Sā itthī tassa gītasaddaṃ sutvā dvāranti saññāya ‘‘vivaṭavātapānena tassa santikaṃ gamissāmī’’ti ākāseyeva jīvitakkhayaṃ pattā.
That woman, hearing his singing, mistook it for a door and, with the thought, “I will go to him through the open window,” lost her life right there in the air.
Người phụ nữ đó nghe tiếng hát của ông, lầm tưởng đó là cánh cửa, và nghĩ: “Ta sẽ đi đến chỗ ông ấy qua cửa sổ mở,” rồi nhảy ra và mất mạng ngay trên không trung.
8. Tatiyasutte cakkavattirañño kāyato candanagandho vāyati, mukhato ca uppalagandhoti idaṃ āharitabbaṃ.
8. In the third sutta, the statement that the body of the Cakkavatti king emitted the fragrance of sandalwood, and his mouth emitted the fragrance of a water-lily, should be brought forth.
8. Trong Tụng thứ ba, câu chuyện về mùi gỗ đàn hương tỏa ra từ thân thể của vị Chuyển Luân Vương và mùi hoa sen xanh tỏa ra từ miệng của ngài nên được kể.
Idaṃ cettha vatthu veditabbaṃ.
This is the story that should be understood here.
Đây là câu chuyện nên được hiểu ở đây.
Sāvatthiyaṃ kirekissā kuṭumbikadhītāya sāmiko satthu dhammadesanaṃ sutvā, ‘‘na sakkā mayā ayaṃ dhammo gihibhūtena pūretu’’nti aññatarassa piṇḍapātikattherassa santike pabbaji.
It is said that in Sāvatthī, the husband of a certain householder's daughter heard the Teacher's Dhamma discourse and, thinking, “It is impossible for me to fulfill this Dhamma while living as a householder,” he went forth into homelessness under a certain Pindapāta Thera.
Ở Sāvatthī, chồng của một người con gái gia chủ đã nghe bài thuyết Pháp của Đức Phật, và nghĩ: “Ta không thể hoàn thành Pháp này khi còn là một cư sĩ,” rồi xuất gia với một vị trưởng lão khất thực.
Athassa bhariyaṃ ‘‘assāmikā aya’’nti ñatvā rājā pasenadikosalo antepuraṃ āharāpetvā ekadivasaṃ ekaṃ nīluppalakalāpaṃ ādāya antepuraṃ paviṭṭho ekekissā ekekaṃ nīluppalaṃ dāpesi.
Then, King Pasenadi of Kosala, knowing his wife to be "without a master," had her brought to the royal palace, and one day, taking a bunch of blue water-lilies, he entered the palace and had one blue water-lily given to each woman.
Sau đó, vua Pasenadi Kosala, biết rằng vợ của người đó “không có chồng,” đã cho đưa cô ấy vào hậu cung, và một ngày nọ, vua mang một bó hoa sen xanh vào hậu cung và cho mỗi người một bông sen xanh.
Pupphesu bhājiyamānesu tassā itthiyā dve hatthaṃ pattāni.
As the flowers were being distributed, two fell into her hands.
Khi hoa được chia, hai bông đã đến tay người phụ nữ đó.
Sā pahaṭṭhākāraṃ dassetvā upasiṅghitvā parodi.
She showed delight, then sniffed them, and wept.
Cô ấy thể hiện vẻ vui mừng, sau đó ngửi và khóc.
Rājā tassā ubhayākāraṃ disvā taṃ pakkosāpetvā pucchi.
The king, seeing her twofold demeanor, summoned her and questioned her.
Vua nhìn thấy cả hai biểu hiện của cô ấy, liền cho gọi cô ấy đến và hỏi.
Sā attano pahaṭṭhakāraṇañca rodanakāraṇañca kathesi.
She explained the reason for her delight and the reason for her weeping.
Cô ấy kể cả nguyên nhân vui mừng và nguyên nhân khóc của mình.
Yāvatatiyaṃ kathitepi rājā assaddahanto punadivase sakalarājanivesane sabbamālāvilepanādisugandhagandhaṃ harāpetvā buddhappamukhassa bhikkhusaṅghassa āsanāni paññāpetvā buddhappamukhassa bhikkhusaṅghassa mahādānaṃ datvā bhattakiccapariyosāne taṃ itthiṃ ‘‘kataro te thero’’ti pucchitvā, ‘‘aya’’nti vutte ñatvā satthāraṃ vanditvā, ‘‘bhante, tumhehi saddhiṃ bhikkhusaṅgho gacchatu, amhākaṃ asukatthero anumodanaṃ karissatī’’ti āha.
Even after she explained it thrice, the king, still disbelieving, had all fragrant perfumes, such as garlands and unguents, removed from the entire royal palace the next day, arranged seats for the Sangha led by the Buddha, offered a great alms-giving to the Sangha led by the Buddha, and at the end of the meal, he asked the woman, "Which is your Thera?" When she replied, "This one," he understood, paid homage to the Teacher, and said, "Bhante, may the Sangha accompany you; our Venerable Thera will perform the anumodanā."
Ngay cả khi cô ấy đã kể đến ba lần, vua vẫn không tin, nên vào ngày hôm sau, vua cho dọn sạch tất cả các loại hương thơm từ hoa và thuốc thoa trong toàn bộ cung điện, sắp đặt chỗ ngồi cho Tăng đoàn do Đức Phật đứng đầu, cúng dường đại thí cho Tăng đoàn do Đức Phật đứng đầu, và sau khi dùng bữa xong, vua hỏi người phụ nữ đó: “Vị trưởng lão của con là ai?” Khi cô ấy đáp: “Là vị này,” vua liền biết, đảnh lễ Đức Đạo Sư và nói: “Bạch Thế Tôn, xin Tăng đoàn hãy đi cùng Ngài, vị trưởng lão của chúng con sẽ tùy hỷ.”
Satthā taṃ bhikkhuṃ ṭhapetvā vihāraṃ gato.
The Teacher, leaving that bhikkhu behind, went to the monastery.
Đức Đạo Sư đã để lại vị Tỳ-khưu đó và đi về Tịnh xá.
There anumodanaṃ vattuṃ āraddhamatte sakalaṃ rājanivesanaṃ gandhapūraṃ viya jātaṃ.
As soon as the Thera began to deliver the anumodanā, the entire royal palace became as if filled with fragrance.
Ngay khi vị trưởng lão bắt đầu tùy hỷ, toàn bộ cung điện trở nên tràn ngập hương thơm.
Rājā ‘‘saccamevesā āhā’’ti pasīditvā punadivase satthāraṃ taṃ kāraṇaṃ pucchi.
The king, believing, "She spoke the truth," respectfully asked the Teacher the reason the next day.
Vua tin rằng: “Cô ấy nói đúng,” và vào ngày hôm sau, vua hỏi Đức Đạo Sư về nguyên nhân đó.
Satthā ‘‘ayaṃ atīte dhammakathaṃ suṇanto ‘sādhu sādhū’ti sādhukāraṃ pavattento sakkaccaṃ assosi, tammūlako tena mahārāja ayamānisaṃso laddho’’ti ācikkhi.
The Teacher explained, "In the past, this one, while listening to a Dhamma discourse, uttered 'Sādhu, sādhu' and listened attentively, so due to that, great king, this benefit has been obtained by him."
Đức Đạo Sư đã giải thích: “Đại vương, trong quá khứ, vị này đã nghe Pháp thoại và hoan hỷ nói ‘Lành thay! Lành thay!’ và đã lắng nghe một cách cung kính; chính nhờ căn nguyên đó mà vị ấy đã đạt được lợi ích này.”
11. Dutiyassa paṭhame ekadhammampīti ettha ‘‘tasmiṃ kho pana samaye dhammā hontī’’tiādīsu (dha. sa. 121) viya nissattaṭṭhena dhammo veditabbo.
11. In the first sutta of the second vagga, ekadhammampīti; here, Dhamma should be understood in the sense of being without a self (nissattaṭṭhena), as in “at that time there are dhammas” and so on.
11. Trong câu đầu tiên của phẩm thứ hai, ekadhammampi (một pháp cũng) – ở đây, pháp nên được hiểu theo nghĩa vô ngã, như trong “tasmiṃ kho pana samaye dhammā honti” (vào thời điểm đó, các pháp tồn tại), v.v.
Tasmā ekadhammampīti nissattaṃ ekasabhāvampīti ayamettha attho.
Therefore, ekadhammampīti means 'even a single phenomenon (nature) that is without a self'; this is the meaning here.
Do đó, nghĩa ở đây của ekadhammampi là “một bản chất vô ngã cũng vậy.”
Anuppannovāti ettha pana ‘‘bhūtānaṃ vā sattānaṃ ṭhitiyā sambhavesīnaṃ vā anuggahāya (ma. ni. 1.402; saṃ. ni. 2.11) yāvatā, bhikkhave, sattā apadā vā dvipadā vā’’ti (a. ni. 4.34; itivu. 90) evamādīsu viya samuccayattho vāsaddo daṭṭhabbo, na vikappattho.
In anuppannovā, the particle vā should be understood in the sense of conjunction (samuccayattho), not option (vikappattho), as in "for the stability of beings that have come to be, or for the support of those seeking rebirth, bhikkhus, whatever beings there are, footless or two-footed," and so on.
Tuy nhiên, trong anuppannovā (hoặc chưa sinh khởi), từ vā nên được hiểu theo nghĩa tập hợp (samuccayattho), không phải nghĩa lựa chọn (vikappattho), như trong “bhūtānaṃ vā sattānaṃ ṭhitiyā sambhavesīnaṃ vā anuggahāya yāvatā, bhikkhave, sattā apadā vā dvipadā vā” (này các Tỳ-khưu, để duy trì những chúng sinh đã sinh hoặc để hỗ trợ những chúng sinh đang tìm kiếm sự tái sinh, cho dù đó là những chúng sinh không chân hay hai chân), v.v.
Ayañhettha attho – yena dhammena anuppanno ca kāmacchando uppajjati, uppanno ca kāmacchando bhiyyobhāvāya vepullāya saṃvattati, tamahaṃ yathā subhanimittaṃ, evaṃ aññaṃ na passāmīti.
And this is the meaning here: "I do not see any other single thing which, when not arisen, causes sensual desire to arise, or when arisen, causes it to increase and expand, as in the case of a beautiful object (subhanimitta)."
Nghĩa ở đây là: “Ta không thấy bất kỳ pháp nào khác, như một tướng tốt, mà nhờ đó dục tham chưa sinh khởi sẽ sinh khởi, và dục tham đã sinh khởi sẽ tăng trưởng và phát triển.”
Tattha anuppannoti ajāto asañjāto apātubhūto asamudāgato.
Here, anuppanno means not arisen, not properly arisen, not appeared, not come to be.
Ở đó, anuppanno nghĩa là chưa sinh, chưa phát sinh, chưa xuất hiện, chưa khởi lên.
Kāmacchandoti ‘‘yo kāmesu kāmacchando kāmarāgo kāmanandī kāmataṇhā’’tiādinā (dha. sa. 1156) nayena vitthāritaṃ kāmacchandanīvaraṇaṃ.
Kāmacchando means the hindrance of sensual desire, elaborated in the manner of "whatever sensual desire, sensual lust, sensual delight, sensual craving there is for sensual pleasures."
Kāmacchando là triền cái dục tham đã được giải thích chi tiết theo cách như “dục tham, dục ái, dục hỷ, dục ái dục tham đối với các dục” v.v.
Uppajjatīti nibbattati pātubhavati.
Uppajjatī means it comes into being, it appears.
Uppajjatī nghĩa là sinh khởi, xuất hiện.
So panesa asamudācāravasena vā ananubhūtārammaṇavasena vā anuppanno uppajjatīti veditabbo.
It should be understood that this unarisen sensual desire arises either due to not being actively manifest or due to not having experienced the object before.
Tuy nhiên, nó nên được hiểu rằng dục tham chưa sinh khởi sẽ sinh khởi theo cách không hành động hoặc theo cách chưa trải nghiệm đối tượng.
Aññathā hi anamatagge saṃsāre anuppanno nāma natthi.
Otherwise, in this beginningless Saṃsāra, there is no such thing as "not arisen."
Nếu không, trong vòng luân hồi vô thủy, không có gì gọi là chưa sinh khởi.
Tattha ekaccassa vattavasena kileso na samudācarati, ekaccassa ganthadhutaṅgasamādhi- vipassanānavakammādīnaṃ aññataravasena.
Here, in some individuals, defilement does not manifest due to adherence to duties, and in others, due to one of the following: textual study, ascetic practices (dhutaṅga), concentration (samādhi), insight (vipassanā), or new constructions (navakamma).
Ở đó, đối với một số người, phiền não không khởi lên do sự thực hành các bổn phận (vatta), đối với một số người khác, do sự thực hành một trong các pháp như học kinh điển (gantha), khổ hạnh đầu đà (dhutaṅga), định (samādhi), tuệ quán (vipassanā), hoặc công việc mới (navakamma).
Kathaṃ?
How is this?
Như thế nào?
Ekacco hi vattasampanno hoti, tassa dveasīti khuddakavattāni cuddasa mahāvattāni cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattāni ca karontasseva kileso okāsaṃ na labhati.
Indeed, some are endowed with duties, and while performing the eighty-two minor duties and the fourteen major duties, as well as the duties concerning the cetiyaṅgaṇa, bodhiyaṅgaṇa, pāniyamāḷaka, uposathāgāra, and for arriving and departing bhikkhus, defilement finds no opportunity.
Một số người hoàn thiện trong các bổn phận; khi họ thực hành 82 tiểu bổn phận, 14 đại bổn phận, và các bổn phận liên quan đến sân thờ, cây bồ đề, nhà uống nước, nhà Uposatha, khách tăng và hành tăng, phiền não không có cơ hội khởi lên.
Aparabhāge panassa vattaṃ vissajjetvā bhinnavattassa carato ayonisomanasikārañceva sativossaggañca āgamma uppajjati.
But later, when they abandon their duties and live with broken vows, defilement arises due to unwise attention and neglect of mindfulness.
Tuy nhiên, sau đó, khi họ từ bỏ các bổn phận và sống với các bổn phận bị phá vỡ, phiền não khởi lên do sự tác ý không đúng đắn (ayoniso manasikāra) và sự xao lãng chánh niệm (sativossagga).
Evampi asamudācāravasena anuppanno uppajjati nāma.
Thus, too, unarisen defilement is said to arise due to not being actively manifest.
Như vậy, dục tham chưa sinh khởi cũng được gọi là sinh khởi theo cách không hành động.
Ekacco ganthayutto hoti, ekampi nikāyaṃ gaṇhāti dvepi tayopi cattāropi pañcapi.
Some are engaged in textual study; they learn one Nikāya, or two, or three, or four, or five.
Một số người thì chuyên tâm vào kinh điển, học một Nikāya, hoặc hai, ba, bốn, hoặc năm Nikāya.
Tassa tepiṭakaṃ buddhavacanaṃ atthavasena pāḷivasena anusandhivasena pubbāparavasena gaṇhantassa sajjhāyantassa vācentassa desentassa pakāsentassa kileso okāsaṃ na labhati.
While such a person is learning, reciting, expounding, teaching, or explaining the Tipiṭaka Buddha-word in terms of its meaning, Pāli, sequence, or prior and subsequent connections, defilement finds no opportunity.
Khi họ học, đọc, giảng, thuyết, và trình bày lời dạy của Đức Phật trong Tam Tạng theo nghĩa lý, văn bản, sự liên kết, và trình tự trước sau, phiền não không có cơ hội khởi lên.
Aparabhāge panassa ganthakammaṃ pahāya kusītassa carato ayonisomanasikārasativossagge āgamma uppajjati.
But later, when they abandon textual work and live lazily, defilement arises due to unwise attention and neglect of mindfulness.
Tuy nhiên, sau đó, khi họ từ bỏ công việc kinh điển và sống một cách lười biếng, phiền não khởi lên do sự tác ý không đúng đắn và sự xao lãng chánh niệm.
Evampi asamudācāravasena anuppanno uppajjati nāma.
Thus, too, unarisen defilement is said to arise due to not being actively manifest.
Như vậy, dục tham chưa sinh khởi cũng được gọi là sinh khởi theo cách không hành động.
Ekacco pana dhutaṅgadharo hoti, terasa dhutaṅgaguṇe samādāya vattati.
However, some are observers of dhutaṅgas; they undertake and practice the thirteen dhutaṅga qualities.
Một số người khác thì thực hành khổ hạnh đầu đà, giữ mười ba hạnh đầu đà.
Tassa pana dhutaṅgaguṇe pariharantassa kileso okāsaṃ na labhati.
While such a person upholds the dhutaṅga qualities, defilement finds no opportunity.
Khi họ thực hành các hạnh đầu đà, phiền não không có cơ hội khởi lên.
Aparabhāge panassa dhutaṅgāni vissajjetvā bāhullāya āvattassa carato ayonisomanasikārasativossagge āgamma uppajjati.
But later, when they abandon the dhutaṅgas and live engaged in excessive activity, defilement arises due to unwise attention and neglect of mindfulness.
Tuy nhiên, sau đó, khi họ từ bỏ các hạnh đầu đà và sống một cách phóng túng, phiền não khởi lên do sự tác ý không đúng đắn và sự xao lãng chánh niệm.
Evampi asamudācāravasena anuppanno uppajjati nāma.
Thus, too, unarisen defilement is said to arise due to not being actively manifest.
Như vậy, dục tham chưa sinh khởi cũng được gọi là sinh khởi theo cách không hành động.
Ekacco pana vipassako hoti, sattasu vā anupassanāsu aṭṭhārasasu vā mahāvipassanāsu kammaṃ karonto viharati.
Some, however, are practitioners of insight, dwelling while engaging in practice concerning the seven contemplations or the eighteen great insights.
Một số người khác thì là hành giả tuệ quán, sống thực hành một trong bảy phép quán hoặc mười tám đại tuệ quán.
Tassevaṃ viharato kileso okāsaṃ na labhati.
As he dwells thus, defilement finds no opportunity.
Khi vị ấy an trú như vậy, phiền não không tìm được cơ hội.
Aparabhāge panassa vipassanākammaṃ pahāya kāyadaḷhībahulassa viharato ayonisomanasikārasativossagge āgamma uppajjati.
Later, however, for him, having abandoned vipassanā practice and dwelling as one much given to bodily comfort, defilement arises due to unwise attention and neglect of mindfulness.
Tuy nhiên, về sau, khi vị ấy từ bỏ công việc tu tập thiền quán (vipassanākammaṃ), an trú với thân thể cường tráng, thì do sự tác ý không như lý (ayoniso manasikāra) và sự xao nhãng chánh niệm (sativossagge) mà phiền não khởi lên.
Evampi asamudācāravasena anuppanno uppajjati nāma.
Even so, that which has not arisen, arises in the sense of not having come to fruition.
Như vậy, phiền não chưa từng khởi lên lại khởi lên do không được tu tập.
Ekacco navakammiko hoti, uposathāgārabhojanasālādīni kāreti.
Some person is a new worker, constructing assembly halls, refectories, and so on.
Một số người làm công việc xây dựng, xây cất các tịnh xá, nhà ăn, v.v.
Tassa tesaṃ upakaraṇāni cintentassa kileso okāsaṃ na labhati.
As he contemplates these requisites, defilement finds no opportunity.
Khi vị ấy suy tư về những vật dụng đó, phiền não không tìm được cơ hội.
Aparabhāge panassa navakamme niṭṭhite vā vissaṭṭhe vā ayonisomanasikārasativossagge āgamma uppajjati.
Later, however, for him, when the new work is finished or abandoned, defilement arises due to unwise attention and neglect of mindfulness.
Tuy nhiên, về sau, khi công việc xây dựng hoàn tất hoặc bị từ bỏ, thì do sự tác ý không như lý (ayoniso manasikāra) và sự xao nhãng chánh niệm (sativossagge) mà phiền não khởi lên.
Evampi asamudācāravasena anuppanno uppajjati nāma.
Even so, that which has not arisen, arises in the sense of not having come to fruition.
Như vậy, phiền não chưa từng khởi lên lại khởi lên do không được tu tập.
Ekacco pana brahmalokā āgato suddhasatto hoti, tassa anāsevanatāya kileso okāsaṃ na labhati.
Another, however, is a pure being who has come from the Brahmā world; for him, defilement finds no opportunity due to non-indulgence.
Một số người là chúng sanh thanh tịnh từ cõi Phạm thiên tái sinh, phiền não không tìm được cơ hội do chưa từng thọ hưởng.
Aparabhāge panassa laddhāsevanassa ayonisomanasikārasativossagge āgamma uppajjati.
Later, however, for him, defilement arises due to unwise attention and neglect of mindfulness, after indulgence has been acquired.
Tuy nhiên, về sau, khi vị ấy được thọ hưởng, thì do sự tác ý không như lý (ayoniso manasikāra) và sự xao nhãng chánh niệm (sativossagge) mà phiền não khởi lên.
Evampi asamudācāravasena anuppanno uppajjati nāma.
Even so, that which has not arisen, arises in the sense of not having come to fruition.
Như vậy, phiền não chưa từng khởi lên lại khởi lên do không được tu tập.
Evaṃ tāva asamudācāravasena anuppannassa uppannatā veditabbā.
Thus, the arising of what has not arisen, in the sense of not having come to fruition, should be understood first.
Trước hết, sự khởi lên của phiền não chưa từng khởi lên do không được tu tập nên được hiểu như vậy.
Uppannoti jāto sañjāto nibbatto abhinibbatto pātubhūto.
Arisen means generated, well-generated, produced, specifically produced, manifested.
Khởi lên (Uppanno) nghĩa là đã sinh, đã phát sinh, đã xuất hiện, đã hiện hữu.
Bhiyyobhāvāyāti punappunabhāvāya.
For its increase means for its repeated occurrence.
Để tăng trưởng (Bhiyyobhāvāya) nghĩa là để khởi lên lặp đi lặp lại.
Vepullāyāti vipulabhāvāya rāsibhāvāya.
For its growth means for its extensive occurrence, for its accumulation.
Để trở nên lớn mạnh (Vepullāyā) nghĩa là để trở nên rộng lớn, để trở thành một khối.
Tattha sakiṃ uppanno kāmacchando na nirujjhissati, sakiṃ niruddho vā sveva puna uppajjissatīti aṭṭhānametaṃ.
In this context, it is not possible that a sensual desire, once arisen, will not cease, or that one that has ceased will arise again as the same one.
Trong trường hợp này, tham dục (kāmacchando) đã khởi lên một lần sẽ không diệt đi, hoặc đã diệt đi một lần sẽ không khởi lên lại nữa – điều này là không thể.
Ekasmiṃ pana niruddhe tasmiṃ vā ārammaṇe aññasmiṃ vā ārammaṇe aparāparaṃ uppajjamāno bhiyyobhāvāya vepullāya saṃvattati nāma.
But when one ceases, another arises again and again with the same or a different object, which indeed leads to its increase and growth.
Tuy nhiên, khi một tham dục diệt đi, một tham dục khác liên tiếp khởi lên trên cùng đối tượng đó hoặc trên một đối tượng khác, thì được gọi là tăng trưởng và trở nên lớn mạnh.
Subhanimittanti rāgaṭṭhāniyaṃ ārammaṇaṃ.
A beautiful object refers to an object that is a cause for lust.
Tướng đáng ưa thích (Subhanimittaṃ) là đối tượng là căn nguyên của tham ái (rāgaṭṭhāniyaṃ ārammaṇaṃ).
‘‘Sanimittā, bhikkhave, uppajjanti pāpakā akusalā dhammā, no animittā’’ti ettha nimittanti paccayassa nāmaṃ.
Here, in “Monks, evil unwholesome states arise with a cause, not without a cause,” “cause” is a name for a condition.
Trong câu “Này các tỳ khưu, các pháp bất thiện, ác pháp khởi lên cùng với tướng (nimitta), không phải không có tướng”, ở đây, tướng (nimitta) là tên của nhân duyên.
‘‘Adhicittamanuyuttena, bhikkhave, bhikkhunā pañca nimittāni kālena kālaṃ manasikātabbānī’’ti (ma. ni. 1.216) ettha kāraṇassa.
Here, in “Monks, a bhikkhu devoted to higher consciousness should from time to time attend to five causes,” it refers to a reason.
Trong câu “Này các tỳ khưu, một tỳ khưu tinh tấn trong thiền định (adhicitta) cần phải tác ý năm tướng (nimitta) tùy thời”, ở đây, là tên của nguyên nhân.
‘‘So taṃ nimittaṃ āsevati bhāvetī’’ti (a. ni. 9.35) ettha samādhissa.
Here, in “He cultivates and develops that cause,” it refers to concentration.
Trong câu “Vị ấy thọ hưởng, tu tập tướng ấy”, ở đây, là tên của thiền định (samādhi).
‘‘Yaṃ nimittaṃ āgamma yaṃ nimittaṃ manasikaroto anantarā āsavānaṃ khayo hotī’’ti (a. ni. 6.27) ettha vipassanāya.
Here, in “By relying on which cause, by attending to which cause, there is immediately the destruction of the taints,” it refers to vipassanā.
Trong câu “Do nương vào tướng nào, do tác ý tướng nào mà sự diệt tận các lậu hoặc xảy ra ngay lập tức”, ở đây, là tên của tuệ quán (vipassanā).
Idha pana rāgaṭṭhāniyo iṭṭhārammaṇadhammo ‘‘subhanimitta’’nti adhippeto.
But here, a desirable object-state that is a cause for lust is intended by the term “beautiful object.”
Tuy nhiên, ở đây, pháp đối tượng đáng ưa thích là căn nguyên của tham ái (rāgaṭṭhāniyo iṭṭhārammaṇadhammo) được hiểu là “tướng đáng ưa thích” (subhanimitta).
Ayonisomanasikarototi.
To one who attends unwisely.
Do tác ý không như lý (Ayonisomanasikaroto) nghĩa là:
‘‘Tattha katamo ayonisomanasikāro?
“Among these, what is unwise attention?
“Ở đây, thế nào là tác ý không như lý (ayoniso manasikāra)?
Anicce niccanti, dukkhe sukhanti, anattani attāti, asubhe subhanti, ayonisomanasikāro uppathamanasikāro, saccavippaṭikūlena vā cittassa āvajjanā anvāvajjanā ābhogo samannāhāro manasikāro.
Taking the impermanent as permanent, the painful as pleasant, the non-self as self, the unattractive as attractive; unwise attention is deviant attention, or it is the turning, repeatedly turning, attending, grasping, and attention of the mind contrary to the truth.
Là tác ý không như lý, tác ý sai lầm: cho vô thường là thường, cho khổ là lạc, cho vô ngã là ngã, cho bất tịnh là tịnh; hoặc sự hướng tâm, sự hướng tâm lặp đi lặp lại, sự chú ý, sự tập trung, sự tác ý của tâm đối với điều trái ngược với sự thật.
Ayaṃ vuccati ayonisomanasikāro’’ti (vibha. 936) imassa manasikārassa vasena anupāyena manasikarontassāti.
This is called unwise attention” — in the sense of one attending by improper means, by means of this attention.
Đây được gọi là tác ý không như lý (ayoniso manasikāra)”, nghĩa là do cách tác ý này, do tác ý không đúng cách.
12. Dutiye byāpādoti bhattabyāpatti viya cittassa byāpajjanaṃ pakativijahanabhāvo.
12. In the second, ill-will means the corruption of the mind, like the spoilage of food, the state of abandoning its natural condition.
12. Trong phần thứ hai, sân hận (byāpādo) là sự biến đổi của tâm, sự rời bỏ trạng thái tự nhiên, giống như sự biến chất của thức ăn.
‘‘Tattha katamaṃ byāpādanīvaraṇaṃ?
“Among these, what is the hindrance of ill-will?
“Ở đây, thế nào là triền cái sân hận (byāpādanīvaraṇaṃ)?
Anatthaṃ me acarīti āghāto jāyatī’’ti (dha. sa. 1160) evaṃ vitthāritassa byāpādanīvaraṇassetaṃ adhivacanaṃ.
Resentment arises, thinking, ‘He has done me harm’” — this is a designation for the hindrance of ill-will as thus expounded.
Là sự oán giận khởi lên: ‘Người ấy đã làm hại tôi’”, đây là tên gọi của triền cái sân hận được giải thích rộng rãi như vậy.
Paṭighanimittanti aniṭṭhaṃ nimittaṃ.
An object of irritation means an undesirable object.
Tướng chướng ngại (Paṭighanimittaṃ) là tướng không đáng ưa thích.
Paṭighassapi paṭighārammaṇassapi etaṃ adhivacanaṃ.
This is a designation for both irritation and an object that causes irritation.
Đây là tên gọi của cả sự chướng ngại (paṭigha) và đối tượng chướng ngại (paṭighārammaṇa).
Vuttampi cetaṃ aṭṭhakathāyaṃ – ‘‘paṭighampi paṭighanimittaṃ, paṭighārammaṇopi dhammo paṭighanimitta’’nti.
It has also been stated in the Aṭṭhakathā: “Irritation is an object of irritation; a state that is an object causing irritation is also an object of irritation.”
Trong Chú Giải cũng đã nói: “Sự chướng ngại (paṭigha) cũng là tướng chướng ngại (paṭighanimitta), pháp đối tượng chướng ngại (paṭighārammaṇa) cũng là tướng chướng ngại (paṭighanimitta)”.
Sesamettha kāmacchande vuttanayeneva veditabbaṃ.
The remainder here should be understood in the same manner as explained for sensual desire.
Các phần còn lại ở đây nên được hiểu theo cách đã nói về tham dục (kāmacchanda).
Yathā cettha, evaṃ ito paresupi.
As it is here, so it is in the subsequent sections as well.
Như ở đây, thì cũng vậy đối với các phần sau.
Tattha tattha hi visesamattameva vakkhāmāti.
For in those respective places, we shall only explain the specific differences.
Vì ở mỗi chỗ đó, chúng ta sẽ chỉ nói về sự khác biệt mà thôi.
13. Tatiye thinamiddhanti thinañceva middhañca.
13. In the third, sloth and torpor means sloth and torpor.
13. Trong phần thứ ba, hôn trầm và thụy miên (thinamiddhaṃ) là hôn trầm (thina) và thụy miên (middha).
Tesu cittassa akammaññatā thinaṃ, ālasiyabhāvassetaṃ adhivacanaṃ.
Among these, the unsuitability of the mind for work is sloth; this is a designation for the state of laziness.
Trong số đó, sự không khéo léo của tâm là hôn trầm (thinaṃ), đây là tên gọi của trạng thái lười biếng.
Tiṇṇaṃ khandhānaṃ akammaññatā middhaṃ, kapimiddhassa pacalāyikabhāvassetaṃ adhivacanaṃ.
The unsuitability of the three aggregates for work is torpor; this is a designation for the state of drowsiness, like a monkey dozing.
Sự không khéo léo của ba uẩn (danh uẩn) là thụy miên (middhaṃ), đây là tên gọi của trạng thái buồn ngủ như khỉ ngủ gật.
Ubhinnampi ‘‘tattha katamaṃ thinaṃ?
The full explanation for both should be understood from the Vibhaṅga, as in “Among these, what is sloth?
Đối với cả hai, sự giải thích chi tiết nên được hiểu theo cách bắt đầu bằng “Ở đây, thế nào là hôn trầm?
Yā cittassa akalyatā akammaññatā olīyanā sallīyanā.
That unwholesomeness, unsuitability for work, sinking, and shrinking of the mind.
Là sự không khéo léo, sự không thuần thục, sự chùng xuống, sự co rút của tâm.
Tattha katamaṃ middhaṃ?
Among these, what is torpor?
Ở đây, thế nào là thụy miên?
Yā kāyassa akalyatā akammaññatā onāho pariyonāho’’tiādinā (dha. sa. 1162-1163) nayena vitthāro veditabbo.
That unwholesomeness, unsuitability for work, dullness, and overpowering dullness of the body.”
Là sự không khéo léo, sự không thuần thục, sự nặng nề, sự bao trùm của thân”.
Aratītiādīni vibhaṅge vibhattanayeneva veditabbāni.
Discontent, and so on, should be understood in the manner explained in the Vibhaṅga.
Sự không hoan hỷ (arati) và các điều khác nên được hiểu theo cách đã phân tích trong Vibhaṅga.
Vuttañhetaṃ –
For it has been said:
Vì điều này đã được nói:
‘‘Tattha katamā arati?
“Among these, what is discontent?
“Ở đây, thế nào là không hoan hỷ (arati)?
Pantesu vā senāsanesu aññataraññataresu vā adhikusalesu dhammesu arati aratitā anabhirati anabhiramanā ukkaṇṭhitā paritassitā, ayaṃ vuccati arati.
Discontent, the state of discontent, displeasure, not delighting, weariness, and agitation concerning isolated dwellings or any other superior wholesome states — this is called discontent.
Là sự không hoan hỷ, trạng thái không hoan hỷ, sự không vui thích, sự không thích thú, sự chán nản, sự lo lắng đối với những trú xứ xa vắng hoặc đối với bất kỳ pháp thiện cao thượng nào; đây được gọi là không hoan hỷ (arati).
Tattha katamā tandī?
Among these, what is languor?
Ở đây, thế nào là lười biếng (tandī)?
Yā tandī tandiyanā tandimanatā ālassaṃ ālassāyanā ālassāyitattaṃ, ayaṃ vuccati tandī.
That languor, being languid, mental languor, laziness, being lazy, and the state of being made lazy — this is called languor.
Là sự lười biếng, trạng thái lười biếng, sự lười nhác, sự lười nhác, trạng thái bị lười nhác hóa; đây được gọi là lười biếng (tandī).
Tattha katamā vijambhitā?
Among these, what is yawning?
Ở đây, thế nào là ngáp vặt (vijambhitā)?
Yā kāyassa jambhanā vijambhanā ānamanā vinamanā sannamanā paṇamanā byādhiyakaṃ, ayaṃ vuccati vijambhitā.
That yawning, gaping, bending forward, bending backward, bending down, bowing, and bodily affliction — this is called yawning.
Là sự ngáp, sự ngáp vặt, sự cúi xuống, sự uốn cong, sự khom lưng, sự gục đầu của thân, sự bệnh hoạn; đây được gọi là ngáp vặt (vijambhitā).
Tattha katamo bhattasammado?
Among these, what is stupor from food?
Ở đây, thế nào là sự mê mẩn do ăn uống (bhattasammado)?
Yā bhuttāvissa bhattamucchā bhattakilamatho bhattapariḷāho kāyaduṭṭhullaṃ, ayaṃ vuccati bhattasammado.
That mental dullness from food, fatigue from food, feverishness from food, and bodily unsuitability in one who has eaten — this is called stupor from food.
Là sự choáng váng do thức ăn, sự mệt mỏi do thức ăn, sự nóng bức do thức ăn, sự nặng nề của thân sau khi ăn; đây được gọi là sự mê mẩn do ăn uống (bhattasammado).
Tattha katamaṃ cetaso ca līnattaṃ?
Among these, what is mental inertia?
Ở đây, thế nào là sự chùng xuống của tâm (cetaso ca līnattaṃ)?
Yā cittassa akalyatā akammaññatā olīyanā sallīyanā līnaṃ līyanā līyitattaṃ thinaṃ thiyanā thiyitattaṃ cittassa, idaṃ vuccati cetaso ca līnatta’’nti (vibha. 856, 857, 859, 860).
That unwholesomeness, unsuitability for work, sinking, shrinking, being inert, inertia, the state of being inert, sloth, being slothful, and the state of being slothful of the mind — this is called mental inertia.”
Là sự không khéo léo, sự không thuần thục, sự chùng xuống, sự co rút, sự chùng xuống, sự chùng xuống, trạng thái chùng xuống, sự hôn trầm, trạng thái hôn trầm, trạng thái bị hôn trầm hóa của tâm; đây được gọi là sự chùng xuống của tâm (cetaso ca līnattaṃ)”.
14. Catutthe uddhaccakukkuccanti uddhaccañceva kukkuccañca.
14. In the fourth, restlessness and remorse means restlessness and remorse.
14. Trong phần thứ tư, trạo cử và hối hận (uddhaccakukkuccaṃ) là trạo cử (uddhacca) và hối hận (kukkucca).
Tattha uddhaccaṃ nāma cittassa uddhatākāro.
Among these, restlessness is the agitated state of mind.
Trong đó, trạo cử (uddhaccaṃ nāma) là trạng thái xao động của tâm.
Kukkuccaṃ nāma akatakalyāṇassa katapāpassa tappaccayā vippaṭisāro.
Remorse is regret for good deeds not done and evil deeds done, dependent on those.
Hối hận (kukkuccaṃ nāma) là sự hối tiếc do việc thiện chưa làm và việc ác đã làm.
Cetaso avūpasamoti uddhaccakukkuccassevetaṃ nāmaṃ.
Non-pacification of mind is a designation for restlessness and remorse itself.
Sự không an tịnh của tâm (cetaso avūpasamo) là tên gọi của trạo cử và hối hận.
Avūpasantacittassāti jhānena vā vipassanāya vā avūpasamitacittassa.
For one whose mind is unpacified means one whose mind is not pacified by jhāna or by vipassanā.
Tâm không an tịnh (avūpasantacittassā) nghĩa là tâm chưa được an tịnh bằng thiền định (jhāna) hoặc tuệ quán (vipassanā).
Ayaṃ pana avūpasamo uddhaccakukkuccassa upanissayakoṭiyā paccayo hotīti.
This non-pacification, however, is a condition for restlessness and remorse in the sense of decisive support.
Sự không an tịnh này là nhân duyên cho trạo cử và hối hận theo cách y chỉ duyên.
16. Chaṭṭhe anuppanno vā kāmacchando nuppajjatīti asamudācāravasena vā ananubhūtārammaṇavasena vāti dvīheva kāraṇehi anuppanno na uppajjati, tathā vikkhambhitova hoti, puna hetuṃ vā paccayaṃ vā na labhati.
16. In the sixth, an unarisen sensual desire does not arise means that what has not arisen, does not arise due to these two reasons: either not having come to fruition or not having enjoyed the object. Thus it remains suppressed, and does not obtain a cause or condition again.
16. Trong phần thứ sáu, tham dục chưa khởi lên thì không khởi lên (anuppanno vā kāmacchando nuppajjati) nghĩa là tham dục chưa khởi lên do hai nguyên nhân: không được tu tập hoặc chưa từng kinh nghiệm đối tượng, thì sẽ không khởi lên. Nó vẫn bị trấn áp như vậy, không nhận được nhân duyên nào nữa.
Idhāpi vattādīnaṃyeva vasena asamudācāro veditabbo.
Here too, the non-arising* should be understood solely through the performance of duties and the like.
Ở đây cũng vậy, cần phải hiểu sự không phát sinh bằng cách thực hành các bổn phận (vatta) và những điều tương tự.
Ekaccassa hi vuttanayeneva vatte yuttassa vattaṃ karontasseva kileso okāsaṃ na labhati, vattavasena vikkhambhito hoti.
Indeed, for some, who are engaged in the practice of duties in the manner described, defilement finds no opportunity to arise while they are performing their duties; it is suppressed by the power of their duties.
Thật vậy, đối với một số người, khi họ đã gắn bó với các bổn phận theo cách đã nói và đang thực hành các bổn phận, phiền não không có cơ hội phát sinh; chúng bị đẩy lùi bởi sự thực hành bổn phận.
So taṃ tathāvikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti milakkhatissatthero viya.
Having thus suppressed it, he turns it around and attains arahantship, like Venerable Milakkhatissa.
Người ấy, sau khi đã đẩy lùi phiền não như vậy, xoay chuyển nó và đạt được A-la-hán quả, giống như Trưởng lão Milakkhatissa.
So kirāyasmā rohaṇajanapade gāmeṇḍavālamahāvihārassa bhikkhācāre nesādakule nibbatto.
It is said that this Venerable One was born into a hunter family in a village within the Rohaṇa region, near the Gaṃeṇḍavāla Great Monastery, where he went for alms.
Nghe nói, vị Đại đức ấy sinh ra trong một gia đình thợ săn ở một ngôi làng thuộc vùng Rohaṇa, nơi các Tỳ-khưu của Đại Tự viện Gāmeṇḍavāla thường đi khất thực.
Vayaṃ āgamma katagharāvāso ‘‘puttadāraṃ posessāmī’’ti adūhalasataṃ saṇṭhapetvā pāsasataṃ yojetvā sūlasataṃ ropetvā bahuṃ pāpaṃ āyūhanto ekadivasaṃ gehato aggiñca loṇañca gahetvā araññaṃ gato.
Having reached the age for marriage, he became a householder and, resolving, “I will support my wife and children,” he set up a hundred pitfalls, arranged a hundred snares, and planted a hundred stakes. One day, after accumulating much demerit, he took fire and salt from his home and went into the forest.
Đến tuổi trưởng thành, Ngài lập gia đình, nghĩ rằng: “Ta sẽ nuôi vợ con,” rồi đặt một trăm cái bẫy, giăng một trăm cái lưới, dựng một trăm cái cọc nhọn, tích lũy nhiều ác nghiệp. Một ngày nọ, Ngài mang lửa và muối từ nhà vào rừng.
Pāse baddhamigaṃ vadhitvā aṅgārapakkamaṃsaṃ khāditvā pipāsito hutvā gāmeṇḍavālamahāvihāraṃ paviṭṭho pānīyamāḷake dasamattesu pānīyaghaṭesu pipāsāvinodanamattampi pānīyaṃ alabhanto, ‘‘kiṃ nāmetaṃ ettakānaṃ bhikkhūnaṃ vasanaṭṭhāne pipāsāya āgatānaṃ pipāsāvinodanamattaṃ pānīyaṃ natthī’’ti ujjhāyituṃ āraddho.
After killing an animal caught in a snare and eating its charcoal-roasted meat, he became thirsty and entered the Gaṃeṇḍavāla Great Monastery. In the water pavilion, among about ten water pots, he found not even enough water to quench his thirst. He began to complain, “What is this? In a dwelling place for so many bhikkhus, there is not even enough water to quench the thirst of those who come here thirsty?”
Sau khi giết con nai bị mắc bẫy, ăn thịt nướng trên than hồng, rồi khát nước, Ngài đi vào Đại Tự viện Gāmeṇḍavāla. Tại nhà nước uống, Ngài không tìm thấy dù chỉ một chút nước để giải khát trong mười bình nước. Ngài bắt đầu càu nhàu: “Tại sao ở nơi cư trú của chừng ấy Tỳ-khưu lại không có đủ nước để giải khát cho những người khát nước đến đây như thế này?”
Cūḷapiṇḍapātikatissatthero tassa kathaṃ sutvā tassa santikaṃ gacchanto pānīyamāḷake dasamatte pānīyaghaṭe pūre disvā ‘‘jīvamānapetakasatto ayaṃ bhavissatī’’ti cintetvā, ‘‘upāsaka, sace pipāsitosi, piva pānīya’’nti vatvā kuṭaṃ ukkhipitvā tassa hatthesu āsiñci.
Venerable Cūḷapiṇḍapātikatissa, hearing his words, approached him. Seeing the ten or so water pots in the water pavilion full, he thought, “This being must be a living ghost.” He said, “Lay follower, if you are thirsty, drink water,” and lifting a water pot, poured water into his hands.
Trưởng lão Cūḷapiṇḍapātikatissa nghe lời Ngài nói, đi đến chỗ Ngài. Thấy mười bình nước trong nhà nước uống đều đầy, Ngài nghĩ: “Người này chắc là một chúng sinh ngạ quỷ còn sống.” Rồi Ngài nói: “Này cư sĩ, nếu ông khát, hãy uống nước,” và nhấc bình nước lên, đổ vào tay Ngài.
Tassa kammaṃ paṭicca pītapītaṃ pānīyaṃ tattakapāle pakkhittamiva nassati, sakalepi ghaṭe pivato pipāsā na pacchijji.
Because of his karma, the water he drank vanished as if poured onto a hot pan, and even after drinking from the entire pot, his thirst was not quenched.
Do nghiệp của Ngài, nước vừa uống vào liền biến mất như thể đổ vào một cái chảo nóng, và dù uống hết cả bình, cơn khát của Ngài vẫn không dứt.
Atha naṃ thero āha – ‘‘yāva dāruṇañca te, upāsaka, kammaṃ kataṃ, idāneva peto jāto, vipāko kīdiso bhavissatī’’ti?
Then the Elder said to him, “Lay follower, what a terrible deed you have done! You have become a ghost in this very life. What will the result be?”
Bấy giờ, vị Trưởng lão nói với Ngài: “Này cư sĩ, nghiệp của ông đã tạo ra thật là tàn khốc! Ngay bây giờ ông đã trở thành ngạ quỷ, quả báo sẽ như thế nào đây?”
So tassa kathaṃ sutvā laddhasaṃvego theraṃ vanditvā tāni adūhalādīni visaṅkharitvā vegena gharaṃ gantvā puttadāraṃ oloketvā satthāni bhinditvā dīpakamigapakkhino araññe vissajjetvā theraṃ paccupasaṅkamitvā pabbajjaṃ yāci.
Hearing his words, deeply moved, he paid homage to the Elder, dismantled the pitfalls and other devices, quickly went home, looked at his wife and children, destroyed his weapons, released the deer and birds in the forest, and then approached the Elder again to request ordination.
Nghe lời Ngài nói, Ngài sinh lòng sợ hãi, đảnh lễ vị Trưởng lão, phá hủy những cái bẫy và những thứ tương tự, nhanh chóng về nhà, nhìn vợ con, đập vỡ vũ khí, thả các loài chim và thú rừng vào rừng, rồi trở lại gặp vị Trưởng lão và xin xuất gia.
Dukkarā, āvuso, pabbajjā, kathaṃ tvaṃ pabbajissasīti?
“Friend, ordination is difficult. How will you ordain?”
“Này hiền giả, việc xuất gia thật khó khăn, làm sao ông có thể xuất gia được?”
Bhante, evarūpaṃ paccakkhakāraṇaṃ disvā kathaṃ na pabbajissāmīti?
“Venerable Sir, having seen such a visible consequence, how could I not ordain?”
“Bạch Ngài, sau khi thấy một sự việc rõ ràng như thế này, làm sao con lại không xuất gia được?”
Thero tacapañcakakammaṭṭhānaṃ datvā pabbājesi.
The Elder gave him the tacapañcaka kammaṭṭhāna (meditation on the fivefold skin as the primary object) and ordained him.
Vị Trưởng lão ban cho Ngài đề mục thiền quán ngũ phần da (tacapañcakakammaṭṭhāna) và cho Ngài xuất gia.
So vattārabhito hutvā buddhavacanaṃ uggaṇhanto ekadivasaṃ devadūtasutte ‘‘tamenaṃ, bhikkhave, nirayapālā puna mahāniraye pakkhipantī’’ti (ma. ni. 3.270; a. ni. 3.36) imaṃ ṭhānaṃ sutvā ‘‘ettakaṃ dukkharāsiṃ anubhavitasattaṃ puna mahāniraye pakkhipanti, aho bhāriyo, bhante, mahānirayo’’ti āha.
Dedicated to duties, while learning the Buddha’s teachings, one day, in the Devadūta Sutta, he heard the passage, “Bhikkhus, the guardians of hell cast him back into the great hell.” Upon hearing this, he said, “This being who experiences so much suffering is cast back into the great hell. Oh, Venerable Sir, how terrible is the great hell!”
Ngài, hoan hỷ với việc thực hành bổn phận, học thuộc lời Phật dạy. Một ngày nọ, khi nghe đoạn này trong kinh Devadūta (Thiên Sứ): “Này các Tỳ-khưu, các cai ngục địa ngục lại ném người ấy vào đại địa ngục,” Ngài nói: “Một chúng sinh đã chịu đựng khối khổ đau lớn như vậy lại bị ném vào đại địa ngục lần nữa. Bạch Ngài, đại địa ngục thật là ghê gớm!”
Āmāvuso, bhāriyoti.
“Yes, friend, it is terrible.”
“Đúng vậy, này hiền giả, thật ghê gớm!”
Sakkā, bhante, passitunti?
“Venerable Sir, is it possible to see it?”
“Bạch Ngài, có thể thấy được không?”
‘‘Na sakkā passituṃ, diṭṭhasadisaṃ kātuṃ ekaṃ kāraṇaṃ dassessāmī’’ti sāmaṇere samādapetvā pāsāṇapiṭṭhe alladārurāsiṃ kārehīti.
“It is not possible to see it, but I will show you something that is like seeing it.” Having exhorted the sāmaṇeras, he said, “Arrange a pile of wet wood on the rock slab.”
“Không thể thấy được, nhưng ta sẽ cho ông thấy một điều giống như đã thấy.” Rồi Ngài nói với các Sa-di: “Hãy chất một đống củi ướt trên tảng đá.”
So tathā kāresi.
He did so.
Họ đã làm như vậy.
Thero yathānisinnova iddhiyā abhisaṅkharitvā mahānirayato khajjopanakamattaṃ aggipapaṭikaṃ nīharitvā passantasseva tassa therassa dārurāsimhi pakkhipi.
The Elder, remaining seated, by his psychic power created and brought forth a spark of fire, no bigger than a firefly, from the great hell and cast it onto the pile of wood, right before the sāmaṇera’s eyes.
Vị Trưởng lão, vẫn ngồi nguyên vị trí, dùng thần thông tạo ra một mảnh lửa nhỏ như đom đóm từ đại địa ngục và ném vào đống củi ngay trước mắt vị Sa-di.
Tassa tattha nipāto ca dārurāsino jhāyitvā chārikabhāvūpagamanañca apacchā apurimaṃ ahosi.
Its fall onto the pile and the pile of wood burning and turning to ashes occurred simultaneously.
Ngay lập tức, mảnh lửa rơi xuống và đống củi cháy thành tro, không có sự chậm trễ.
So taṃ disvā, ‘‘bhante, imasmiṃ sāsane kati dhurāni nāmā’’ti pucchi.
Seeing this, he asked, “Venerable Sir, how many kinds of burdens are there in this Dispensation?”
Thấy vậy, Ngài hỏi: “Bạch Ngài, trong giáo pháp này có bao nhiêu gánh nặng (dhura)?”
Āvuso, vipassanādhuraṃ, ganthadhuranti.
“Friend, there are the burden of insight (vipassanā dhura) and the burden of learning (gantha dhura).”
“Này hiền giả, có gánh nặng tuệ quán (vipassanādhura) và gánh nặng kinh điển (ganthadhura).”
‘‘Bhante, gantho nāma paṭibalassa bhāro, mayhaṃ pana dukkhūpanisā saddhā, vipassanādhuraṃ pūressāmi kammaṭṭhānaṃ me dethā’’ti vanditvā nisīdi.
“Venerable Sir, the burden of learning is for one who is capable; but for me, faith is conditioned by suffering. I will fulfill the burden of insight. Please give me a meditation subject.” And having paid homage, he sat down.
“Bạch Ngài, kinh điển là gánh nặng của người có năng lực, còn con thì có đức tin dẫn đến khổ đau, con sẽ hoàn thành gánh nặng tuệ quán. Xin Ngài hãy ban cho con đề mục thiền quán.” Ngài đảnh lễ và ngồi xuống.
Thero ‘‘vattasampanno bhikkhū’’ti vattasīse ṭhatvā tassa kammaṭṭhānaṃ kathesi.
The Elder, thinking, “This bhikkhu is complete in his duties,” stood firm on the foundation of duties and taught him the meditation subject.
Vị Trưởng lão, nghĩ: “Đây là một Tỳ-khưu đầy đủ bổn phận,” rồi đứng trên nền tảng bổn phận, giảng đề mục thiền quán cho Ngài.
So kammaṭṭhānaṃ gahetvā vipassanāya ca kammaṃ karoti, vattañca pūreti.
He took the meditation subject and both practiced insight meditation and fulfilled his duties.
Ngài nhận đề mục thiền quán và thực hành tuệ quán, đồng thời hoàn thành các bổn phận.
Ekadivasaṃ cittalapabbatamahāvihāre vattaṃ karoti, ekadivasaṃ gāmeṇḍavālamahāvihāre, ekadivasaṃ gocaragāmamahāvihāre.
One day he performed his duties at Cittalapabbata Great Monastery, another day at Gaṃeṇḍavāla Great Monastery, and another day at Gocaragāma Great Monastery.
Một ngày Ngài thực hành bổn phận tại Đại Tự viện Cittala-pabbata, một ngày tại Đại Tự viện Gāmeṇḍavāla, một ngày tại Đại Tự viện Gocaragāma.
Thinamiddhe okkantamatte vattaparihānibhayena palālavaraṇakaṃ temetvā sīse ṭhapetvā pāde udake otāretvā nisīdati.
As soon as sloth and torpor arose, for fear of neglecting his duties, he would wet a wisp of straw, place it on his head, immerse his feet in water, and sit down.
Khi hôn trầm và thụy miên vừa khởi lên, vì sợ bỏ bê bổn phận, Ngài nhúng một bó rơm ướt, đặt lên đầu, và ngồi với hai chân ngâm trong nước.
So ekadivasaṃ cittalapabbatamahāvihāre dve yāme vattaṃ katvā balavapaccūsakāle niddāya okkamituṃ āraddhāya allapalālaṃ sīse ṭhapetvā nisinno pācīnapabbatapasse sāmaṇerassa aruṇavatiyasuttantaṃ sajjhāyantassa –
One day, having performed duties for two watches at Cittalapabbata Great Monastery, as strong dawn approached and he began to feel sleepy, he sat with wet straw on his head, listening to a sāmaṇera reciting the Aruṇavatīya Suttanta by the eastern side of the mountain—
Một ngày nọ, tại Đại Tự viện Cittala-pabbata, sau khi thực hành bổn phận suốt hai canh, vào lúc rạng đông mạnh mẽ, khi cơn buồn ngủ bắt đầu ập đến, Ngài ngồi với bó rơm ướt trên đầu. Một Sa-di ở phía sườn núi phía đông đang tụng kinh Aruṇavatīyasuttanta:
Ekaccassa vuttanayeneva ganthe yuttassa ganthaṃ uggaṇhantassa sajjhāyantassa vācentassa desentassa pakāsentassa ca kileso okāsaṃ na labhati, ganthavasena vikkhambhitova hoti.
For some, who are engaged in learning in the manner described—studying, reciting, teaching, expounding—defilement finds no opportunity to arise; it is suppressed by the power of learning.
Đối với một số người, khi họ đã gắn bó với kinh điển theo cách đã nói, đang học thuộc, tụng niệm, giảng dạy, thuyết pháp và công bố kinh điển, phiền não không có cơ hội phát sinh; chúng bị đẩy lùi bởi kinh điển.
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti maliyadevatthero viya.
Having thus suppressed it, he turns it around and attains arahantship, like Venerable Maliyadeva.
Người ấy, sau khi đã đẩy lùi phiền não như vậy, xoay chuyển nó và đạt được A-la-hán quả, giống như Trưởng lão Maliyadeva.
So kirāyasmā tivassabhikkhukāle kallagāmake maṇḍalārāmamahāvihāre uddesañca gaṇhāti, vipassanāya ca kammaṃ karoti.
It is said that this Venerable One, when he had been a bhikkhu for three years, studied and practiced insight meditation at Maṇḍalārāma Great Monastery in Kallagāma.
Nghe nói, vị Đại đức ấy, khi còn là một Tỳ-khưu ba tuổi hạ, đã học hỏi kinh điển và thực hành tuệ quán tại Đại Tự viện Maṇḍalārāma ở làng Kallagāma.
Tassekadivasaṃ kallagāme bhikkhāya carato ekā upāsikā yāguuḷuṅkaṃ datvā puttasinehaṃ uppādetvā theraṃ antonivesane nisīdāpetvā paṇītabhojanaṃ bhojetvā ‘‘kataragāmavāsikosi tātā’’ti pucchi.
One day, while he was on his alms round in Kallagāma, a female lay follower gave him a bowl of gruel, and out of motherly affection, invited the Elder to sit inside her house, offered him exquisite food, and asked, “My son, from which village are you?”
Một ngày nọ, khi Ngài đi khất thực ở làng Kallagāma, một nữ cư sĩ đã dâng một bát cháo, khởi lên tình thương con, mời Ngài ngồi trong nhà và dâng cúng thức ăn ngon. Bà hỏi: “Này con, con ở làng nào?”
Maṇḍalārāmamahāvihāre ganthakammaṃ karomi, upāsiketi.
“Lay follower, I am engaged in the burden of learning at Maṇḍalārāma Great Monastery.”
“Này cư sĩ, con đang làm công việc kinh điển tại Đại Tự viện Maṇḍalārāma.”
Tena hi tāta yāva ganthakammaṃ karosi, idheva nibaddhaṃ bhikkhaṃ gaṇhāsīti.
“In that case, my son, as long as you are engaged in the burden of learning, you should always receive alms here.”
“Vậy thì, này con, chừng nào con còn làm công việc kinh điển, con hãy nhận thực phẩm cúng dường cố định ở đây.”
So taṃ adhivāsetvā tattha nibaddhaṃ bhikkhaṃ gaṇhāti, bhattakiccāvasāne anumodanaṃ karonto ‘‘sukhaṃ hotu, dukkhā muccatū’’ti padadvayameva kathetvā gacchati.
He consented to this and regularly received alms there. At the conclusion of the meal, in his thanksgiving, he would simply say the two phrases, “May there be happiness, may you be freed from suffering,” and then depart.
Ngài chấp thuận và nhận thực phẩm cúng dường cố định ở đó. Sau bữa ăn, khi hồi hướng phước báu, Ngài chỉ nói hai câu: “Mong được an lạc, mong thoát khỏi khổ đau,” rồi rời đi.
Antovasse temāsaṃ tassāyeva saṅgahaṃ karonto piṇḍāpacitiṃ katvā mahāpavāraṇāya saha paṭisambhidāhi arahattaṃ pāpuṇi.
During the three months of the Rains Retreat, while receiving alms from her, he achieved the accumulation of alms-food and attained arahantship along with the analytical knowledges on the day of the Great Invitation.
Trong ba tháng an cư, Ngài đã nhận sự cúng dường của bà ấy, thực hành công đức khất thực và đạt được A-la-hán quả cùng với các phân tích tuệ vào ngày Đại Lễ Pavāraṇā.
Nevāsikamahāthero āha – ‘‘āvuso mahādeva, ajja vihāre mahājano sannipatissati, tassa dhammadānaṃ dadeyyāsī’’ti.
The resident Mahāthera said, "Friend Mahādeva, today a great many people will assemble at the monastery. You should give them the gift of Dhamma."
Trưởng lão cư sĩ nói: "Này hiền giả Mahādeva, hôm nay đại chúng sẽ tập hợp tại tịnh xá, hiền giả hãy ban bố pháp thí cho họ."
Thero adhivāsesi.
The Thera assented.
Vị Trưởng lão đã chấp thuận.
Daharasāmaṇerā upāsikāya saññaṃ adaṃsu – ‘‘ajja te putto dhammaṃ kathessati, vihāraṃ gantvā suṇeyyāsī’’ti.
The young sāmaṇeras gave a sign to the female devotee: "Today your son will preach the Dhamma; you should go to the monastery and listen to it."
Các Sa-di trẻ đã báo cho nữ cư sĩ biết: "Hôm nay, con của bà sẽ thuyết pháp, bà hãy đến tịnh xá mà nghe."
Tātā, na sabbeva dhammakathaṃ jānanti, mama putto ettakaṃ kālaṃ mayhaṃ kathento ‘‘sukhaṃ hotu, dukkhā muccatū’’ti padadvayameva kathesi, mā keḷiṃ karothāti.
"My children, not all know how to preach Dhamma. My son, having preached to me for so long, uttered only the two phrases 'May there be happiness, may you be freed from suffering.' Don't make fun of me."
"Này các con, không phải tất cả đều biết thuyết pháp. Con ta, trong suốt thời gian dài thuyết pháp cho ta, chỉ nói hai từ 'Cầu mong được an lạc, cầu mong thoát khỏi khổ đau.' Đừng có đùa giỡn như vậy!"
Mā, tvaṃ upāsike, jānanaṃ vā ajānanaṃ vā upaṭṭhahassu, vihāraṃ gantvā dhammameva suṇāhīti.
"O female devotee, whether you know or not, do not concern yourself; go to the monastery and just listen to the Dhamma."
"Này nữ cư sĩ, bà đừng bận tâm việc biết hay không biết, hãy đến tịnh xá và nghe pháp."
Upāsikā gandhamālādīni gahetvā gantvā pūjetvā parisante dhammaṃ suṇamānā nisīdi.
The female devotee, taking perfumes, garlands, and so forth, went, offered them, and sat listening to the Dhamma at the edge of the assembly.
Nữ cư sĩ cầm hương hoa và các thứ khác, đi đến cúng dường, rồi ngồi xuống nghe pháp ở rìa hội chúng.
Divādhammakathiko ca sarabhāṇako ca attano pamāṇaṃ ñatvā uṭṭhahiṃsu.
The daytime Dhamma preacher and the reciter, knowing their limits, stood up.
Vị Dhamma-kathika (thuyết pháp) ban ngày và vị Sarabhaṇaka (ngâm tụng) đã biết giới hạn của mình nên đứng dậy.
Tato maliyadevatthero dhammāsane nisīditvā cittabījaniṃ gahetvā anupubbiṃ kathaṃ vatvā – ‘‘mayā mahāupāsikāya tayo māse dvīheva padehi anumodanā katā, ajja sabbarattiṃ tīhi piṭakehi sammasitvā tasseva padadvayassa atthaṃ kathessāmī’’ti dhammadesanaṃ ārabhitvā sabbarattiṃ kathesi.
Then Maliyadeva Thera sat on the Dhamma seat, took a beautiful fan, delivered a progressive discourse, and then said: "I have given the great female devotee an anumodanā with only two phrases for three months. Today, having examined the three Piṭakas throughout the entire night, I shall explain the meaning of those same two phrases." Starting his Dhamma discourse thus, he preached the entire night.
Sau đó, Trưởng lão Maliyadeva ngồi trên pháp tòa, cầm chiếc quạt đẹp, thuyết một bài pháp tuần tự, rồi nói: "Ta đã tùy hỷ với vị đại cư sĩ này bằng hai từ trong ba tháng. Hôm nay, ta sẽ suy xét bằng ba Tạng Pali suốt cả đêm và thuyết giảng ý nghĩa của chính hai từ đó." Bắt đầu bài thuyết pháp, Ngài đã thuyết giảng suốt cả đêm.
Aruṇuggamane desanāpariyosāne mahāupāsikā sotāpattiphale patiṭṭhāsi.
At the rising of the sun, at the conclusion of the discourse, the great female devotee became established in the fruit of Stream-entry (sotāpatti).
Khi bình minh ló dạng, vào lúc kết thúc bài thuyết pháp, vị đại cư sĩ đã chứng đắc quả vị Nhập Lưu (Sotāpatti).
Aparopi tasmiṃyeva mahāvihāre tissabhūtitthero nāma vinayaṃ gaṇhanto bhikkhācāravelāyaṃ antogāmaṃ paviṭṭho visabhāgārammaṇaṃ olokesi.
Another Thera named Tissabhūti Thera, residing in that same great monastery and learning the Vinaya, entered the village for alms and looked at an unsuitable object (visabhāgārammaṇa).
Một vị Trưởng lão khác tên là Tissabhūti, trong khi học Vinaya tại cùng đại tịnh xá đó, khi vào làng khất thực, đã nhìn thấy một đối tượng không phù hợp (visabhāgārammaṇa).
Tassa lobho uppajji, so patiṭṭhitapādaṃ acāletvā attano patte yāguṃ upaṭṭhākadaharassa patte ākiritvā ‘‘ayaṃ vitakko vaḍḍhamāno maṃ catūsu apāyesu saṃsīdāpessatī’’ti tatova nivattitvā ācariyassa santikaṃ gantvā vanditvā ekamantaṃ ṭhito āha – ‘‘eko me byādhi uppanno, ahaṃ etaṃ tikicchituṃ sakkonto āgamissāmi, itarathā nāgamissāmi.
Craving arose in him. Without moving his standing foot, he poured the gruel from his own bowl into the bowl of the young attendant, thinking, "If this thought grows, it will sink me into the four woeful states." From that very spot, he turned back, went to his teacher, prostrated, and stood aside, saying, "A certain ailment has arisen in me. I will return if I am able to cure it; otherwise, I will not come back.
Tham ái đã khởi lên trong Ngài. Ngài không nhúc nhích chân đang đứng, trút cháo trong bát của mình sang bát của vị Tỳ-khưu trẻ hộ độ, và nghĩ: "Nếu tà tư này tiếp tục tăng trưởng, nó sẽ nhấn chìm ta vào bốn cảnh khổ." Từ đó, Ngài quay trở lại, đến chỗ thầy mình, đảnh lễ và đứng sang một bên rồi nói: "Con có một căn bệnh đã phát sinh, con sẽ trở lại nếu con có thể chữa trị được nó, nếu không thì con sẽ không trở lại.
Tumhe divā uddesañca sāyaṃ uddesañca maṃ oloketvā ṭhapetha, paccūsakāle uddesaṃ pana mā ṭhapayitthā’’ti evaṃ vatvā malayavāsimahāsaṅgharakkhitattherassa santikaṃ agamāsi.
You should keep my instruction for the day and the evening by looking for me, but do not keep the instruction for dawn." Having said this, he went to Malayavāsī Mahāsaṅgharakkhita Thera.
Xin quý Ngài hãy giữ chỗ cho con học vào ban ngày và ban đêm, nhưng đừng giữ chỗ cho con học vào lúc rạng đông." Nói xong như vậy, Ngài đi đến chỗ Trưởng lão Mahāsaṅgharakkhita ở Malayavāsi.
Thero attano paṇṇasālāya paribhaṇḍaṃ karonto taṃ anoloketvāva ‘‘paṭisāmehi, āvuso, tava pattacīvara’’nti āha.
The Thera, arranging the furnishings in his leaf-hut, said without looking at him, "Put away your bowl and robes, friend."
Vị Trưởng lão đang chỉnh sửa vật dụng trong tịnh xá lá của mình, không nhìn Ngài mà nói: "Này hiền giả, hãy cất bát và y của hiền giả đi."
Bhante, eko me byādhi atthi, sace tumhe taṃ tikicchituṃ sakkotha, paṭisāmessāmīti.
"Venerable sir, I have a certain ailment. If you are able to cure it, I will put them away," he said.
"Bạch Ngài, con có một căn bệnh. Nếu Ngài có thể chữa trị nó, con sẽ cất bát và y."
Āvuso, uppannaṃ rogaṃ tikicchituṃ samatthassa santikaṃ āgatosi, paṭisāmehīti.
"Friend, you have come to one who is capable of curing the arisen illness. Put them away," he said.
"Này hiền giả, hiền giả đã đến chỗ của người có khả năng chữa trị căn bệnh đã phát sinh. Hãy cất bát và y đi."
Subbaco bhikkhu ‘‘amhākaṃ ācariyo ajānitvā evaṃ na vakkhatī’’ti pattacīvaraṃ ṭhapetvā therassa vattaṃ dassetvā vanditvā ekamantaṃ nisīdi.
The obedient bhikkhu thought, "Our teacher would not speak thus without knowing," and so, having put away his bowl and robes, he performed his duties for the Thera, prostrated, and sat down at one side.
Vị Tỳ-khưu Subbaca nghĩ: "Thầy của chúng ta sẽ không nói như vậy mà không biết." Ngài cất bát và y, thực hiện các bổn phận đối với vị Trưởng lão, đảnh lễ và ngồi sang một bên.
Thero ‘‘rāgacarito aya’’nti ñatvā asubhakammaṭṭhānaṃ kathesi.
The Thera, knowing "this one has a nature of lust (rāgacarito)", expounded on the meditation object of foulness (asubhakammaṭṭhāna).
Vị Trưởng lão biết rằng "vị này có hành xử thiên về tham ái" nên đã thuyết giảng về đề mục bất tịnh (asubhakammaṭṭhāna).
So uṭṭhāya pattacīvaraṃ aṃse laggetvā theraṃ punappunaṃ vandi.
He rose, slung his bowl and robes over his shoulder, and prostrated to the Thera again and again.
Vị ấy đứng dậy, vắt bát và y lên vai, đảnh lễ vị Trưởng lão nhiều lần.
Kiṃ, āvuso, mahābhūti atirekanipaccakāraṃ dassesīti?
"Friend Mahābhūti, why do you show excessive reverence?"
"Này hiền giả Mahābhūti, tại sao hiền giả lại thể hiện sự cung kính quá mức như vậy?"
Bhante, sace attano kiccaṃ kātuṃ sakkhissāmi, iccetaṃ kusalaṃ.
"Venerable sir, if I am able to accomplish my task, that would be good.
"Bạch Ngài, nếu con có thể hoàn thành việc của mình, thì điều đó thật tốt lành.
No ce, idaṃ me pacchimadassananti!
If not, this is my last sight!"
Nếu không, đây là lần gặp cuối cùng của con!"
Gacchāvuso, mahābhūti tādisassa yuttayogassa kulaputtassa na jhānaṃ vā vipassanā vā maggo vā phalaṃ vā dullabhanti.
"Go, friend Mahābhūti, for such a well-practiced clansman, jhāna or vipassanā, or the path or its fruit, is not difficult to attain."
"Hãy đi đi, hiền giả Mahābhūti. Đối với một thiện nam tử có sự tinh tấn phù hợp như vậy, thiền định, tuệ quán, đạo hay quả không phải là điều khó đạt được."
So therassa kathaṃ sutvā nipaccakāraṃ dassetvā āgamanakāle vavatthāpitaṃ channaṃ sepaṇṇigacchamūlaṃ gantvā pallaṅkena nisinno asubhakammaṭṭhānaṃ pādakaṃ katvā vipassanaṃ paṭṭhapetvā arahatte patiṭṭhāya paccūsakāle uddesaṃ sampāpuṇi.
Having heard the Thera's words, and having shown reverence, he went to the Sepaṇṇi bush root, which had been marked out for his arrival, sat in the cross-legged posture, made the foulness meditation object his basis, established vipassanā, and attained Arahantship. He arrived for the instruction at dawn.
Nghe lời của vị Trưởng lão, Ngài thể hiện sự cung kính rồi đi đến gốc cây Sepaṇṇi được chỉ định từ lúc đến, ngồi kiết già, lấy đề mục bất tịnh làm nền tảng, bắt đầu tuệ quán, chứng đắc A-la-hán quả và đến giờ học vào lúc rạng đông.
Evarūpānaṃ ganthavasena vikkhambhitā kilesā tathā vikkhambhitāva honti.
In such persons, defilements kept in check by means of textual study (ganthavasena) remain thus suppressed.
Đối với những người như vậy, các phiền não được trấn áp bằng cách học kinh điển vẫn bị trấn áp như vậy.
Ekaccassa pana vuttanayeneva dhutaṅgāni pariharato kileso okāsaṃ na labhati, dhutaṅgavasena vikkhambhitova hoti.
However, for some, by adhering to the ascetic practices (dhutaṅga) in the manner described, defilements do not find an opportunity; they are suppressed by means of the dhutaṅgas.
Tuy nhiên, đối với một số người, khi thực hành các hạnh đầu đà (dhutaṅga) theo cách đã nói, phiền não không có cơ hội phát sinh, chúng bị trấn áp nhờ các hạnh đầu đà.
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti gāmantapabbhāravāsī mahāsīvatthero viya.
Such a person, having thus suppressed them, turns them back and attains Arahantship, like Mahāsīva Thera who resided in the village ravine.
Người ấy giữ cho phiền não bị trấn áp như vậy, rồi chuyển hóa chúng và đạt được A-la-hán quả, giống như Trưởng lão Mahāsīva ở Gāmantapabbhāra.
Thero kira mahāgāme tissamahāvihāre vasanto tepiṭakaṃ atthavasena ca pāḷivasena ca aṭṭhārasa mahāgaṇe vāceti.
It is said that this Thera, residing in the great Tissa Monastery in the great village, taught the Tipiṭaka to eighteen large groups, both in terms of meaning (attha) and Pāḷi text.
Nghe nói, vị Trưởng lão đó sống tại đại tịnh xá Tissa ở làng lớn, và giảng dạy Tam Tạng Pali cho mười tám đại chúng theo cả nghĩa lý và văn bản.
Therassa ovāde ṭhatvā saṭṭhisahassa bhikkhū arahattaṃ pāpuṇiṃsu.
Staying in the Thera's instruction, sixty thousand bhikkhus attained Arahantship.
Sáu vạn Tỳ-khưu đã đạt được A-la-hán quả nhờ tuân theo lời giáo huấn của vị Trưởng lão.
Tesu eko bhikkhu attanā paṭividdhadhammaṃ ārabbha uppannasomanasso cintesi – ‘‘atthi nu kho idaṃ sukhaṃ amhākaṃ ācariyassā’’ti.
Among them, one bhikkhu, filled with joy concerning the Dhamma he had penetrated, thought: "Does our teacher also have this happiness?"
Trong số đó, một vị Tỳ-khưu, với niềm hoan hỷ phát sinh do đã thấu hiểu giáo pháp, đã suy nghĩ: "Liệu sự an lạc này có phải của thầy chúng ta không?"
So āvajjento therassa puthujjanabhāvaṃ ñatvā ‘‘ekenupāyena therassa saṃvegaṃ uppādessāmī’’ti attano vasanaṭṭhānato therassa santikaṃ gantvā vanditvā vattaṃ dassetvā nisīdi.
Reflecting thus, he realized the Thera's state as a worldling (puthujjana), and thinking, "I will arouse a sense of urgency in the Thera by some means," he went from his dwelling place to the Thera, prostrated, performed his duties, and sat down.
Khi quán xét, Ngài biết được vị Trưởng lão vẫn còn là phàm phu, nên nghĩ: "Ta sẽ làm cho vị Trưởng lão khởi lên sự xúc động bằng một phương cách nào đó." Từ chỗ ở của mình, Ngài đi đến chỗ vị Trưởng lão, đảnh lễ, thực hiện các bổn phận và ngồi xuống.
Atha naṃ thero ‘‘kiṃ āgatosi, āvuso, piṇḍapātikā’’ti āha.
Then the Thera said to him, "Friend, alms-gatherer, why have you come?"
Khi đó, vị Trưởng lão hỏi Ngài: "Này hiền giả Piṇḍapātika, hiền giả đến đây làm gì?"
‘‘Sace me okāsaṃ karissatha, ekaṃ dhammapadaṃ gaṇhissāmī’’ti āgatosmi, bhanteti.
"Venerable sir, I have come thinking, 'If you grant me the opportunity, I will take up a section of the Dhamma (dhammapada).'"
"Bạch Ngài, nếu Ngài cho con cơ hội, con sẽ học một đoạn pháp."
Bahū, āvuso, gaṇhanti, tuyhaṃ okāso na bhavissatīti.
"Many, friend, are taking it up; there will be no opportunity for you."
"Này hiền giả, nhiều vị đang học, hiền giả sẽ không có cơ hội đâu."
So sabbesu rattidivasabhāgesu okāsaṃ alabhanto, ‘‘bhante, evaṃ okāse asati maraṇassa kathaṃ okāsaṃ labhissathā’’ti āha.
Since he found no opportunity during any of the night or day periods, he said, "Venerable sir, if there is no such opportunity, how will you find an opportunity for death?"
Vì không có cơ hội trong tất cả các buổi ngày và đêm, Ngài nói: "Bạch Ngài, nếu không có cơ hội như vậy, làm sao Ngài có thể có cơ hội cho cái chết?"
Tadā thero cintesi – ‘‘nāyaṃ uddesatthāya āgato, mayhaṃ panesa saṃvegajananatthāya āgato’’ti.
Then the Thera thought, "This bhikkhu has not come for instruction; he has come to arouse urgency in me."
Khi đó, vị Trưởng lão nghĩ: "Vị Tỳ-khưu này không đến để học, mà Ngài đến để làm cho ta khởi lên sự xúc động."
Sopi thero ‘‘bhikkhunā nāma, bhante, mādisena bhavitabba’’nti vatvā theraṃ vanditvā maṇivaṇṇe ākāse uppatitvā agamāsi.
That Thera, too, said, "Venerable sir, a bhikkhu should be like me," and having said this, he prostrated to the Thera, rose into the sky, radiant like a jewel, and departed.
Vị Trưởng lão ấy cũng nói: "Bạch Ngài, một Tỳ-khưu nên giống như con." Nói xong, Ngài đảnh lễ vị Trưởng lão, rồi bay lên không trung với màu ngọc bích và đi mất.
Thero tassa gatakālato paṭṭhāya jātasaṃvego divā uddesañca sāyaṃ uddesañca vācetvā pattacīvaraṃ hatthapāse ṭhapetvā paccūsakāle uddesaṃ gahetvā otarantena bhikkhunā saddhiṃ pattacīvaramādāya otiṇṇo terasa dhutaguṇe paripuṇṇe adhiṭṭhāya gāmantapabbhārasenāsanaṃ gantvā pabbhāraṃ paṭijaggitvā mañcapīṭhaṃ ussāpetvā ‘‘arahattaṃ apatvā mañce piṭṭhiṃ na pasāressāmī’’ti mānasaṃ bandhitvā caṅkamaṃ otari.
From the time of that bhikkhu's departure, the Thera, having generated a sense of urgency, taught the lessons for the day and the evening, kept his bowl and robes within reach, and then, taking his bowl and robes with the bhikkhu who descended to take the dawn lesson, he went down. He determined to fully observe the thirteen ascetic practices (dhutaguṇa), went to the forest dwelling in the ravine near the village (gāmantapabbhārasenāsana), prepared the ravine dwelling, raised his couch and seat, and made a resolve, "I will not rest my back on the couch until I attain Arahantship," and then he descended to the walking path.
Từ khi vị ấy đi, vị Trưởng lão đó, với sự xúc động đã phát sinh, sau khi giảng dạy vào ban ngày và ban đêm, đặt bát và y trong tầm tay, rồi cùng với vị Tỳ-khưu đang xuống để học vào lúc rạng đông, cầm bát và y xuống. Ngài phát nguyện thực hành mười ba hạnh đầu đà một cách trọn vẹn, đi đến chỗ ở trong hang động gần làng, dọn dẹp hang động, dựng giường ghế lên, và phát tâm: "Ta sẽ không duỗi lưng trên giường cho đến khi đạt được A-la-hán quả." Ngài xuống chỗ kinh hành.
Tassa ‘‘ajja arahattaṃ gaṇhissāmi ajja arahattaṃ gaṇhissāmī’’ti ghaṭentasseva pavāraṇā sampattā.
As he strove, thinking, "Today I will attain Arahantship, today I will attain Arahantship," the Pavāraṇā day arrived.
Trong khi Ngài tinh tấn: "Hôm nay ta sẽ đạt A-la-hán quả, hôm nay ta sẽ đạt A-la-hán quả," thì lễ Pavāraṇā đã đến.
So pavāraṇāya upakaṭṭhāya ‘‘puthujjanabhāvaṃ pahāya visuddhipavāraṇaṃ pavāressāmī’’ti cintento ativiya kilamati.
As the Pavāraṇā approached, he contemplated, "I will abandon the state of a worldling and perform the pure Pavāraṇā," and he exerted himself greatly.
Khi lễ Pavāraṇā đến gần, Ngài đã rất vất vả khi nghĩ: "Ta sẽ thực hành Pavāraṇā thanh tịnh sau khi từ bỏ trạng thái phàm phu."
So tāya pavāraṇāya maggaṃ vā phalaṃ vā uppādetuṃ asakkonto ‘‘mādisopi nāma āraddhavipassako na labhati, yāva dullabhañca vatidaṃ arahatta’’nti vatvā teneva niyāmena ṭhānacaṅkamabahulo hutvā tiṃsa vassāni samaṇadhammaṃ katvā mahāpavāraṇāya majjhe ṭhitaṃ puṇṇacandaṃ disvā ‘‘kiṃ nu kho candamaṇḍalaṃ visuddhaṃ, udāhu mayhaṃ sīla’’nti cintento ‘‘candamaṇḍale sasalakkhaṇaṃ paññāyati, mayhaṃ pana upasampadato paṭṭhāya yāvajjadivasā sīlasmiṃ kāḷakaṃ vā tilako vā natthī’’ti āvajjetvā sañjātapītisomanasso paripakkañāṇattā pītiṃ vikkhambhetvā saha paṭisambhidāhi arahattaṃ pāpuṇi.
Unable to generate the path or fruit by that Pavāraṇā, he thought, "Even one like me, who has commenced vipassanā, cannot attain it; how truly difficult is this Arahantship!" Having spoken thus, and being accustomed to standing and walking in the same manner, he practiced the ascetic life for thirty years. On the day of the Great Pavāraṇā, seeing the full moon in the sky, he pondered, "Is the moon's disc pure, or is my sīla pure?" Reflecting that "the rabbit-mark is visible on the moon's disc, but in my sīla, from the time of my ordination until today, there is no blemish or spot," he became filled with joy and happiness. Due to his mature knowledge, he subdued his rapture and attained Arahantship together with the Paṭisambhidās.
Vị ấy, không thể chứng đắc Đạo hay Quả trong lễ Pavāraṇā đó, đã nói: “Ngay cả một người đã tinh tấn tu tập Vipassanā như ta mà còn không đạt được A-la-hán, quả thật A-la-hán khó đạt biết bao!” Rồi với phương pháp ấy, vị ấy đã thực hành đời sống Sa-môn trong ba mươi năm, với nhiều thời gian đi kinh hành và đứng. Đến giữa lễ Mahāpavāraṇā, khi nhìn thấy vầng trăng tròn, vị ấy suy nghĩ: “Vầng trăng này có thanh tịnh chăng, hay là giới của ta?” Sau khi quán xét và nhận ra: “Trong vầng trăng có dấu vết con thỏ, nhưng từ khi thọ giới Tỳ-kheo cho đến ngày nay, giới của ta không có vết đen hay tì vết nào”, vị ấy khởi tâm hoan hỷ và hân hoan. Do trí tuệ đã chín muồi, vị ấy đã vượt qua niềm hoan hỷ và chứng đắc A-la-hán cùng với các Tứ Vô Ngại Giải (Paṭisambhidā).
Evarūpassa dhutaṅgavasena vikkhambhito kileso tathā vikkhambhitova hoti.
For such an individual, defilements suppressed by means of dhutaṅga practices remain suppressed.
Đối với người như vậy, phiền não đã bị loại trừ nhờ thực hành hạnh đầu đà (dhutaṅga) thì chúng vẫn bị loại trừ như vậy.
Ekaccassa vuttanayeneva paṭhamajjhānādisamāpajjanabahulatāya kileso okāsaṃ na labhati, samāpattivasena vikkhambhitova hoti.
For some, as mentioned, defilements find no opportunity to arise due to their frequent attainment of the first jhāna and so forth; they remain suppressed by means of meditative attainments.
Đối với một số người khác, theo cách đã nói, do thường xuyên nhập các thiền định (jhāna) từ Sơ thiền trở đi, phiền não không có cơ hội phát sinh, chúng bị loại trừ nhờ các định (samāpatti).
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti mahātissatthero viya.
Such a person, having kept those defilements thus suppressed, turns them around and attains Arahantship, like the Mahātissa Thera.
Vị ấy đã loại trừ chúng như vậy, rồi xoay chuyển (tâm) và chứng đắc A-la-hán, như trường hợp Đại Trưởng lão Tissa (Mahātissatthero).
Thero kira avassikakālato paṭṭhāya aṭṭhasamāpattilābhī.
It is said that from his eighth year as a bhikkhu, the Thera was an attainer of the eight attainments.
Nghe nói, từ khi nhập hạ, vị Trưởng lão ấy đã là người thành tựu tám định (aṭṭhasamāpatti).
So samāpattivikkhambhitānaṃ kilesānaṃ asamudācārena uggahaparipucchāvaseneva ariyamaggasāmantaṃ katheti, saṭṭhivassakālepi attano puthujjanabhāvaṃ na jānāti.
He taught about the vicinity of the Ariyan Path merely through studying and questioning, due to the non-arising of defilements suppressed by meditative attainments; even at sixty vassas, he did not know his own state as a worldling.
Do phiền não đã bị loại trừ bằng định, vị ấy chỉ giảng về các giai đoạn gần cận Thánh đạo (ariyamagga) thông qua việc học hỏi và nghiên cứu, và ngay cả khi đã sáu mươi tuổi hạ, vị ấy vẫn không biết mình là phàm nhân.
Athekadivasaṃ mahāgāme tissamahāvihārato bhikkhusaṅgho talaṅgaravāsidhammadinnattherassa sāsanaṃ pesesi ‘‘thero āgantvā amhākaṃ dhammakathaṃ kathetū’’ti.
Then one day, the Saṅgha of bhikkhus from the Mahātissa Vihāra in the great village sent a message to Dhammadinna Thera, who resided in Talaṅgara, saying, "May the Thera come and deliver a Dhamma talk to us."
Một ngày nọ, Tăng chúng từ Tissa Mahāvihāra ở Mahāgāma đã gửi lời nhắn đến Trưởng lão Dhammadinna ở Talaṅgaravāsa: “Xin Trưởng lão hãy đến và thuyết pháp cho chúng tôi.”
Thero adhivāsetvā ‘‘mama santike mahallakataro bhikkhu natthi, mahātissatthero kho pana me kammaṭṭhānācariyo, taṃ saṅghattheraṃ katvā gamissāmī’’ti cintento bhikkhusaṅghaparivuto therassa vihāraṃ gantvā divāṭṭhāne therassa vattaṃ dassetvā ekamantaṃ nisīdi.
The Thera assented and thought, "There is no bhikkhu older than me here. However, Mahātissa Thera is my meditation teacher. I will go, making him the senior Thera of the Saṅgha." Thinking thus, he went to the Thera's monastery, surrounded by a company of bhikkhus, showed respect to the Thera at his day-residence, and sat down to one side.
Vị Trưởng lão (Dhammadinna) đã chấp nhận và suy nghĩ: “Ở chỗ ta không có vị Tỳ-kheo nào lớn tuổi hơn. Tuy nhiên, Đại Trưởng lão Tissa là vị thầy kammaṭṭhāna của ta. Ta sẽ đi cùng ngài, tôn ngài làm Trưởng lão Tăng chúng.” Nghĩ vậy, vị ấy cùng với Tăng chúng đã đến tịnh xá của Đại Trưởng lão Tissa. Sau khi thực hiện các bổn phận đối với Trưởng lão tại nơi nghỉ ban ngày, vị ấy ngồi sang một bên.
Thero āha – ‘‘kiṃ, dhammadinna, cirassaṃ āgatosī’’ti?
The Thera asked, "Dhammadinna, why have you come after such a long time?"
Trưởng lão (Tissa) hỏi: “Này Dhammadinna, sao lâu rồi con mới đến vậy?”
‘‘Āma, bhante, tissamahāvihārato me bhikkhusaṅgho sāsanaṃ pesesi, ahaṃ ekako na gamissāmi, tumhehi pana saddhiṃ gantukāmo hutvā āgatomhī’’ti sāraṇīyakathaṃ kathentova papañcetvā ‘‘kadā, bhante, tumhehi ayaṃ dhammo adhigato’’ti pucchi.
"Yes, Venerable Sir, the community of bhikkhus from Tissamahāvihāra sent me a message. I will not go alone; I have come wanting to go with you," he said, engaging in agreeable conversation, and then elaborated, asking, "Venerable Sir, when did you attain this Dhamma?"
“Bạch Thế Tôn, vâng, Tăng chúng từ Tissa Mahāvihāra đã gửi lời nhắn cho con. Con sẽ không đi một mình, con muốn đi cùng Thế Tôn nên đã đến đây.” Vị ấy vừa nói chuyện thân mật, vừa mở rộng câu chuyện và hỏi: “Bạch Thế Tôn, Ngài đã chứng đắc pháp này từ khi nào?”
Saṭṭhimattāni, āvuso dhammadinna, vassāni hontīti.
"It has been about sixty years, friend Dhammadinna," he said.
“Này hiền giả Dhammadinna, đã sáu mươi năm rồi.”
Samāpattiṃ pana, bhante, vaḷañjethāti.
"But Venerable Sir, do you enter attainments?"
“Bạch Thế Tôn, Ngài có thể nhập định không?”
Āma, āvusoti.
"Yes, friend," he said.
“Vâng, này hiền giả.”
Ekaṃ pokkharaṇiṃ māpetuṃ sakkuṇeyyātha, bhanteti?
"Venerable Sir, would you be able to create a pond?"
“Bạch Thế Tôn, Ngài có thể tạo ra một cái hồ không?”
‘‘Na, āvuso, etaṃ bhāriya’’nti vatvā sammukhaṭṭhāne pokkharaṇiṃ māpesi.
"No, friend, that is not difficult," he said and created a pond right in front of him.
Vị ấy nói: “Này hiền giả, việc đó không khó.” Rồi ngài đã tạo ra một cái hồ ngay trước mặt.
‘‘Ettha, bhante, ekaṃ padumagacchaṃ māpethā’’ti ca vutto tampi māpesi.
When told, "Venerable Sir, create a lotus bush here," he also created that.
Khi được yêu cầu: “Bạch Thế Tôn, hãy tạo một bụi sen ở đó”, ngài cũng đã tạo ra nó.
Idānettha mahantaṃ pupphaṃ dassethāti.
"Now, display a large flower here."
“Bây giờ, hãy hiện ra một bông hoa lớn ở đó.”
Thero tampi dassesi.
The Thera also displayed it.
Vị Trưởng lão cũng đã hiện ra nó.
Ettha soḷasavassuddesikaṃ itthirūpaṃ dassethāti.
"Here, display the form of a sixteen-year-old woman."
“Hãy hiện ra một hình ảnh người nữ mười sáu tuổi ở đó.”
Thero soḷasavassuddesikaṃ itthirūpaṃ dassesi.
The Thera displayed the form of a sixteen-year-old woman.
Vị Trưởng lão đã hiện ra một hình ảnh người nữ mười sáu tuổi.
Tato naṃ āha – ‘‘idaṃ, bhante, punappunaṃ subhato manasi karothā’’ti.
Then he said to him, "Venerable Sir, contemplate this repeatedly as beautiful."
Sau đó, vị ấy nói với ngài: “Bạch Thế Tôn, hãy quán tưởng hình ảnh này là đẹp đẽ, lặp đi lặp lại.”
Thero attanāva māpitaṃ itthirūpaṃ olokento lobhaṃ uppādesi.
As the Thera looked at the woman's form that he himself had created, he generated greed.
Vị Trưởng lão, khi nhìn hình ảnh người nữ do chính mình tạo ra, đã khởi lên tham ái.
Tadā attano puthujjanabhāvaṃ ñatvā ‘‘avassayo me sappurisa hohī’’ti antevāsikassa santike ukkuṭikaṃ nisīdi.
At that time, knowing his own state as a worldling, he sat squatting before his disciple, saying, "Good man, be a refuge for me."
Lúc đó, nhận ra mình vẫn là phàm nhân, ngài quỳ gối trước vị đệ tử và nói: “Này thiện nam tử, hãy là nơi nương tựa của ta.”
‘‘Etadatthamevāhaṃ, bhante, āgato’’ti therassa asubhavasena sallahukaṃ katvā kammaṭṭhānaṃ kathetvā therassa okāsaṃ kātuṃ bahi nikkhanto.
"Venerable Sir, I have indeed come for this purpose," he said, and after lightening the Thera's mind by means of the contemplation of foulness and teaching him a meditation subject, he went outside to give the Thera an opportunity.
“Bạch Thế Tôn, con đến đây chính vì mục đích đó.” Nói vậy, vị ấy đã giảng kammaṭṭhāna về bất tịnh cho Trưởng lão để làm tâm ngài nhẹ nhõm, rồi đi ra ngoài để tạo không gian cho Trưởng lão.
Suparimadditasaṅkhāro thero tasmiṃ divāṭṭhānato nikkhantamatteyeva saha paṭisambhidāhi arahattaṃ pāpuṇi.
As soon as the Thera, whose saṅkhāras were well-purified, left that day-residence, he attained Arahantship together with the Paṭisambhidās.
Vị Trưởng lão (Tissa), với các hành đã được trau dồi kỹ lưỡng, ngay khi vị kia vừa rời khỏi nơi nghỉ ban ngày, đã chứng đắc A-la-hán cùng với các Tứ Vô Ngại Giải.
Atha naṃ saṅghattheraṃ katvā dhammadinnatthero tissamahāvihāraṃ gantvā saṅghassa dhammakathaṃ kathesi.
Then, making him the Saṅgha Thera, Dhammadinna Thera went to Tissamahāvihāra and delivered a Dhamma talk to the Saṅgha.
Sau đó, Trưởng lão Dhammadinna đã tôn ngài làm Trưởng lão Tăng chúng, rồi đến Tissa Mahāvihāra và thuyết pháp cho Tăng chúng.
Evarūpassa samāpattivasena vikkhambhito kileso tathā vikkhambhitova hoti.
For such an individual, defilements suppressed by means of meditative attainments remain suppressed.
Đối với người như vậy, phiền não đã bị loại trừ nhờ định thì chúng vẫn bị loại trừ như vậy.
Ekaccassa pana vuttanayeneva vipassanāya kammaṃ karontassa kileso okāsaṃ na labhati, vipassanāvasena vikkhambhitova hoti.
For some, as mentioned, defilements find no opportunity to arise when they perform the work of vipassanā; they remain suppressed by means of vipassanā.
Đối với một số người khác, theo cách đã nói, khi thực hành Vipassanā, phiền não không có cơ hội phát sinh, chúng bị loại trừ nhờ Vipassanā.
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti, buddhakāle saṭṭhimattā āraddhavipassakā bhikkhū viya.
Such a person, having kept those defilements thus suppressed, turns them around and attains Arahantship, like the sixty bhikkhus dedicated to vipassanā in the time of the Buddha.
Vị ấy đã loại trừ chúng như vậy, rồi xoay chuyển (tâm) và chứng đắc A-la-hán, như sáu mươi vị Tỳ-kheo đã tinh tấn tu tập Vipassanā vào thời Đức Phật.
Te kira satthu santike kammaṭṭhānaṃ gahetvā vivittaṃ araññaṃ pavisitvā vipassanāya kammaṃ karontā kilesānaṃ asamudācāravasena ‘‘paṭividdhamaggaphalā maya’’nti saññāya maggaphalatthāya vāyāmaṃ akatvā ‘‘amhehi paṭividdhadhammaṃ dasabalassa ārocessāmā’’ti satthu santikaṃ āgacchanti.
It is said that those bhikkhus, having received their meditation subject from the Teacher, entered a secluded forest and, while performing the work of vipassanā, thought, due to the non-arising of defilements, "We have penetrated the path and fruit." With this perception, without exerting themselves for the path and fruit, they resolved, "We will report the Dhamma we have penetrated to the Dasabala," and came to the Teacher.
Nghe nói, những vị ấy đã nhận kammaṭṭhāna từ Đức Thế Tôn, rồi vào rừng vắng để thực hành Vipassanā. Do phiền não không phát sinh, họ đã lầm tưởng rằng: “Chúng ta đã chứng đắc Đạo và Quả.” Với ý nghĩ đó, họ không tinh tấn để đạt Đạo và Quả, mà thay vào đó, họ nghĩ: “Chúng ta sẽ trình bày pháp đã chứng đắc cho Đức Thập Lực.” Rồi họ đã đến chỗ Đức Thế Tôn.
Satthā tesaṃ pure āgamanatova ānandattheraṃ āha – ‘‘ānanda, padhānakammikā bhikkhū ajja maṃ passituṃ āgamissanti, tesaṃ mama dassanāya okāsaṃ akatvā ‘āmakasusānaṃ gantvā allaasubhabhāvanaṃ karothā’ti pahiṇeyyāsī’’ti.
Even before their arrival, the Teacher said to Ānanda Thera, "Ānanda, the bhikkhus dedicated to practice will come to see me today. Do not give them an opportunity to see me, but send them away, saying, 'Go to the charnel ground and practice contemplation of the wet foulness.'"
Đức Thế Tôn, trước khi họ đến, đã nói với Trưởng lão Ānanda: “Này Ānanda, các Tỳ-kheo đang tinh tấn tu tập sẽ đến gặp Như Lai hôm nay. Con đừng cho họ cơ hội gặp Như Lai, mà hãy bảo họ: ‘Hãy đến nghĩa địa hoang vắng và thực hành quán bất tịnh trên thi thể còn tươi.’”
Thero tesaṃ āgatānaṃ satthārā kathitasāsanaṃ ārocesi.
The Thera, when they arrived, conveyed the Teacher's message.
Vị Trưởng lão (Ānanda) đã truyền lại lời nhắn của Đức Thế Tôn cho họ khi họ đến.
Te ‘‘tathāgato ajānitvā na kathessati, addhā ettha kāraṇaṃ bhavissatī’’ti āmakasusānaṃ gantvā allaasubhaṃ olokentā lobhaṃ uppādetvā ‘‘idaṃ nūna sammāsambuddhena diṭṭhaṃ bhavissatī’’ti jātasaṃvegā laddhamaggaṃ kammaṭṭhānaṃ ādito paṭṭhāya ārabhiṃsu.
They thought, "The Tathāgata would not speak without knowing; surely there is a reason here," and went to the charnel ground. As they contemplated the wet foulness, they generated greed. Convinced that "the Fully Self-Enlightened One must surely have seen this," they were stirred to urgency and began their meditation subject, which had the path as its basis, from the very beginning.
Họ nghĩ: “Đức Như Lai sẽ không nói nếu không biết. Chắc chắn có lý do ở đây.” Rồi họ đã đến nghĩa địa hoang vắng, khi nhìn các thi thể bất tịnh còn tươi, họ đã khởi lên tham ái. Cảm thấy xúc động, họ đã bắt đầu lại kammaṭṭhāna đã nhận từ ban đầu.
Satthā tesaṃ vipassanāya āraddhabhāvaṃ ñatvā gandhakuṭiyaṃ nisinnova imaṃ obhāsagāthamāha –
The Teacher, knowing that they had commenced vipassanā, recited this verse of revelation while seated in the Gandhakūṭi:
Đức Thế Tôn, biết rằng họ đã tinh tấn tu tập Vipassanā, đã ngồi trong hương thất và nói bài kệ ánh sáng này:
Ekaccassa vuttanayeneva navakammaṃ karontassa kileso okāsaṃ na labhati, navakammavasena vikkhambhitova hoti.
For some, as mentioned, defilements find no opportunity to arise when they perform new construction work; they remain suppressed by means of new construction work.
Đối với một số người khác, theo cách đã nói, khi thực hiện công việc xây dựng mới (navakamma), phiền não không có cơ hội phát sinh, chúng bị loại trừ nhờ công việc xây dựng mới.
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti cittalapabbate tissatthero viya.
Such a person, having kept those defilements thus suppressed, turns them around and attains Arahantship, like Tissa Thera of Cittalapabbata.
Vị ấy đã loại trừ chúng như vậy, rồi xoay chuyển (tâm) và chứng đắc A-la-hán, như Trưởng lão Tissa ở Cittalapabbata.
Tassa kira aṭṭhavassikakāle anabhirati uppajji, so taṃ vinodetuṃ asakkonto attano cīvaraṃ dhovitvā rajitvā pattaṃ pacitvā kese ohāretvā upajjhāyaṃ vanditvā aṭṭhāsi.
It is said that when he was eight years old, disinterest arose in him. Unable to dispel it, he washed and dyed his robes, prepared his bowl, shaved his head, paid homage to his preceptor, and stood.
Nghe nói, khi ngài được tám tuổi hạ, sự bất mãn đã phát sinh. Không thể xua tan nó, ngài đã giặt và nhuộm y của mình, nấu bát, cạo tóc, đảnh lễ bổn sư và đứng đó.
Atha naṃ thero āha – ‘‘kiṃ, āvuso mahātissa, atuṭṭhassa viya te ākāro’’ti?
Then the Thera asked him, "Tissa, friend, you look as if you are discontented?"
Rồi vị Trưởng lão (bổn sư) hỏi ngài: “Này hiền giả Mahātissa, con có vẻ không hài lòng phải không?”
Āma, bhante, anabhirati me uppannā, taṃ vinodetuṃ na sakkomīti.
"Yes, Venerable Sir, disinterest has arisen in me, and I cannot dispel it."
“Bạch Thế Tôn, vâng, sự bất mãn đã phát sinh trong con, con không thể xua tan nó.”
Thero tassāsayaṃ olokento arahattassa upanissayaṃ disvā anukampāvasena āha – ‘‘āvuso tissa, mayaṃ mahallakā, ekaṃ no vasanaṭṭhānaṃ karohī’’ti.
The Thera, looking into his intention, saw his supporting condition for Arahantship and, out of compassion, said, "Tissa, friend, we are old; please build us a dwelling place."
Vị Trưởng lão (bổn sư), nhìn thấu tâm ý của ngài và thấy được nhân duyên chứng A-la-hán, đã nói với lòng từ bi: “Này hiền giả Tissa, chúng ta đã già rồi, con hãy xây cho chúng ta một chỗ ở.”
Dutiyakathaṃ akathitapubbo bhikkhu ‘‘sādhu, bhante’’ti sampaṭicchi.
The bhikkhu, who had never before spoken a second word, accepted, saying, "Yes, Venerable Sir."
Vị Tỳ-kheo chưa từng nói lời thứ hai đã đáp: “Vâng, bạch Thế Tôn.”
Atha naṃ thero āha – ‘‘āvuso, navakammaṃ karonto uddesamaggañca mā vissajji, kammaṭṭhānañca manasi karohi, kālena ca kālaṃ kasiṇaparikammaṃ karohī’’ti.
Then the elder said to him, "Friend, while engaged in new construction, do not abandon the path of recitation, attend to your meditation subject, and from time to time perform kasiṇa meditation."
Sau đó, vị Trưởng lão nói với Tỳ-kheo ấy: “Này Hiền giả, khi làm công việc xây cất mới, chớ bỏ quên con đường học tập (uddesamagga), hãy chú tâm vào đề mục thiền quán (kammaṭṭhāna), và hãy thực hành sơ công (parikamma) kasiṇa đúng lúc.”
‘‘Evaṃ karissāmi, bhante’’ti theraṃ vanditvā tathārūpaṃ sappāyaṭṭhānaṃ oloketvā ‘‘ettha kātuṃ sakkā’’ti dārūhi pūretvā jhāpetvā sodhetvā iṭṭhakāhi parikkhipitvā dvāravātapānādīni yojetvā saddhiṃ caṅkamanabhūmibhittiparikammādīhi leṇaṃ niṭṭhāpetvā mañcapīṭhaṃ santharitvā therassa santikaṃ gantvā vanditvā, ‘‘bhante, niṭṭhitaṃ leṇe parikammaṃ, vasathā’’ti āha.
"Yes, venerable sir, I will do so," he said, and having paid homage to the elder, he sought out a suitable place. Concluding that "it is possible to build here," he filled it with wood, burned it, cleaned it, surrounded it with bricks, constructed doors, windows, and other fittings. He completed the cave, along with a walking meditation path and wall finishes. Having arranged a couch and a chair, he went to the elder, paid homage, and said, "Venerable sir, the work in the cave is finished; please reside here."
Vị ấy thưa: “Bạch Ngài, con sẽ làm như vậy.” Sau khi đảnh lễ vị Trưởng lão, Tỳ-kheo ấy tìm một nơi thích hợp, nghĩ rằng: “Ở đây có thể làm được,” rồi chất đầy củi đốt, dọn dẹp sạch sẽ, xây gạch bao quanh, lắp đặt cửa ra vào, cửa sổ, v.v., hoàn thành hang động cùng với việc làm nền đường kinh hành và tường vách, trải giường ghế, rồi đến chỗ vị Trưởng lão đảnh lễ và thưa: “Bạch Ngài, công việc trong hang động đã hoàn tất, xin Ngài an cư.”
Āvuso, dukkhena tayā etaṃ kammaṃ kataṃ, ajja ekadivasaṃ tvaññevettha vasāhīti.
"Friend, you have accomplished this task with difficulty. Today, for one day, you yourself should reside here."
Vị Trưởng lão nói: “Này Hiền giả, con đã làm công việc này rất vất vả. Hôm nay, một ngày này, chính con hãy ở đó đi.”
So ‘‘sādhu, bhante’’ti vanditvā pāde dhovitvā leṇaṃ pavisitvā pallaṅkaṃ ābhujitvā nisinno attanā katakammaṃ āvajji.
He said, "Very well, venerable sir," and having paid homage, washed his feet, entered the cave, sat down cross-legged, and reflected on the work he had done.
Vị ấy thưa: “Bạch Ngài, lành thay,” rồi đảnh lễ, rửa chân, vào hang động, ngồi kiết già và quán xét công việc mình đã làm.
Tassa ‘‘manāpaṃ mayā upajjhāyassa kāyaveyyāvaccaṃ kata’’nti cintentassa abbhantare pīti uppannā.
As he thought, "I have performed pleasing bodily service for my preceptor," delight arose within him.
Khi vị ấy suy nghĩ: “Ta đã làm công việc phụng sự thân của vị Upajjhāya một cách vừa ý,” thì niềm hỷ lạc phát sinh trong tâm vị ấy.
So taṃ vikkhambhetvā vipassanaṃ paṭṭhapetvā aggaphalaṃ arahattaṃ pāpuṇi.
He then suppressed that*, established vipassanā, and attained arahatta, the highest fruit.
Vị ấy trấn áp niềm hỷ lạc đó, bắt đầu thiền quán Vipassanā và đạt đến quả tối thượng là A-la-hán.
Evarūpassa navakammavasena vikkhambhito kileso tathā vikkhambhitova hoti.
In such a person, defilements suppressed by means of new construction remain suppressed as such.
Đối với người như vậy, phiền não đã bị trấn áp nhờ công việc xây cất mới thì vẫn cứ bị trấn áp như vậy.
Ekacco pana brahmalokato āgato suddhasatto hoti.
Another, however, may be a pure being descended from the Brahma-world.
Lại có một số người là chúng sinh thanh tịnh từ cõi Phạm thiên xuống.
Tassa anāsevanatāya kileso na samudācarati, bhavavasena vikkhambhito hoti.
For him, defilements do not arise through non-cultivation; they are suppressed due to his former existence.
Đối với người ấy, phiền não không khởi lên do không có sự tích tập, chúng bị trấn áp bởi nghiệp lực của đời sống (bhava).
So taṃ tathā vikkhambhitameva katvā vivaṭṭetvā arahattaṃ gaṇhāti āyasmā mahākassapo viya.
He, like Venerable Mahākassapa, makes them remain suppressed as such and, turning away*, attains arahatta.
Vị ấy làm cho phiền não bị trấn áp như vậy, rồi chuyển hóa và đạt được quả A-la-hán, như Tôn giả Mahākassapa.
So hi āyasmā agāramajjhepi kāme aparibhuñjitvā mahāsampattiṃ pahāya pabbajitvā nikkhanto antarāmagge paccuggamanatthāya āgataṃ satthāraṃ disvā vanditvā tīhi ovādehi upasampadaṃ labhitvā aṭṭhame aruṇe saha paṭisambhidāhi arahattaṃ pāpuṇi.
Indeed, that Venerable One, even while living in a household, did not indulge in sensual pleasures. Giving up great wealth, he went forth into homelessness. On the way, he saw the Teacher who had come to meet him, paid homage, received higher ordination through three admonitions, and on the eighth dawn, attained arahatta together with the paṭisambhidās.
Tôn giả ấy, dù sống giữa gia đình, không thụ hưởng dục lạc, từ bỏ tài sản lớn lao, xuất gia, khi đi trên đường gặp Đức Thế Tôn đến để nghênh đón, liền đảnh lễ và nhận giới Tỳ-kheo với ba lời giáo huấn, rồi vào buổi bình minh thứ tám, Ngài đạt được quả A-la-hán cùng với các Tuệ phân tích (Paṭisambhidā).
Evarūpassa bhavavasena vikkhambhito kileso tathā vikkhambhitova hoti.
For such a person, defilements suppressed due to existence remain suppressed as such.
Đối với người như vậy, phiền não đã bị trấn áp bởi nghiệp lực của đời sống thì vẫn cứ bị trấn áp như vậy.
Uppanno vā kāmacchando pahīyatīti ettha uppannoti jāto bhūto samudāgato.
In the phrase, "or if sensual desire has arisen, it is abandoned," "arisen" means born, come into being, come forth.
Trong câu “Hoặc dục tham đã sanh được đoạn trừ,” thì từ “san sanh” có nghĩa là đã phát sinh, đã hiện hữu, đã khởi lên.
Pahīyatīti tadaṅgappahānaṃ, vikkhambhanappahānaṃ, samucchedappahānaṃ, paṭipassaddhippahānaṃ, nissaraṇappahānanti imehi pañcahi pahānehi pahīyati, na puna uppajjatīti attho.
"Abandoned" means it is abandoned by these five kinds of abandonment: abandonment by substitution of opposites (tadaṅgappahāna), abandonment by suppression (vikkhambhanappahāna), abandonment by eradication (samucchedappahāna), abandonment by tranquilisation (paṭipassaddhippahāna), and abandonment by escape (nissaraṇappahāna). The meaning is that it does not arise again.
“Được đoạn trừ” có nghĩa là được đoạn trừ bằng năm loại đoạn trừ này: Tadaṅgappahāna (đoạn trừ từng phần), Vikkhambhanappahāna (đoạn trừ bằng cách trấn áp), Samucchedappahāna (đoạn trừ tận gốc), Paṭipassaddhippahāna (đoạn trừ bằng cách an tịnh), và Nissaraṇappahāna (đoạn trừ bằng cách xuất ly), tức là không phát sinh trở lại.
Tattha vipassanāya kilesā tadaṅgavasena pahīyantīti vipassanā tadaṅgappahānanti veditabbā.
Among these, defilements are abandoned by vipassanā by way of substitution of opposites; therefore, vipassanā should be understood as abandonment by substitution of opposites.
Trong đó, phiền não được đoạn trừ từng phần bằng Vipassanā, nên Vipassanā được xem là Tadaṅgappahāna.
Samāpatti pana kilese vikkhambhetīti sā vikkhambhanappahānanti veditabbā.
Samāpatti, however, suppresses defilements; therefore, it should be understood as abandonment by suppression.
Còn Samāpatti (thiền định) trấn áp phiền não, nên nó được xem là Vikkhambhanappahāna.
Maggo samucchindanto uppajjati, phalaṃ paṭippassambhayamānaṃ, nibbānaṃ sabbakilesehi nissaṭanti imāni tīṇi samucchedapaṭipassaddhinissaraṇappahānānīti vuccanti.
The Path arises eradicating*, the Fruit tranquilising*, and Nibbāna is the escape from all defilements. These three are called abandonment by eradication, tranquilisation, and escape, respectively.
Đạo (Magga) phát sinh để đoạn trừ tận gốc, Quả (Phala) phát sinh để an tịnh, và Nibbāna là sự xuất ly khỏi tất cả phiền não, ba điều này được gọi là Samucchedappahāna, Paṭipassaddhippahāna, Nissaraṇappahāna.
Imehi lokiyalokuttarehi pañcahi pahānehi pahīyatīti attho.
The meaning is that it is abandoned by these five kinds of mundane and supramundane abandonment.
Ý nghĩa là được đoạn trừ bằng năm loại đoạn trừ thuộc thế gian và siêu thế này.
Asubhanimittanti dasasu asubhesu uppannaṃ sārammaṇaṃ paṭhamajjhānaṃ.
"Asubhanimitta" refers to the first jhāna, with a meditative object, arisen from the ten asubhas.
Asubhanimitta (tướng bất tịnh) là thiền định bậc nhất (paṭhamajjhāna) phát sinh trong mười tướng bất tịnh, có đối tượng là sắc.
Tenāhu porāṇā – ‘‘asubhampi asubhanimittaṃ, asubhārammaṇā dhammāpi asubhanimitta’’nti.
Therefore, the ancients said, "Asubha itself is an asubhanimitta; the phenomena with asubha as their object are also asubhanimitta."
Vì thế, các bậc cổ đức đã nói: “Bất tịnh cũng là tướng bất tịnh, các pháp có đối tượng là bất tịnh cũng là tướng bất tịnh.”
Yonisomanasikarototi.
"By applying wise attention":
Yonisomanasikaroto (tác ý chân chánh):
‘‘Tattha katamo yonisomanasikāro?
"What is wise attention here?
“Trong đó, thế nào là tác ý chân chánh?
Anicce anicca’’ntiādinā nayena vuttassa upāyamanasikārassa vasena manasikaroto.
By attending with the proper mode of attention as stated in the manner of 'impermanent in the impermanent' and so on."
Là tác ý theo cách thức đã nói, như ‘vô thường là vô thường,’ v.v., tức là tác ý bằng sự khéo léo.”
Anuppanno ceva kāmacchando nuppajjatīti asamudāgato na samudāgacchati.
"Unarisen sensual desire does not arise" means that sensual desire which has not come forth does not come forth.
“Dục tham chưa sanh không sanh” có nghĩa là dục tham chưa khởi lên thì không khởi lên.
Uppanno ca kāmacchando pahīyatīti samudāgato ca kāmacchando pañcavidhena pahānena pahīyati.
"And arisen sensual desire is abandoned" means that sensual desire which has come forth is abandoned by the five kinds of abandonment.
“Dục tham đã sanh được đoạn trừ” có nghĩa là dục tham đã khởi lên được đoạn trừ bằng năm loại đoạn trừ.
Apica cha dhammā kāmacchandassa pahānāya saṃvattanti – asubhanimittassa uggaho, asubhabhāvanānuyogo, indriyesu guttadvāratā, bhojane mattaññutā, kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandonment of sensual desire: the apprehension of an asubha sign, diligence in asubha meditation, guarding the sense doors, moderation in food, good friendship, and suitable conversation.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ dục tham: nắm giữ tướng bất tịnh (asubhanimitta), chuyên cần tu tập bất tịnh quán (asubhabhāvanānuyoga), giữ gìn các căn (indriyesu guttadvāratā), biết đủ trong ăn uống (bhojane mattaññutā), có bạn lành (kalyāṇamittatā), và nói chuyện thích hợp (sappāyakathā).
Dasavidhañhi asubhanimittaṃ uggaṇhantassāpi kāmacchando pahīyati, bhāventassāpi, indriyesu pihitadvārassāpi, catunnaṃ pañcannaṃ ālopānaṃ okāse sati udakaṃ pivitvā yāpanasīlatāya bhojane mattaññunopi.
Indeed, sensual desire is abandoned even for one who apprehends a ten-fold asubha sign, and for one who cultivates asubha, and for one who has guarded sense doors, and for one who is moderate in food, in that he has the practice of sustaining himself by drinking water when there is occasion for four or five mouthfuls of food.
Thật vậy, dục tham được đoạn trừ đối với người nắm giữ tướng bất tịnh mười loại, đối với người tu tập bất tịnh quán, đối với người giữ gìn các căn, và đối với người biết đủ trong ăn uống bằng cách uống nước để duy trì sự sống khi chỉ còn bốn hoặc năm miếng cơm.
Tenetaṃ vuttaṃ –
Therefore, it was said:
Vì thế, điều này đã được nói:
17. Sattame mettā cetovimuttīti sabbasattesu hitapharaṇakā mettā.
17. In the seventh, "mettā cetovimuttī" is mettā that pervades all beings with benevolence.
17. Trong thứ bảy, Mettā cetovimutti (Tâm giải thoát từ bi) là tâm từ trải rộng lợi ích đến tất cả chúng sinh.
Yasmā pana taṃsampayuttacittaṃ nīvaraṇādīhi paccanīkadhammehi vimuccati, tasmā sā ‘‘cetovimuttī’’ti vuccati.
However, because the mind associated with it is liberated from hindrances and other opposing states, it is called "cetovimutti."
Vì tâm tương ưng với tâm từ ấy được giải thoát khỏi các pháp đối nghịch như năm triền cái (nīvaraṇa), v.v., nên nó được gọi là “cetovimutti.”
Visesato vā sabbabyāpādapariyuṭṭhānena vimuttattā sā cetovimuttīti veditabbā.
Or, specifically, because it is liberated from the uprising of all ill-will, it should be understood as cetovimutti.
Hoặc đặc biệt hơn, vì được giải thoát khỏi tất cả sự chi phối của sân hận (byāpāda), nên nó được xem là cetovimutti.
Tattha ‘‘mettā’’ti ettāvatā pubbabhāgopi vaṭṭati, ‘‘cetovimuttī’’ti vuttattā pana idha tikacatukkajjhānavasena appanāva adhippetā.
Here, the mere mention of "mettā" would suffice for the preparatory stage, but because "cetovimuttī" is stated, here the absorption (appanā) by way of the triadic or tetradic jhānas is intended.
Trong đó, chỉ riêng từ “mettā” cũng có thể chỉ giai đoạn chuẩn bị (pubbabhāga), nhưng vì đã nói “cetovimutti” nên ở đây ý muốn nói đến sự an chỉ (appanā) theo các thiền tam và tứ.
Yonisomanasikarototi taṃ mettaṃ cetovimuttiṃ vuttalakkhaṇena upāyamanasikārena manasikarontassa.
"By applying wise attention" means for one who attends to that mettā cetovimutti with the mode of wise attention as previously described.
Yonisomanasikaroto có nghĩa là người tác ý tâm giải thoát từ bi ấy với sự tác ý chân chánh theo đặc tính đã nói.
Apica cha dhammā byāpādassa pahānāya saṃvattanti – mettānimittassa uggaho, mettābhāvanānuyogo, kammassakatāpaccavekkhaṇā, paṭisaṅkhānabahulatā, kalyāṇamittatā, sappāyakathāti.
Furthermore, six things lead to the abandonment of ill-will: the apprehension of the mettā sign, diligence in mettā meditation, reflection on kamma as one's own, frequent recollection of the disadvantages*, good friendship, and suitable conversation.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ sân hận (byāpāda): nắm giữ tướng tâm từ (mettānimitta), chuyên cần tu tập tâm từ (mettābhāvanānuyoga), quán xét nghiệp của chính mình (kammassakatāpaccavekkhaṇā), thường xuyên quán xét (paṭisaṅkhānabahulatā), có bạn lành (kalyāṇamittatā), và nói chuyện thích hợp (sappāyakathā).
Odissakaanodissakadisāpharaṇānañhi aññataravasena mettaṃ uggaṇhantassāpi byāpādo pahīyati, odhiso anodhiso disāpharaṇavasena mettaṃ bhāventassāpi.
Indeed, ill-will is abandoned even for one who apprehends mettā by way of pervading specific or non-specific directions, and for one who cultivates mettā by way of pervasive and non-pervasive directions.
Thật vậy, sân hận được đoạn trừ đối với người nắm giữ tâm từ theo một trong các cách trải rộng đến chúng sinh có giới hạn hoặc không giới hạn, và đối với người tu tập tâm từ theo cách trải rộng đến các phương hướng có giới hạn hoặc không giới hạn.
‘‘Tvaṃ etassa kuddho kiṃ karissasi, kimassa sīlādīni nāsetuṃ sakkhissasi, nanu tvaṃ attano kammena āgantvā attano kammeneva gamissasi?
"What will you do by being angry with him? Will you be able to destroy his virtue or other good qualities? Surely you have come by your own kamma and will depart by your own kamma?
“Ngươi nổi giận với người này sẽ làm gì? Ngươi có thể hủy hoại giới hạnh, v.v., của người ấy không? Chẳng phải ngươi đến bằng nghiệp của chính mình và sẽ đi bằng nghiệp của chính mình sao?
Parassa kujjhanaṃ nāma vītaccitaṅgāratattaayasalākagūthādīni gahetvā paraṃ paharitukāmatāsadisaṃ hoti.
To be angry with another is like wanting to strike another with fiery embers, a heated iron spit, or excrement.
Nổi giận với người khác giống như việc cầm than hồng cháy, thanh sắt nung đỏ, phân, v.v., để đánh người khác.
Esopi tava kuddho kiṃ karissati, kiṃ te sīlādīni nāsetuṃ sakkhissati?
What will this person do by being angry with you? Will he be able to destroy your virtue or other good qualities?
Người ấy nổi giận với ngươi sẽ làm gì? Người ấy có thể hủy hoại giới hạnh, v.v., của ngươi không?
Esa attano kammena āgantvā attano kammeneva gamissati, appaṭicchitapaheṇakaṃ viya paṭivātaṃ khittarajomuṭṭhi viya ca etassevesa kodho matthake patissatī’’ti evaṃ attano ca parassa ca kammassakataṃ paccavekkhatopi, ubhayakammassakataṃ paccavekkhitvā paṭisaṅkhāne ṭhitassāpi, assaguttattherasadise mettābhāvanārate kalyāṇamitte sevantassāpi byāpādo pahīyati, ṭhānanisajjādīsu mettānissitasappāyakathāyapi pahīyati.
“This person, having come by his own kamma, will go by his own kamma. Just as an unaccepted gift or a handful of dust thrown against the wind, this very anger will fall upon his own head.” Thus, for one who reflects on their own and others’ ownership of kamma, or for one who, having reflected on the ownership of kamma by both, remains in contemplation, or for one who associates with good friends like Assagutta Thera, who delight in the development of mettā, ill-will is abandoned. It is also abandoned through appropriate discussions imbued with mettā during standing, sitting, and other postures.
Người ấy đến bằng nghiệp của chính mình và sẽ đi bằng chính nghiệp của mình, giống như món quà không được chấp nhận, và giống như nắm bụi ném ngược gió, cơn giận này sẽ rơi xuống đầu chính người ấy.” Cơn sân hận được loại bỏ ngay cả khi người ấy quán xét về nghiệp của mình và của người khác, hoặc khi người ấy đã quán xét về nghiệp của cả hai và an trú trong sự quán xét đó, hoặc khi người ấy phục vụ những thiện hữu như Trưởng lão Assagutta, những người hoan hỷ trong sự tu tập tâm từ, và nó cũng được loại bỏ qua những lời nói thích hợp về tâm từ trong các tư thế đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā byāpādassa pahānāya saṃvattantī’’ti.
Therefore, it has been said: “Six qualities conduce to the abandoning of ill-will.”
Vì vậy, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ sân hận.”
Sesamidha ito paresu ca vuttanayeneva veditabbaṃ, visesamattameva pana vakkhāmāti.
The rest here should be understood in the same way as stated in these and other suttas, but we shall only explain the distinctions.
Phần còn lại ở đây và trong các bài kinh khác nên được hiểu theo cách đã nói, chúng tôi sẽ chỉ nói về những điểm đặc biệt.
18. Aṭṭhame ārambhadhātūādīsu ārambhadhātu nāma paṭhamārambhavīriyaṃ.
18. In the eighth discourse, regarding ārambhadhātu and so on, ārambhadhātu means the initial effort (vīriya) of beginning.
18. Trong bài kinh thứ tám, trong các thuật ngữ như ārambhadhātu, ārambhadhātu có nghĩa là tinh tấn khởi đầu tiên.
Nikkamadhātu nāma kosajjato nikkhantattā tato balavataraṃ.
Nikkamadhātu means a more strenuous effort (vīriya) than that, because it has emerged from idleness.
Nikkamadhātu có nghĩa là mạnh mẽ hơn điều đó, vì nó đã thoát khỏi sự lười biếng.
Parakkamadhātu nāma paraṃ paraṃ ṭhānaṃ akkamanato tatopi balavataraṃ.
Parakkamadhātu means an even more strenuous effort (vīriya) than that, because it steps over each successive obstacle.
Parakkamadhātu có nghĩa là mạnh mẽ hơn điều đó, vì nó vượt qua từng giai đoạn.
Aṭṭhakathāyaṃ pana ‘‘ārambho cetaso kāmānaṃ panūdanāya, nikkamo cetaso palighugghāṭanāya, parakkamo cetaso bandhanacchedanāyā’’ti vatvā ‘‘tīhi petehi adhimattavīriyameva kathita’’nti vuttaṃ.
However, in the Commentary, it is said, “ārambha (initial effort) is for the mind's dispelling of sensual desires, nikkama (sustained effort) is for the mind's lifting of the crossbar (of ignorance), parakkama (arduous effort) is for the mind's cutting of fetters,” and then it is stated, “by these three, only intense effort (adhimattavīriya) is taught.”
Tuy nhiên, trong Chú Giải, sau khi nói: “Sự khởi đầu là sự loại bỏ các dục vọng khỏi tâm; sự thoát ly là sự phá vỡ chốt cửa của tâm; sự tinh tấn là sự cắt đứt các ràng buộc của tâm,” thì đã nói: “Với ba điều này, chỉ có sự tinh tấn mãnh liệt được nói đến.”
Āraddhavīriyassāti paripuṇṇavīriyassa ceva paggahitavīriyassa ca.
Āraddhavīriyassa means for one whose effort is complete and whose effort is aroused.
Āraddhavīriyassa có nghĩa là người có tinh tấn viên mãn và tinh tấn được thúc đẩy.
Tattha catudosāpagataṃ vīriyaṃ āraddhanti veditabbaṃ.
Here, effort (vīriya) free from four faults should be understood as aroused.
Trong đó, tinh tấn không có bốn lỗi được hiểu là āraddha (được thúc đẩy).
Na ca atilīnaṃ hoti, na ca atipaggahitaṃ, na ca ajjhattaṃ saṃkhittaṃ, na ca bahiddhā vikkhittaṃ.
It is neither too slack nor too strained, neither inwardly constricted nor outwardly dispersed.
Nó không quá chùng, không quá căng, không thu hẹp bên trong, và không phân tán ra bên ngoài.
Tadetaṃ duvidhaṃ hoti – kāyikaṃ, cetasikañca.
This effort is of two kinds: physical and mental.
Tinh tấn này có hai loại: thân hành và tâm hành.
Tattha ‘‘idha bhikkhu divasaṃ caṅkamena nisajjāya āvaraṇīyehi dhammehi cittaṃ parisodhetī’’ti (vibha. 519) evaṃ rattidivasassa pañca koṭṭhāse kāyena ghaṭentassa vāyamantassa kāyikavīriyaṃ veditabbaṃ.
Here, the physical effort (kāyikavīriya) of a bhikkhu is to be understood as one who, striving and exerting with his body, cleanses his mind of obstructive states during five divisions of the night and day, as it is said: "Here, a bhikkhu purifies his mind from obstructive states by walking and sitting during the day."
Trong đó, kāyikavīriyaṃ (tinh tấn thân hành) nên được hiểu là sự nỗ lực của một tỳ-khưu, người thanh lọc tâm khỏi các pháp chướng ngại bằng cách đi kinh hành và ngồi trong năm phần của ngày và đêm, như đã nói: “Ở đây, này các tỳ-khưu, tỳ-khưu thanh lọc tâm khỏi các pháp chướng ngại bằng cách đi kinh hành và ngồi trong ngày.”
‘‘Na tāvāhaṃ ito leṇā nikkhamissāmi, yāva me na anupādāya āsavehi cittaṃ vimuccatī’’ti evaṃ okāsaparicchedena vā, ‘‘na tāvāhaṃ imaṃ pallaṅkaṃ bhindissāmī’’ti evaṃ nisajjādiparicchedena vā mānasaṃ bandhitvā ghaṭentassa vāyamantassa cetasikavīriyaṃ veditabbaṃ.
The mental effort (cetasikavīriya) is to be understood as that of one who, binding his mind with a resolution, striving and exerting, either by delimiting space, saying, "I will not leave this cave until my mind is liberated from the taints without clinging," or by delimiting postures like sitting, saying, "I will not break this cross-legged posture."
Cetasikavīriyaṃ (tinh tấn tâm hành) nên được hiểu là sự nỗ lực của một người, người đã ràng buộc tâm bằng cách giới hạn không gian, như: “Tôi sẽ không rời khỏi hang động này cho đến khi tâm tôi được giải thoát khỏi các lậu hoặc mà không chấp thủ,” hoặc bằng cách giới hạn tư thế ngồi, như: “Tôi sẽ không phá vỡ tư thế kiết già này.”
Tadubhayampi idha vaṭṭati.
Both are suitable here.
Cả hai loại này đều phù hợp ở đây.
Duvidhenāpi hi iminā vīriyena āraddhavīriyassa anuppannañceva thinamiddhaṃ nuppajjati, uppannañca thinamiddhaṃ pahīyati milakkhatissattherassa viya, gāmantapabbhāravāsimahāsīvattherassa viya, pītimallakattherassa viya, kuṭumbiyaputtatissattherassa viya ca.
Indeed, for one whose effort is aroused by both these kinds of effort, unarisen sloth and torpor do not arise, and arisen sloth and torpor are abandoned, just as in the cases of Malakatissa Thera, Gāmantapabbhāravāsī Mahāsīva Thera, Pītimallaka Thera, and Kuṭumbiyaputta Tissa Thera.
Thật vậy, với tinh tấn được thúc đẩy bởi cả hai loại tinh tấn này, sự hôn trầm, thụy miên chưa sinh sẽ không sinh, và sự hôn trầm, thụy miên đã sinh sẽ được loại bỏ, giống như Trưởng lão Milakkhatissa, giống như Trưởng lão Mahāsīva sống ở Gāmantapabbhāra, giống như Trưởng lão Pītimallaka, và giống như Trưởng lão Kuṭumbiyaputtatissa.
Etesu hi purimā tayo aññe ca evarūpā kāyikavīriyena āraddhavīriyā, kuṭumbiyaputtatissatthero aññe ca evarūpā cetasikavīriyena āraddhavīriyā, uccāvālukavāsī mahānāgatthero pana dvīhipi vīriyehi āraddhavīriyova.
Among these, the first three and others of their kind aroused their effort physically; Kuṭumbiyaputta Tissa Thera and others of his kind aroused their effort mentally; but Uccāvālukavāsī Mahānāga Thera aroused his effort by both kinds of effort.
Trong số đó, ba vị đầu tiên và những vị khác tương tự là những người có tinh tấn thân hành được thúc đẩy; Trưởng lão Kuṭumbiyaputtatissa và những vị khác tương tự là những người có tinh tấn tâm hành được thúc đẩy; còn Trưởng lão Mahānāga sống ở Uccāvāluka thì có tinh tấn được thúc đẩy bởi cả hai loại.
Thero kira ekaṃ sattāhaṃ caṅkamati, ekaṃ tiṭṭhati, ekaṃ nisīdati, ekaṃ nipajjati.
It is said that the elder would walk for one week, stand for one week, sit for one week, and lie down for one week.
Nghe nói rằng, vị Trưởng lão ấy đi kinh hành một tuần, đứng một tuần, ngồi một tuần, nằm một tuần.
Mahātherassa ekairiyāpathopi asappāyo nāma natthi, catutthe sattāhe vipassanaṃ vaḍḍhetvā arahatte patiṭṭhāsi.
No single posture was unsuitable for the great elder; in the fourth week, he developed vipassanā and became established in Arahantship.
Không có tư thế nào không thích hợp với Đại Trưởng lão; trong tuần thứ tư, ngài đã phát triển thiền quán và an trú trong A-la-hán quả.
Apica cha dhammā thinamiddhassa pahānāya saṃvattanti – atibhojane nimittaggāho, iriyāpathasamparivattanatā, ālokasaññāmanasikāro, abbhokāsavāso, kalyāṇamittatā, sappāyakathāti.
Furthermore, six qualities conduce to the abandoning of sloth and torpor: taking a sign (nimitta) in overeating, changing postures, attending to the perception of light, dwelling in the open air, having good friends, and appropriate discussion.
Hơn nữa, sáu pháp dẫn đến sự đoạn trừ thinamiddha (hôn trầm, thụy miên): sự nắm bắt dấu hiệu trong việc ăn uống quá độ, sự thay đổi oai nghi, sự tác ý về tưởng ánh sáng, sự sống ở nơi trống trải, có thiện hữu, và lời nói thích hợp.
Āharahatthaka-bhuttavamitaka-tatravaṭṭaka-alaṃsāṭaka-kākamāsaka-brāhmaṇādayo viya bhojanaṃ bhuñjitvā rattiṭṭhānadivāṭṭhāne nisinnassa hi samaṇadhammaṃ karoto thinamiddhaṃ mahāhatthī viya ottharantaṃ āgacchati, catupañcaālopaokāsaṃ pana ṭhapetvā pānīyaṃ pivitvā yāpanasīlassa bhikkhuno taṃ na hotīti evaṃ atibhojane nimittaṃ gaṇhantassāpi thinamiddhaṃ pahīyati.
Indeed, for one who eats a meal and then sits in a night or day dwelling place, performing the duties of a recluse, sloth and torpor come overwhelming him like a great elephant, as for the brahmins Āharahatthaka, Bhuttavamitaka, Tatravaṭṭaka, Alaṃsāṭaka, and Kākamāsaka. But for a bhikkhu who makes do by drinking water, leaving aside four or five mouthfuls of food, that does not occur. Thus, even for one who takes a sign in overeating, sloth and torpor are abandoned.
Thật vậy, khi một người ăn uống như những Bà-la-môn Āharahatthaka, Bhuttavamitaka, Tatravaṭṭaka, Alaṃsāṭaka, Kākamāsaka, v.v., rồi ngồi ở nơi nghỉ đêm hoặc nơi nghỉ ngày để thực hành pháp Sa-môn, hôn trầm, thụy miên sẽ đến bao trùm như một con voi lớn; nhưng đối với một tỳ-khưu có thói quen chỉ ăn bốn, năm miếng cơm và uống nước để duy trì sự sống, điều đó sẽ không xảy ra. Vì vậy, hôn trầm, thụy miên được loại bỏ ngay cả khi người ấy nắm bắt dấu hiệu trong việc ăn uống quá độ.
Yasmiṃ iriyāpathe thinamiddhaṃ okkamati, tato aññaṃ parivattentassāpi, rattiṃ candālokadīpālokaukkāloke divā sūriyālokaṃ manasikarontassāpi, abbhokāse vasantassāpi, mahākassapattherasadise pahīnathinamiddhe kalyāṇamitte sevantassāpi thinamiddhaṃ pahīyati, ṭhānanisajjādīsu dhutaṅganissitasappāyakathāyapi pahīyati.
Even for one who changes from the posture in which sloth and torpor arise, or for one who attends to the light of the moon, lamp, or stars at night, and the light of the sun by day, or for one who dwells in the open air, or for one who associates with good friends like Mahākassapa Thera, who have abandoned sloth and torpor, sloth and torpor are abandoned. It is also abandoned through appropriate discussions based on dhutaṅga practices during standing, sitting, and other postures.
Hôn trầm, thụy miên cũng được loại bỏ khi người ấy thay đổi oai nghi mà hôn trầm, thụy miên xuất hiện, hoặc khi người ấy tác ý đến ánh sáng mặt trăng, ánh sáng đèn, ánh sáng sao vào ban đêm, và ánh sáng mặt trời vào ban ngày, hoặc khi người ấy sống ở nơi trống trải, hoặc khi người ấy phục vụ những thiện hữu như Trưởng lão Mahākassapa, những người đã đoạn trừ hôn trầm, thụy miên, và nó cũng được loại bỏ qua những lời nói thích hợp liên quan đến hạnh đầu đà trong các tư thế đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā thinamiddhassa pahānāya saṃvattantī’’ti.
Therefore, it has been said: “Six qualities conduce to the abandoning of sloth and torpor.”
Vì vậy, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ hôn trầm, thụy miên.”
Apica cha dhammā uddhaccakukkuccassa pahānāya saṃvattanti – bahussutatā, paripucchakatā, vinaye pakataññutā, vuddhasevitā, kalyāṇamittatā, sappāyakathāti.
Furthermore, six qualities conduce to the abandoning of restlessness and remorse: extensive learning, being questioning, familiarity with the Vinaya, association with elders, having good friends, and appropriate discussion.
Hơn nữa, sáu pháp dẫn đến sự đoạn trừ uddhaccakukkucca (trạo cử, hối hận): sự đa văn, sự hay hỏi, sự thông thạo về giới luật, sự phụng sự các bậc trưởng thượng, có thiện hữu, và lời nói thích hợp.
Bāhusaccenāpi hi ekaṃ vā dve vā tayo vā cattāro vā pañca vā nikāye pāḷivasena ca atthavasena ca uggaṇhantassāpi uddhaccakukkuccaṃ pahīyati, kappiyākappiyaparipucchābahulassāpi, vinayapaññattiyaṃ ciṇṇavasībhāvatāya pakataññunopi, vuḍḍhe mahallakatthere upasaṅkamantassāpi, upālittherasadise vinayadhare kalyāṇamitte sevantassāpi uddhaccakukkuccaṃ pahīyati, ṭhānanisajjādīsu kappiyākappiyanissitasappāyakathāyapi pahīyati.
Indeed, by extensive learning, even for one who masters one, two, three, four, or five Nikāyas by way of both the Pāḷi text and its meaning, restlessness and remorse are abandoned. It is also abandoned for one who frequently asks about what is allowable and unallowable, or for one who is skilled through habitual practice in the Vinaya ordinances, or for one who approaches elderly elders, or for one who associates with good friends who are Vinaya holders like Upāli Thera. It is also abandoned through appropriate discussions based on what is allowable and unallowable during standing, sitting, and other postures.
Thật vậy, trạo cử, hối hận được loại bỏ ngay cả khi người ấy đa văn, học thuộc lòng một, hai, ba, bốn hoặc năm bộ Nikāya cả về văn bản và ý nghĩa; ngay cả khi người ấy thường xuyên hỏi về những điều hợp pháp và không hợp pháp; ngay cả khi người ấy thông thạo các giới luật do đã thực hành thành thục; ngay cả khi người ấy đến gần các vị trưởng lão; ngay cả khi người ấy phục vụ những thiện hữu giữ giới luật như Trưởng lão Upāli; và nó cũng được loại bỏ qua những lời nói thích hợp liên quan đến điều hợp pháp và không hợp pháp trong các tư thế đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā uddhaccakukkuccassa pahānāya saṃvattantī’’ti.
Therefore, it has been said: “Six qualities conduce to the abandoning of restlessness and remorse.”
Vì vậy, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ trạo cử, hối hận.”
Apica cha dhammā vicikicchāya pahānāya saṃvattanti – bahussutatā, paripucchakatā, vinaye pakataññutā, adhimokkhabahulatā, kalyāṇamittatā, sappāyakathāti.
Furthermore, six qualities conduce to the abandoning of doubt: extensive learning, being questioning, familiarity with the Vinaya, abundance of conviction, having good friends, and appropriate discussion.
Hơn nữa, sáu pháp dẫn đến sự đoạn trừ vicikicchā (hoài nghi): sự đa văn, sự hay hỏi, sự thông thạo về giới luật, sự có nhiều thắng giải (adhimokkha), có thiện hữu, và lời nói thích hợp.
Bahusaccenāpi hi ekaṃ vā…pe… pañca vā nikāye pāḷivasena ca atthavasena ca uggaṇhantassāpi vicikicchā pahīyati, tīṇi ratanāni ārabbha paripucchābahulassāpi, vinaye ciṇṇavasībhāvassāpi, tīsu ratanesu okappaniyasaddhāsaṅkhātaadhimokkhabahulassāpi, saddhādhimutte vakkalittherasadise kalyāṇamitte sevantassāpi vicikicchā pahīyati, ṭhānanisajjādīsu tiṇṇaṃ ratanānaṃ guṇanissitasappāyakathāyapi pahīyati.
Indeed, by extensive learning, even for one who masters one... or five Nikāyas by way of both the Pāḷi text and its meaning, doubt is abandoned. It is also abandoned for one who frequently asks questions concerning the Three Jewels, or for one who has habitually practiced the Vinaya, or for one who has an abundance of conviction, meaning unwavering faith in the Three Jewels, or for one who associates with good friends devoted to faith, like Vakkali Thera. It is also abandoned through appropriate discussions based on the qualities of the Three Jewels during standing, sitting, and other postures.
Thật vậy, hoài nghi được loại bỏ ngay cả khi người ấy đa văn, học thuộc lòng một... hoặc năm bộ Nikāya cả về văn bản và ý nghĩa; ngay cả khi người ấy thường xuyên hỏi về Ba Ngôi Báu; ngay cả khi người ấy đã thực hành thành thục giới luật; ngay cả khi người ấy có nhiều thắng giải, tức là niềm tin kiên cố vào Ba Ngôi Báu; ngay cả khi người ấy phục vụ những thiện hữu có đức tin kiên cố như Trưởng lão Vakkali; và nó cũng được loại bỏ qua những lời nói thích hợp liên quan đến phẩm hạnh của Ba Ngôi Báu trong các tư thế đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā vicikicchāya pahānāya saṃvattantī’’ti.
Therefore, it has been said: “Six qualities conduce to the abandoning of doubt.”
Vì vậy, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ hoài nghi.”
Imasmiṃ nīvaraṇappahānavagge vaṭṭavivaṭṭaṃ kathitanti.
In this Nīvaraṇappahānavagga, both saṃsāra (vaṭṭa) and liberation from saṃsāra (vivaṭṭa) have been taught.
Trong phẩm đoạn trừ các triền cái này, vòng luân hồi (vaṭṭa) và sự thoát khỏi luân hồi (vivaṭṭa) đã được nói đến.
21-22. Tatiyassa paṭhame abhāvitanti avaḍḍhitaṃ bhāvanāvasena appavattitaṃ.
21-22. In the first of the third vagga, abhāvitaṃ means undeveloped, not proceeded with by way of cultivation.
21-22. Trong bài kinh đầu tiên của phẩm thứ ba, abhāvitaṃ có nghĩa là chưa được phát triển, chưa được thực hành theo cách tu tập.
Akammaniyaṃ hotīti kammakkhamaṃ kammayoggaṃ na hoti.
Akammaniyaṃ hoti means it is not fit for action, not suitable for work.
Akammaniyaṃ hotī có nghĩa là không thích hợp cho công việc, không đủ khả năng cho công việc.
Dutiye vuttavipariyāyena attho veditabbo.
In the second, the meaning should be understood in the reverse of what was stated.
Trong bài kinh thứ hai, ý nghĩa cần được hiểu theo cách ngược lại với những gì đã nói.
Ettha ca paṭhame cittanti vaṭṭavasena uppannacittaṃ, dutiye vivaṭṭavasena uppannacittaṃ.
Furthermore, in this (context), in the first, mind refers to the mind that arises due to the round (of existence), and in the second, to the mind that arises due to release (from the round).
Ở đây, trong bài kinh thứ nhất, tâm (citta) là tâm phát sinh theo vòng luân hồi (vaṭṭa); trong bài kinh thứ hai, là tâm phát sinh theo sự thoát ly luân hồi (vivaṭṭa).
Tattha ca vaṭṭaṃ vaṭṭapādaṃ, vivaṭṭaṃ vivaṭṭapādanti ayaṃ pabhedo veditabbo.
In that (context), the distinction between vaṭṭa (the round of existence), vaṭṭapāda (the cause of the round), vivaṭṭa (release from the round), and vivaṭṭapāda (the cause of release) should be understood.
Ở đó, vaṭṭa (luân hồi) là căn bản của luân hồi (vaṭṭapāda), vivaṭṭa (thoát ly luân hồi) là căn bản của sự thoát ly luân hồi (vivaṭṭapāda) – sự phân biệt này cần được hiểu.
Vaṭṭaṃ nāma tebhūmakavaṭṭaṃ, vaṭṭapādaṃ nāma vaṭṭapaṭilābhāya kammaṃ, vivaṭṭaṃ nāma nava lokuttaradhammā, vivaṭṭapādaṃ nāma vivaṭṭapaṭilābhāya kammaṃ.
Vaṭṭa means the round of existence in the three realms; vaṭṭapāda means the kamma that leads to the attainment of the round; vivaṭṭa means the nine lokuttara dhammas (supramundane states); vivaṭṭapāda means the kamma that leads to the attainment of release from the round.
Vaṭṭa là luân hồi ba cõi (tebhūmakavaṭṭa); vaṭṭapāda là nghiệp (kamma) để đạt được luân hồi; vivaṭṭa là chín pháp siêu thế (lokuttaradhammā); vivaṭṭapāda là nghiệp để đạt được sự thoát ly luân hồi.
Iti imesu suttesu vaṭṭavivaṭṭameva kathitanti.
Thus, in these suttas, only the round (vaṭṭa) and release from the round (vivaṭṭa) are discussed.
Vì vậy, trong những bài kinh này, chỉ nói về luân hồi và sự thoát ly luân hồi.
23-24. Tatiye vaṭṭavaseneva uppannacittaṃ veditabbaṃ.
23-24. In the third, the mind that arises due to the round of existence should be understood.
23-24. Trong bài kinh thứ ba, tâm cần được hiểu là tâm phát sinh chỉ theo vòng luân hồi.
Mahato anatthāya saṃvattatīti devamanussasampattiyo mārabrahmaissariyāni ca dadamānampi punappunaṃ jātijarābyādhimaraṇasokaparidevadukkhadomanassupāyāse khandhadhātuāyatanapaṭiccasamuppādavaṭṭāni ca dadamānaṃ kevalaṃ dukkhakkhandhameva detīti mahato anatthāya saṃvattati nāmāti.
It leads to great harm means that even though it bestows human and divine prosperity, and the sovereignty of Māra and Brahmā, it repeatedly brings birth, old age, sickness, death, sorrow, lamentation, pain, dejection, and despair, as well as the rounds of aggregates (khandha), elements (dhātu), sense bases (āyatana), and dependent origination (paṭiccasamuppāda); it only gives rise to a mass of suffering, hence it is said to lead to great harm.
Dẫn đến sự bất lợi lớn (mahato anatthāya saṃvattatīti) có nghĩa là, dù ban cho sự giàu sang của chư thiên và loài người, quyền lực của Ma vương và Phạm thiên, nhưng nó vẫn liên tục ban cho sự tái sinh, già, bệnh, chết, sầu, bi, khổ, ưu, não, các vòng luân hồi của uẩn, giới, xứ, duyên khởi, tức là chỉ ban cho khối khổ, nên được gọi là dẫn đến sự bất lợi lớn.
Catutthe cittanti vivaṭṭavaseneva uppannacittaṃ.
In the fourth, mind refers only to the mind that arises due to release from the round.
Trong bài kinh thứ tư, tâm (citta) là tâm phát sinh chỉ theo sự thoát ly luân hồi.
25-26. Pañcamachaṭṭhesu abhāvitaṃ apātubhūtanti ayaṃ viseso.
25-26. In the fifth and sixth, there is a distinction regarding " undeveloped (abhāvitaṃ) and unmanifested (apātubhūtaṃ)."
25-26. Trong bài kinh thứ năm và thứ sáu, có sự khác biệt về không được tu tập (abhāvitaṃ) và không hiển lộ (apātubhūtaṃ).
Tatrāmayadhippāyo – vaṭṭavasena uppannacittaṃ nāma uppannampi abhāvitaṃ apātubhūtameva hoti.
Herein, the intention is this: the mind that arises due to the round of existence, even when arisen, is undeveloped and unmanifested.
Ý nghĩa ở đây là: tâm phát sinh theo vòng luân hồi, dù đã phát sinh, vẫn là không được tu tập và không hiển lộ.
Lokuttarapādakajjhānavipassanāmaggaphalanibbānesu pakkhandituṃ asamatthattā.
Because it is unable to penetrate the jhānas that are the basis for the lokuttara, vipassanā, magga, phala, and Nibbāna.
Vì không có khả năng thâm nhập vào các thiền định làm nền tảng cho siêu thế, tuệ quán, đạo, quả và Niết Bàn.
Vivaṭṭavasena uppannaṃ pana bhāvitaṃ pātubhūtaṃ nāma hoti.
However, the mind that arises due to release from the round is developed and manifested.
Còn tâm phát sinh theo sự thoát ly luân hồi thì được gọi là đã được tu tập và đã hiển lộ.
Tesu dhammesu pakkhandituṃ samatthattā.
Because it is able to penetrate those dhammas.
Vì có khả năng thâm nhập vào các pháp đó.
Kurundakavāsī phussamittatthero panāha – ‘‘maggacittameva, āvuso, bhāvitaṃ pātubhūtaṃ nāma hotī’’ti.
But the Elder Phussamitta, who resided in Kurundaka, said: "Friends, only the mind of the path (maggacitta) is called developed and manifested."
Tuy nhiên, Trưởng lão Phussamitta ở Kurundaka đã nói: “Này các hiền hữu, chỉ có tâm Đạo (maggacitta) mới được gọi là đã được tu tập và đã hiển lộ.”
29. Navame ‘‘jātipi dukkhā’’tiādinā nayena vuttaṃ dukkhaṃ adhivahati āharatīti dukkhādhivahaṃ.
29. In the ninth, bringing suffering (dukkhādhivahaṃ) means that it brings forth or causes suffering, as stated in the manner beginning with "birth is suffering" and so forth.
29. Trong bài kinh thứ chín, dẫn đến khổ (dukkhādhivahaṃ) là mang đến, đem lại khổ đã được nói theo cách như “sanh là khổ” v.v.
Dukkhādhivāhantipi pāṭho.
Dukkhādhivāhaṃ is also a reading.
Cũng có bản đọc là dukkhādhivāhaṃ.
Tassattho – lokuttarapādakajjhānādi ariyadhammābhimukhaṃ dukkhena adhivāhīyati pesīyatīti dukkhādhivāhaṃ.
Its meaning is: a mind that is impelled or driven towards noble dhammas such as jhānas that are the basis for the lokuttara, with difficulty, hence it is dukkhādhivāhaṃ.
Ý nghĩa của nó là: bị thúc đẩy, bị sai khiến một cách khó khăn hướng đến các Thánh pháp như thiền định làm nền tảng cho siêu thế, nên gọi là dukkhādhivāhaṃ.
Idampi vaṭṭavasena uppannacittameva.
This also refers to the mind that arises due to the round of existence.
Đây cũng là tâm phát sinh theo vòng luân hồi.
Tañhi vuttappakārā devamanussādisampattiyo dadamānampi jātiādīnaṃ adhivahanato dukkhādhivahaṃ, ariyadhammādhigamāya duppesanato dukkhādhivāhañca nāma hotīti.
For even when it bestows human and divine prosperities of the described kind, it is called dukkhādhivahaṃ because it brings forth birth and so forth, and it is called dukkhādhivāhaṃ because it is impelled with difficulty towards the attainment of noble dhammas.
Vì nó, dù ban cho sự giàu sang của chư thiên, loài người đã nói ở trên, nhưng vì mang lại sự sanh v.v. nên gọi là dukkhādhivahaṃ, và vì bị sai khiến một cách khó khăn để đạt được Thánh pháp nên cũng gọi là dukkhādhivāhaṃ.
30. Dasame vivaṭṭavasena uppannacittameva cittaṃ.
30. In the tenth, the mind that arises due to release from the round is the (true) mind.
30. Trong bài kinh thứ mười, tâm chỉ là tâm phát sinh theo sự thoát ly luân hồi.
Tañhi mānusakasukhato dibbasukhaṃ, dibbasukhato jhānasukhaṃ, jhānasukhato vipassanāsukhaṃ, vipassanāsukhato maggasukhaṃ, maggasukhato phalasukhaṃ, phalasukhato nibbānasukhaṃ adhivahati āharatīti sukhādhivahaṃ nāma hoti, sukhādhivāhaṃ vā.
For it brings forth or leads to happiness from human bliss to divine bliss, from divine bliss to jhāna bliss, from jhāna bliss to vipassanā bliss, from vipassanā bliss to magga bliss, from magga bliss to phala bliss, and from phala bliss to Nibbāna bliss, hence it is called bringing happiness (sukhādhivahaṃ), or sukhādhivāhaṃ.
Vì nó mang đến, đem lại hạnh phúc của chư thiên vượt hơn hạnh phúc của loài người, hạnh phúc của thiền định vượt hơn hạnh phúc của chư thiên, hạnh phúc của tuệ quán vượt hơn hạnh phúc của thiền định, hạnh phúc của Đạo vượt hơn hạnh phúc của tuệ quán, hạnh phúc của Quả vượt hơn hạnh phúc của Đạo, hạnh phúc của Niết Bàn vượt hơn hạnh phúc của Quả, nên được gọi là dẫn đến lạc (sukhādhivahaṃ), hoặc sukhādhivāhaṃ.
Tañhi lokuttarapādakajjhānādiariyadhammābhimukhaṃ supesayaṃ vissaṭṭhaindavajirasadisaṃ hotīti sukhādhivāhantipi vuccati.
For it impels easily towards noble dhammas such as jhānas that are the basis for the lokuttara, and is like an Indra's thunderbolt that has been released, therefore it is also called sukhādhivāhaṃ.
Vì nó thúc đẩy một cách dễ dàng hướng đến các Thánh pháp như thiền định làm nền tảng cho siêu thế, giống như chày kim cương của Thích Ca đã được phóng ra, nên cũng được gọi là sukhādhivāhaṃ.
Imasmimpi vagge vaṭṭavivaṭṭameva kathitanti.
In this chapter too, only the round (vaṭṭa) and release from the round (vivaṭṭa) are discussed.
Trong phẩm này cũng chỉ nói về luân hồi và sự thoát ly luân hồi.
41. Pañcamassa paṭhame seyyathāpīti opammatthe nipāto.
41. In the first of the fifth (chapter), seyyathāpi is a particle indicating a simile.
41. Trong bài kinh thứ nhất của phẩm thứ năm, seyyathāpi là một giới từ biểu thị ý nghĩa so sánh.
Tatra bhagavā katthaci atthena upamaṃ parivāretvā dasseti vatthasutte (ma. ni. 1.70 ādayo) viya, pāricchattakopama- (a. ni. 7.69) aggikkhandhopamādisuttesu (a. ni. 7.72) viya ca, katthaci upamāya atthaṃ parivāretvā dasseti loṇambilasutte (a. ni. 3.101) viya, suvaṇṇakārasuttasūriyopamādisuttesu (a. ni. 7.66) viya ca.
Herein, the Blessed One sometimes illustrates the meaning by surrounding it with a simile, as in the Vatthasutta and others, and as in the Pāricchattakopama and Aggikkhandhopama suttas; and sometimes illustrates the simile by surrounding it with the meaning, as in the Loṇambilasutta and as in the Suvaṇṇakārasutta and Sūriyopama suttas.
Ở đây, Đức Thế Tôn đôi khi trình bày ý nghĩa bằng cách bao quanh bởi ví dụ, như trong các bài kinh Vatthasutta (Ma. Ni. 1.70 v.v.) và các bài kinh ví dụ về cây pāricchattaka (A. Ni. 7.69), ví dụ về khối lửa (A. Ni. 7.72) v.v.; đôi khi lại trình bày ví dụ bằng cách bao quanh bởi ý nghĩa, như trong bài kinh Loṇambilasutta (A. Ni. 3.101), các bài kinh ví dụ về thợ vàng, ví dụ về mặt trời (A. Ni. 7.66) v.v.
Imasmiṃ pana sālisūkopame upamāya atthaṃ parivāretvā dassento seyyathāpi, bhikkhavetiādimāha.
But in this Sālisūkopama (simile of the rice awn), illustrating the meaning with the simile, he said, " Just as, bhikkhus," and so forth.
Tuy nhiên, trong bài kinh ví dụ về vỏ trấu này, Ngài đã nói “Này các Tỳ-khưu, ví như” v.v. để trình bày ý nghĩa bằng cách bao quanh bởi ví dụ.
Tattha sālisūkanti sāliphalassa sūkaṃ.
Herein, sālisūkaṃ means the awn of a rice grain.
Ở đó, vỏ trấu lúa (sālisūkaṃ) là vỏ của hạt lúa.
Yavasūkepi eseva nayo.
The same method applies to yavasūkaṃ (barley awn).
Đối với vỏ trấu lúa mạch (yavasūkaṃ) cũng theo cách này.
Vā-saddo vikappattho.
The word 'vā' is used in the sense of 'or'.
Từ "vā" có nghĩa là lựa chọn.
Micchāpaṇihitanti micchāṭhapitaṃ.
Micchāpaṇihitaṃ means incorrectly placed.
Đặt sai cách (micchāpaṇihitaṃ) có nghĩa là đặt không đúng.
Yathā vijjhituṃ sakkoti, na evaṃ uddhaggaṃ katvā ṭhapitanti attho.
The meaning is that it is not placed pointing upwards in such a way that it can pierce.
Ý nghĩa là không đặt thẳng đứng để có thể đâm xuyên.
Bhecchatīti bhindissati, chaviṃ chindissatīti attho.
Bhecchatī means it will break, it will cut the skin, is the meaning.
Sẽ làm tổn thương (bhecchatī) có nghĩa là sẽ làm vỡ, sẽ làm rách da.
Micchāpaṇihitena cittenāti micchāṭhapitena cittena.
By a mind wrongly directed (micchāpaṇihitena cittena) means by a mind wrongly placed.
Với tâm đặt sai cách (micchāpaṇihitena cittenā) có nghĩa là với tâm đã được đặt sai cách.
Vaṭṭavasena uppannacittaṃ sandhāyetaṃ vuttaṃ.
This is said with reference to the mind that arises due to the round of existence.
Điều này được nói để chỉ tâm phát sinh theo vòng luân hồi.
Avijjanti aṭṭhasu ṭhānesu aññāṇabhūtaṃ ghanabahalaṃ mahāavijjaṃ.
Ignorance (avijjaṃ) means the great, dense, and profound ignorance (aññāṇa) in eight instances.
Vô minh (avijjaṃ) là vô minh lớn, dày đặc, là sự không hiểu biết ở tám chỗ.
Vijjaṃ uppādessatīti ettha vijjanti arahattamaggañāṇaṃ.
Here, in will generate wisdom (vijjaṃ uppādessatī), wisdom (vijja) means the knowledge of Arahantship-magga.
Trong câu sẽ phát sinh minh (vijjaṃ uppādessatī), minh (vijja) là Đạo trí A-la-hán.
Nibbānanti taṇhāvānato nikkhantabhāvena evaṃ vuttaṃ amataṃ.
Nibbāna is the deathless state, so called due to being freed from the forest of craving (taṇhāvāna).
Niết Bàn (nibbānaṃ) là bất tử, được gọi như vậy vì đã thoát ly khỏi rừng tham ái (taṇhāvāna).
Sacchikarissatīti paccakkhaṃ karissati.
Sacchikarissatī means he will realize it directly.
Sẽ chứng ngộ (sacchikarissatī) có nghĩa là sẽ làm cho hiển lộ.
42. Dutiye sammāpaṇihitanti yathā bhindituṃ sakkoti, evaṃ uddhaggaṃ katvā suṭṭhu ṭhapitaṃ.
42. In the second, sammāpaṇihitaṃ means well-placed, set up straight so that it can pierce.
42. Trong bài kinh thứ hai, đặt đúng cách (sammāpaṇihitaṃ) có nghĩa là đặt thẳng đứng một cách hoàn hảo để có thể đâm xuyên.
Akkantanti ettha pādeneva akkantaṃ nāma hoti, hatthena uppīḷitaṃ.
Here, akkantaṃ means something that is trodden upon by the foot, or pressed down by the hand.
Ở đây, bị giẫm lên (akkantaṃ) có nghĩa là bị giẫm bằng chân, bị đè bằng tay.
Ruḷhisaddavasena pana akkantanteva vuttaṃ.
However, by conventional usage, it is simply said to be 'trodden upon'.
Nhưng theo cách dùng thông thường, nó được gọi là akkantaṃ.
Ayañhettha ariyavohāro.
This is a noble expression here.
Đây là cách dùng của bậc Thánh.
Kasmā pana aññe sepaṇṇikaṇṭakamadanakaṇṭakādayo mahante aggahetvā sukhumaṃ dubbalaṃ sālisūkayavasūkameva gahitanti?
But why were the subtle and weak rice awn or barley awn taken as examples, and not other large thorns like sepaṇṇi-thorn or madana-thorn?
Tại sao không lấy những gai lớn khác như gai sepaṇṇika, gai madanaka v.v. mà lại lấy vỏ trấu lúa và vỏ trấu lúa mạch nhỏ bé, yếu ớt?
Appamattakassāpi kusalakammassa vivaṭṭāya samatthabhāvadassanatthaṃ.
To show that even a small amount of wholesome kamma is capable of leading to release from the round (vivaṭṭa).
Để chỉ ra khả năng của dù chỉ một chút thiện nghiệp cũng có thể dẫn đến sự thoát ly luân hồi.
Yathā hi sukhumaṃ dubbalaṃ sālisūkaṃ vā yavasūkaṃ vā hotu, mahantamahantā sepaṇṇikaṇṭakamadanakaṇṭakādayo vā, etesu yaṃkiñci micchā ṭhapitaṃ hatthaṃ vā pādaṃ vā bhindituṃ lohitaṃ vā uppādetuṃ na sakkoti, sammā ṭhapitaṃ pana sakkoti, evameva appamattakaṃ tiṇamuṭṭhi mattadānakusalaṃ vā hotu, mahantaṃ velāmadānādikusalaṃ vā, sace vaṭṭasampattiṃ patthetvā vaṭṭasannissitavasena micchā ṭhapitaṃ hoti, vaṭṭameva āharituṃ sakkoti, no vivaṭṭaṃ.
For just as a subtle and weak rice awn or barley awn, or even large sepaṇṇi-thorns or madana-thorns, if any of these is placed incorrectly, it cannot pierce a hand or foot or draw blood, but if placed correctly, it can; in the same way, whether it is a small act of wholesome kamma like giving a handful of grass, or a great act like giving land (velāmadāna), if it is placed incorrectly by desiring prosperity in the round of existence and being connected to the round, it can only lead to the round, not to release from the round.
Thật vậy, dù là vỏ trấu lúa hay vỏ trấu lúa mạch nhỏ bé, yếu ớt, hay những gai lớn như gai sepaṇṇika, gai madanaka v.v., nếu bất cứ thứ gì trong số đó được đặt sai cách, nó không thể làm tổn thương tay hoặc chân hay làm chảy máu; nhưng nếu được đặt đúng cách, nó có thể làm được. Cũng vậy, dù là thiện nghiệp nhỏ bé như việc bố thí một nắm cỏ, hay thiện nghiệp lớn như việc bố thí theo thời gian v.v., nếu nó được đặt sai cách, gắn liền với vòng luân hồi, mong cầu sự giàu sang trong luân hồi, thì nó chỉ có thể mang lại luân hồi, chứ không phải sự thoát ly luân hồi.
‘‘Idaṃ me dānaṃ āsavakkhayāvahaṃ hotū’’ti evaṃ pana vivaṭṭaṃ patthentena vivaṭṭavasena sammā ṭhapitaṃ arahattampi paccekabodhiñāṇampi sabbaññutañāṇampi dātuṃ sakkotiyeva.
"May this offering of mine be productive of the destruction of the āsavas" — by wishing for liberation in this way, when it is correctly established as leading to liberation, it is indeed capable of bestowing arahantship, the knowledge of a Paccekabuddha, and the omniscience of a Sammāsambuddha.
Khi một người cầu nguyện rằng: "Nguyện cho sự bố thí này của tôi dẫn đến sự diệt trừ các lậu hoặc (āsavakkhaya)", thì sự bố thí được thiết lập đúng đắn theo cách thoát khỏi luân hồi (vivaṭṭa) như vậy có thể mang lại quả A-la-hán (arahatta), trí tuệ Bích-chi Phật (paccekabodhiñāṇa), và trí tuệ Toàn giác (sabbaññutañāṇa).
Vuttañhetaṃ –
For this has been said:
Điều này đã được nói:
43. Tatiye paduṭṭhacittanti dosena paduṭṭhacittaṃ.
43. In the third, paduṭṭhacittaṃ means a mind corrupted by hatred (dosa).
43. Trong bài kinh thứ ba, paduṭṭhacitta có nghĩa là tâm bị ô nhiễm bởi sân hận (dosa).
Cetasā cetopariccāti attano cittena tassa cittaṃ paricchinditvā.
Cetasā cetopariccā means discerning another's mind with one's own mind.
Cetasā cetopariccā có nghĩa là dùng tâm của mình để thấu hiểu tâm của người khác.
Yathābhataṃ nikkhittoti yathā āharitvā ṭhapito.
Yathābhataṃ nikkhitto means just as one is brought and placed.
Yathābhataṃ nikkhitto có nghĩa là như đã được mang đến và đặt xuống.
Evaṃ nirayeti evaṃ niraye ṭhitoyevāti vattabbo.
Evaṃ niraye means "he is thus placed in hell", so it should be stated.
Evaṃ niraye có nghĩa là như vậy, người ấy đã ở trong địa ngục (niraya).
Apāyantiādi sabbaṃ nirayavevacanameva.
Apāyaṃ and so on are all synonyms for hell (niraya).
Apāya và các từ tương tự đều là đồng nghĩa của địa ngục (niraya).
Nirayo hi ayasaṅkhātā sukhā apetoti apāyo, dukkhassa gati paṭisaraṇanti duggati, dukkaṭakārino ettha vivasā nipatantīti vinipāto, nirassādatthena nirayo.
For hell (niraya) is apāya because it is devoid of happiness, which is called 'aya'; it is duggati as it is a destination and refuge of suffering; it is vinipāto because evildoers fall into it helplessly; and it is nirayo due to its lack of enjoyment.
Địa ngục (niraya) được gọi là apāya vì nó không có hạnh phúc (sukha) được gọi là sự tốt lành (aya); là duggati vì là nơi đến, nơi nương tựa của khổ đau; là vinipāto vì những kẻ làm ác sa xuống đó một cách bất đắc dĩ; là nirayo vì không có hương vị (nirassāda).
45. Pañcame udakarahadoti udakadaho.
45. In the fifth, udakarahado means a pool of water.
45. Trong bài kinh thứ năm, udakarahado có nghĩa là hồ nước.
Āviloti avippasanno.
Āvilo means not clear.
Āvilo có nghĩa là không trong sạch.
Luḷitoti aparisaṇṭhito.
Luḷito means not settled.
Luḷito có nghĩa là không yên tĩnh.
Kalalībhūtoti kaddamībhūto.
Kalalībhūto means become muddy.
Kalalībhūto có nghĩa là trở thành bùn.
Sippisambukantiādīsu sippiyo ca sambukā ca sippisambukaṃ.
In sippisambukā and so on, sippī (oysters) and sambukā (snails) are sippisambukaṃ.
Trong các từ như sippisambukaṃ, sippisambukaṃ là sò và ốc.
Sakkharā ca kaṭhalāni ca sakkharakaṭhalaṃ.
Gravel (sakkarā) and potsherds (kaṭhalāni) are sakkharakaṭhalaṃ.
Sỏi và mảnh sành là sakkharakaṭhalaṃ.
Macchānaṃ gumbaṃ ghaṭāti macchagumbaṃ.
A group or cluster of fish is macchagumbaṃ.
Đàn cá là macchagumbaṃ.
Carantampi tiṭṭhantampīti ettha sakkharakaṭhalaṃ tiṭṭhatiyeva, itarāni carantipi tiṭṭhantipi.
In carantampi tiṭṭhantampi (moving or standing), the gravel and potsherds (sakkharakaṭhalaṃ) just stand, while the others (oysters, snails, fish) may be moving or standing.
Trong câu carantampi tiṭṭhantampi, sỏi và mảnh sành thì chỉ đứng yên, còn các thứ khác thì có thể di chuyển hoặc đứng yên.
Yathā pana antarantarā ṭhitāsupi nisinnāsupi nipajjamānāsupi ‘‘etā gāviyo carantī’’ti carantiyo upādāya itarāpi ‘‘carantī’’ti vuccanti, evaṃ tiṭṭhantameva sakkharakaṭhalaṃ upādāya itarampi dvayaṃ ‘‘tiṭṭhanta’’nti vuttaṃ, itaraṃ dvayaṃ carantaṃ upādāya sakkharakaṭhalampi ‘‘caranta’’nti vuttaṃ.
Just as cows that are standing, sitting, or lying down in between are also called "moving" based on those that are actually moving, so too the other two (oysters and snails) are said to be "standing" based on the gravel and potsherds that are just standing. And based on the other two that are moving, the gravel and potsherds are also said to be "moving".
Cũng như khi những con bò đứng, ngồi, nằm xen kẽ nhau, nhưng người ta nói "những con bò này đang đi" dựa trên những con đang đi, và những con khác cũng được gọi là "đang đi"; tương tự, dựa trên sỏi và mảnh sành chỉ đứng yên, hai loại kia cũng được gọi là "đứng yên", và dựa trên hai loại kia đang di chuyển, sỏi và mảnh sành cũng được gọi là "đang di chuyển".
Āvilenāti pañcahi nīvaraṇehi pariyonaddhena.
Āvilenā means enmeshed by the five hindrances (nīvaraṇa).
Āvilenā có nghĩa là bị bao phủ bởi năm triền cái (nīvaraṇa).
Attatthaṃ vātiādīsu attano diṭṭhadhammiko lokiyalokuttaramissako attho attattho nāma.
In attatthaṃ vā and so on, one's own benefit, which is worldly and supramundane mixed, in this very life, is called one's own benefit (attattha).
Trong các từ như attatthaṃ vā, lợi ích của chính mình trong hiện tại, bao gồm cả thế gian và siêu thế, được gọi là attattha.
Attanova samparāye lokiyalokuttaramissako attho parattho nāma hoti.
One's own benefit, which is worldly and supramundane mixed, in the next life, is called the benefit of others (parattha).
Lợi ích của chính mình trong đời sau, bao gồm cả thế gian và siêu thế, được gọi là parattha.
So hi parattha atthoti parattho.
For that is a benefit for the next life, hence it is called benefit of others (parattha).
Vì nó là lợi ích ở đời sau nên gọi là parattha.
Tadubhayaṃ ubhayattho nāma.
Both of these are called the benefit of both (ubhayattha).
Cả hai điều đó được gọi là ubhayattha.
Apica attano diṭṭhadhammikasamparāyikopi lokiyalokuttaro attho attattho nāma, parassa tādisova attho parattho nāma, tadubhayampi ubhayattho nāma.
Moreover, one's own worldly and supramundane benefit, both in this life and the next, is called one's own benefit (attattha); a similar benefit for another is called the benefit of others (parattha); and both of these are called the benefit of both (ubhayattha).
Hơn nữa, lợi ích của chính mình trong hiện tại và đời sau, cả thế gian và siêu thế, được gọi là attattha; lợi ích tương tự của người khác được gọi là parattha; và cả hai điều đó được gọi là ubhayattha.
Uttariṃ vā manussadhammāti dasakusalakammapathasaṅkhātā manussadhammā uttariṃ.
Uttariṃ vā manussadhammā means beyond the human qualities (manussadhammā), which are the ten courses of wholesome action (dasakusalakammapatha).
Uttariṃ vā manussadhammā có nghĩa là vượt trên các pháp của loài người (manussadhamma) là mười nghiệp đạo thiện (dasakusalakammapatha).
Ayañhi dasavidho dhammo vināpi aññaṃ samādāpakaṃ satthantarakappāvasāne jātasaṃvegehi manussehi sayameva samādinnattā manussadhammoti vuccati, tato uttariṃ pana jhānavipassanāmaggaphalāni veditabbāni.
For these tenfold qualities are called human qualities (manussadhammā) because they were undertaken spontaneously by humans filled with urgency at the end of a world-ending period (satthantarakappa), even without another initiator; beyond that, jhāna, vipassanā, path, and fruition should be understood.
Mười pháp này được gọi là pháp của loài người (manussadhamma) vì vào cuối kiếp chiến tranh (satthantarakappa), con người tự mình thọ trì chúng mà không cần người khác khuyến khích, do cảm thấy sợ hãi sự sinh tử; còn vượt trên đó là các thiền định (jhāna), tuệ quán (vipassanā), đạo (magga) và quả (phala) cần được biết.
Alamariyañāṇadassanavisesanti ariyānaṃ yuttaṃ, ariyabhāvaṃ vā kātuṃ samatthaṃ ñāṇadassanasaṅkhātaṃ visesaṃ.
Alamariyañāṇadassanavisesaṃ means a special kind of knowledge and vision that is suitable for noble ones (ariya) or capable of making one noble.
Alamariyañāṇadassanavisesa có nghĩa là sự đặc biệt của tri kiến (ñāṇadassana) thích hợp với các bậc Thánh (ariya) hoặc có khả năng làm cho trở thành bậc Thánh.
Ñāṇameva hi jānanaṭṭhena ñāṇaṃ, dassanaṭṭhena dassananti veditabbaṃ, dibbacakkhuñāṇavipassanāñāṇamaggañāṇaphalañāṇapaccavekkhaṇañāṇānametaṃ adhivacanaṃ.
Indeed, knowledge (ñāṇa) should be understood as 'ñāṇa' in the sense of knowing, and 'dassana' in the sense of seeing; this is a designation for the knowledge of the divine eye (dibbacakkhuñāṇa), insight knowledge (vipassanāñāṇa), path knowledge (maggañāṇa), fruition knowledge (phalañāṇa), and reviewing knowledge (paccavekkhaṇañāṇa).
Thật vậy, ñāṇa cần được hiểu là trí tuệ theo nghĩa biết (jānanaṭṭha), và dassana là tri kiến theo nghĩa thấy (dassanaṭṭha); đây là tên gọi chung cho thiên nhãn trí (dibbacakkhuñāṇa), tuệ quán trí (vipassanāñāṇa), đạo trí (maggañāṇa), quả trí (phalañāṇa) và quán xét trí (paccavekkhaṇañāṇa).
46. Chaṭṭhe acchoti abahalo, pasannotipi vaṭṭati.
46. In the sixth, accho means not thick, 'clear' is also suitable.
46. Trong bài kinh thứ sáu, accho có nghĩa là không đục, cũng có thể là thanh tịnh.
Vippasannoti suṭṭhu pasanno.
Vippasanno means very clear.
Vippasanno có nghĩa là rất thanh tịnh.
Anāviloti na āvilo, parisuddhoti attho, pheṇapubbuḷasaṅkhasevālapaṇakavirahitoti vuttaṃ hoti.
Anāvilo means not turbid, meaning pure, i.e., free from foam, bubbles, moss, and water plants.
Anāvilo có nghĩa là không đục, tức là trong sạch, không có bọt, bong bóng, rong rêu hay thực vật thủy sinh.
Anāvilenāti pañcanīvaraṇavimuttena.
Anāvilenā means free from the five hindrances (nīvaraṇa).
Anāvilenā có nghĩa là không bị năm triền cái (pañcanīvaraṇa) che chướng.
Sesaṃ catutthe vuttanayameva.
The rest is as stated in the fourth*.
Phần còn lại tương tự như đã nói trong bài kinh thứ tư.
Imasmimpi suttadvaye vaṭṭavivaṭṭameva kathitaṃ.
In these two suttas also, saṃsāra (vaṭṭa) and liberation (vivaṭṭa) are discussed.
Trong hai bài kinh này cũng chỉ nói về luân hồi (vaṭṭa) và thoát ly luân hồi (vivaṭṭa).
47. Sattame rukkhajātānanti paccatte sāmivacanaṃ, rukkhajātānīti attho.
47. In the seventh, rukkhajātānaṃ is a possessive case in the sense of particularity, meaning "of tree species".
47. Trong bài kinh thứ bảy, rukkhajātānaṃ là sở hữu cách số ít, có nghĩa là "trong số các loại cây".
Rukkhānametaṃ adhivacanaṃ.
This is a synonym for trees.
Đây là tên gọi của các loại cây.
Yadidanti nipātamattaṃ.
Yadidaṃ is merely a particle.
Yadidaṃ chỉ là một giới từ.
Mudutāyāti mudubhāvena.
Mudutāya means by way of softness.
Mudutāya có nghĩa là do sự mềm mại.
Koci hi rukkho vaṇṇena aggo hoti, koci gandhena, koci rasena, koci thaddhatāya.
For some trees are supreme in beauty, some in fragrance, some in taste, some in hardness.
Có cây thì tốt nhất về màu sắc, có cây về hương thơm, có cây về vị, có cây về độ cứng.
Phandano pana mudutāya ceva kammaññatāya ca aggo seṭṭhoti dasseti.
But the phandana (trembling mind) is shown to be supreme and excellent in both softness and malleability.
Còn cây Phandana thì tốt nhất về sự mềm mại và dễ uốn nắn.
Cittaṃ, bhikkhave, bhāvitaṃ bahulīkatanti ettha samathavipassanāvasena bhāvitañceva punappunakatañca cittaṃ adhippetaṃ.
Here, Cittaṃ, bhikkhave, bhāvitaṃ bahulīkataṃ refers to a mind that is developed through both calm (samatha) and insight (vipassanā), and repeatedly practiced.
Trong câu Cittaṃ, bhikkhave, bhāvitaṃ bahulīkataṃ, tâm được tu tập (bhāvita) và thực hành nhiều lần (punappunakata) theo cách thiền định (samatha) và tuệ quán (vipassanā) là điều được đề cập.
Kurundakavāsi phussamittatthero panāha – ‘‘ekantaṃ mudu ceva kammaniyañca cittaṃ nāma abhiññāpādakacatutthajjhānacittameva, āvuso’’ti.
However, Elder Phussamitta of Kurundaka said: "O friend, a mind that is exclusively soft and malleable is none other than the fourth jhāna consciousness, which is the basis for supernormal powers (abhiññā)."
Tuy nhiên, Trưởng lão Phussamitta ở Kurundaka nói: "Này hiền giả, tâm hoàn toàn mềm mại và dễ uốn nắn là tâm thiền thứ tư (catutthajjhāna) dẫn đến các thắng trí (abhiññāpādaka)."
48. Aṭṭhame evaṃ lahuparivattanti evaṃ lahuṃ uppajjitvā lahuṃ nirujjhanakaṃ.
48. In the eighth, evaṃ lahuparivattaṃ means thus swiftly arising and swiftly ceasing.
48. Trong bài kinh thứ tám, evaṃ lahuparivatta có nghĩa là sinh lên nhanh chóng và diệt đi nhanh chóng như vậy.
Yāvañcāti adhimattapamāṇatthe nipāto, ativiya na sukarāti attho.
Yāvañcā is a particle signifying an extreme degree or extent, meaning "it is exceedingly difficult".
Yāvañcā là một giới từ chỉ mức độ quá mức, có nghĩa là cực kỳ khó khăn.
Idanti nipātamattaṃ.
Idaṃ is merely a particle.
Idaṃ chỉ là một giới từ.
Cittanti ekacce tāva ācariyā ‘‘bhavaṅgacitta’’nti vadanti, taṃ pana paṭikkhipitvā ‘‘idha cittanti yaṃkiñci antamaso cakkhuviññāṇampi adhippetamevā’’ti vuttaṃ.
Regarding cittaṃ, some teachers say it refers to the life-continuum consciousness (bhavaṅgacitta); but refuting that, it is said that "here cittaṃ refers to any consciousness whatsoever, even eye-consciousness, is intended."
Citta – một số vị thầy nói đó là tâm hộ kiếp (bhavaṅgacitta), nhưng điều đó bị bác bỏ và nói rằng "ở đây, citta có nghĩa là bất cứ tâm nào, thậm chí là nhãn thức (cakkhuviññāṇa)."
Imasmiṃ panatthe milindarājā dhammakathikaṃ nāgasenattheraṃ pucchi, ‘‘bhante nāgasena, ekasmiṃ accharākkhaṇe pavattitacittasaṅkhārā sace rūpino assu, kīva mahārāsi bhaveyyā’’ti?
Concerning this meaning, King Milinda asked the Dhamma preacher, Elder Nāgasena, "Venerable Nāgasena, if the mental formations (cittasaṅkhārā) occurring in a single snap of the fingers were material, how vast would the heap be?"
Về vấn đề này, vua Milinda đã hỏi Trưởng lão Nāgasena, một vị thuyết pháp: "Thưa Tôn giả Nāgasena, nếu các hành của tâm (cittasaṅkhāra) xảy ra trong một khoảnh khắc chớp mắt (accharākkhaṇa) là vật chất (rūpino), thì chúng sẽ có khối lượng lớn đến mức nào?"
‘‘Vāhasatānaṃ kho, mahārāja, vīhīnaṃ aḍḍhacūḷañca vāhā vīhisattambaṇāni dve ca tumbā ekaccharākkhaṇe pavattitassa cittassa saṅkhampi na upenti, kalampi na upenti, kalabhāgampi na upentī’’ti (mi. pa. 4.1.2).
"Indeed, great king, half a cūḷa of vāha measures of paddy, and seven ambaṇa measures of paddy, and two tumba measures would not even compare to, nor be a fraction of, nor a part of a fraction of the mental formations occurring in a single snap of the fingers."
"Thưa Đại vương, một trăm xe lúa, cộng thêm nửa chūḷa xe lúa, bảy ambaṇa lúa và hai tumbā lúa cũng không thể sánh bằng, không thể so sánh, không thể là một phần nhỏ của các hành của tâm xảy ra trong một khoảnh khắc chớp mắt."
Atha kasmā sammāsambuddhena ‘‘upamāpi na sukarā’’ti vuttaṃ?
So why did the Sammāsambuddha say, "an analogy is not easy"?
Vậy tại sao Đức Chánh Đẳng Giác lại nói "không dễ để đưa ra ví dụ"?
Yatheva hi upamaṃ paṭikkhipitvāpi kappadīghabhāvassa yojanikapabbatena yojanikasāsapapuṇṇanagarena, nirayadukkhassa sattisatāhatopamena, saggasukhassa ca cakkavattisampattiyā upamā katā, evamidhāpi kātabbāti?
Just as an analogy for the long duration of a kappa, even after refuting it, was made with a yojanika mountain and a city full of yojanika mustard seeds, and for the suffering of hell with the simile of being struck a hundred spears, and for the happiness of heaven with the sovereignty of a Cakkavatti, so should it be done here?
Như việc bác bỏ ví dụ nhưng vẫn đưa ra ví dụ về núi cao dặm, thành phố đầy hạt cải dặm để nói về sự dài lâu của kiếp (kappa), ví dụ về việc bị đâm bởi hàng trăm cây giáo để nói về khổ đau địa ngục, và ví dụ về sự giàu sang của Chuyển Luân Vương để nói về hạnh phúc thiên giới, thì ở đây cũng nên làm như vậy phải không?
Tattha ‘‘sakkā pana, bhante, upamā kātu’’nti evaṃ pucchāvasena upamā katā, imasmiṃ sutte pucchāya abhāvena na katā.
There, an analogy was made by way of asking, "But venerable sir, is it possible to make an analogy?" In this sutta, it was not made due to the absence of a question.
Ở đó, ví dụ được đưa ra dưới dạng câu hỏi: "Thưa Tôn giả, có thể đưa ra ví dụ được không?"; còn trong bài kinh này, vì không có câu hỏi nên không đưa ra ví dụ.
Idañhi suttaṃ dhammadesanāpariyosāne vuttaṃ.
For this sutta was spoken at the conclusion of a Dhamma discourse.
Bài kinh này được nói vào cuối buổi thuyết pháp.
Iti imasmiṃ sutte cittarāsi nāma kathitoti.
Thus, in this sutta, the mass of consciousness is described.
Như vậy, trong bài kinh này đã nói về khối lượng tâm.
49. Navame pabhassaranti paṇḍaraṃ parisuddhaṃ.
49. In the ninth, pabhassaraṃ means white and pure.
49. Trong bài kinh thứ chín, pabhassara có nghĩa là trắng, trong sạch.
Cittanti bhavaṅgacittaṃ.
Cittaṃ means the life-continuum consciousness (bhavaṅgacitta).
Citta có nghĩa là tâm hộ kiếp (bhavaṅgacitta).
Kiṃ pana cittassa vaṇṇo nāma atthīti?
Does consciousness (citta) actually have a color?
Vậy tâm có màu sắc không?
Natthi.
No, it does not.
Không có.
Nīlādīnañhi aññataravaṇṇaṃ vā hotu avaṇṇaṃ vā yaṃkiñci parisuddhatāya ‘‘pabhassara’’nti vuccati.
For something, whether it be blue or any other color, or colorless, is called "luminous" (pabhassaraṃ) due to its purity.
Bất kỳ điều gì, dù có màu xanh lam hay màu nào khác, hoặc không có màu, đều được gọi là pabhassara vì sự trong sạch của nó.
Idampi nirupakkilesatāya parisuddhanti pabhassaraṃ.
This (consciousness) is also pure due to its freedom from defilements (nirupakkilesatā), hence it is luminous (pabhassaraṃ).
Điều này cũng là pabhassara vì trong sạch do không có phiền não (nirupakkilesatā).
Tañca khoti taṃ bhavaṅgacittaṃ.
Tañca kho means that life-continuum consciousness (bhavaṅgacitta).
Tañca kho có nghĩa là tâm hộ kiếp đó.
Āgantukehīti asahajātehi pacchā javanakkhaṇe uppajjanakehi.
Āgantukehi means by adventitious (incoming) defilements that arise subsequently at the moment of impulsion (javana).
Āgantukehī có nghĩa là do những phiền não khách trần (āsava) không đồng sinh, sinh khởi vào khoảnh khắc javana sau đó.
Upakkilesehīti rāgādīhi upakkiliṭṭhattā upakkiliṭṭhaṃ nāmāti vuccati.
Upakkilesehi means that it is called defiled because it is defiled by defilements such as greed.
Upakkilesehī (bởi các phiền não) có nghĩa là được gọi là bị ô nhiễm (upakkiliṭṭha) vì bị ô nhiễm bởi tham (rāga) và các phiền não khác.
Kathaṃ?
How so?
Như thế nào?
Yathā hi sīlavantā ācārasampannā mātāpitaro vā ācariyupajjhāyā vā dussīlānaṃ durācārānaṃ avattasampannānaṃ puttānañceva antevāsikasaddhivihārikānañca vasena ‘‘attano putte vā antevāsikasaddhivihārike vā na tajjenti na sikkhāpenti na ovadanti nānusāsantī’’ti avaṇṇaṃ akittiṃ labhanti, evaṃsampadamidaṃ veditabbaṃ.
Just as virtuous and well-behaved parents, teachers, or preceptors gain ill-repute and discredit on account of their immoral, ill-behaved, and undisciplined sons, pupils, and co-residents, saying: "They do not admonish, train, instruct, or advise their sons, pupils, or co-residents," so too should this be understood.
Ví như, cha mẹ hoặc thầy giáo, thầy tế độ có giới hạnh và đầy đủ oai nghi, do con cái hoặc học trò, đệ tử sống chung của họ không có giới hạnh, có ác hạnh, không đầy đủ bổn phận, mà bị mang tiếng xấu, bị mất danh dự rằng: “Họ không răn đe, không giáo huấn, không khuyên bảo, không chỉ dạy con cái hoặc học trò, đệ tử sống chung của mình”, thì điều này cũng nên được hiểu tương tự như vậy.
Ācārasampannā mātāpitaro viya ca ācariyupajjhāyā viya ca bhavaṅgacittaṃ daṭṭhabbaṃ, puttādīnaṃ vasena tesaṃ akittilābho viya javanakkhaṇe rajjanadussanamuyhanasabhāvānaṃ lobhasahagatādīnaṃ cittānaṃ vasena uppannehi āgantukehi upakkilesehi pakatiparisuddhampi bhavaṅgacittaṃ upakkiliṭṭhaṃ nāma hotīti.
The bhavaṅga-citta should be seen like well-behaved parents, teachers, and preceptors, and just as they gain discredit on account of their sons, etc., so too, the naturally pure bhavaṅga-citta is called defiled by the adventitious defilements that arise due to cittas such as those accompanied by greed, which have the nature of clinging, aversion, and delusion during the javana-moment.
Tâm Hộ phần (bhavaṅgacitta) nên được xem như cha mẹ hoặc thầy giáo, thầy tế độ đầy đủ oai nghi; và giống như việc họ bị mất danh dự do con cái và những người khác, thì tâm Hộ phần vốn thanh tịnh tự nhiên cũng bị gọi là ô nhiễm do các phiền não khách trần sinh khởi bởi các tâm tham hợp, v.v., có bản chất tham đắm, sân hận, si mê trong sát-na tốc hành tâm (javana-kṣaṇa).
50. Dasamepi bhavaṅgacittameva cittaṃ.
50. In the tenth, the bhavaṅga-citta itself is the citta.
50. Trong bài kinh thứ mười, chính tâm Hộ phần là tâm (citta).
Vippamuttanti javanakkhaṇe arajjamānaṃ adussamānaṃ amuyhamānaṃ tihetukañāṇasampayuttādikusalavasena uppajjamānaṃ āgantukehi upakkilesehi vippamuttaṃ nāma hoti.
Vippamutta (liberated) means that which is not clinging, not hateful, not deluded during the javana-moment, and which arises due to wholesome states such as those accompanied by three roots and knowledge, thus being liberated from adventitious defilements.
Vippamutta (thoát ly) có nghĩa là trong sát-na tốc hành tâm, tâm không tham đắm, không sân hận, không si mê, sinh khởi do các thiện tâm tam nhân hợp trí, v.v., thì được gọi là thoát ly khỏi các phiền não khách trần.
Idhāpi yathā sīlavantānaṃ ācārasampannānaṃ puttādīnaṃ vasena mātādayo ‘‘sobhanā eteyeva attano puttakādayo sikkhāpenti ovadanti anusāsantī’’ti vaṇṇakittilābhino honti, evaṃ javanakkhaṇe uppannakusalacittavasena idaṃ bhavaṅgacittaṃ āgantukehi upakkilesehi vippamuttanti vuccatīti.
Here too, just as mothers and others gain praise and repute on account of their virtuous and well-behaved sons, etc., saying: "These sons, etc., of theirs are excellent; they train, instruct, and advise them," so too, this bhavaṅga-citta is said to be liberated from adventitious defilements due to the wholesome cittas that arise during the javana-moment.
Ở đây cũng vậy, ví như cha mẹ và những người khác được khen ngợi, được danh tiếng rằng: “Con cái và những người khác của họ có giới hạnh, đầy đủ oai nghi, họ giáo huấn, khuyên bảo, chỉ dạy con cái và những người khác của mình một cách tốt đẹp”, thì tâm Hộ phần này cũng được gọi là thoát ly khỏi các phiền não khách trần do thiện tâm sinh khởi trong sát-na tốc hành tâm.
51. Chaṭṭhassa paṭhame taṃ assutavā puthujjanoti taṃ bhavaṅgacittaṃ sutavirahito puthujjano.
51. In the first discourse of the sixth section, taṃ assutavā puthujjano means that an uninstructed ordinary person does not know that bhavaṅga-citta.
51. Trong bài kinh đầu tiên của phẩm thứ sáu, taṃ assutavā puthujjano (phàm phu không nghe pháp ấy) có nghĩa là phàm phu không có nghe pháp về tâm Hộ phần ấy.
Tattha āgamādhigamābhāvā ñeyyo assutavā iti.
Here, "uninstructed" should be understood as lacking both scriptural knowledge (āgama) and penetrative knowledge (adhigama).
Ở đây, người không nghe pháp (assutavā) nên được hiểu là do không có sự học hỏi (āgama) và không có sự chứng đắc (adhigama).
Yo hi idaṃ suttaṃ ādito paṭṭhāya atthavasena upaparikkhanto ‘‘idaṃ bhavaṅgacittaṃ nāma pakatiparisuddhampi javanakkhaṇe uppannehi lobhādīhi upakkilesehi upakkiliṭṭha’’nti neva āgamavasena na adhigamavasena jānāti, yassa ca khandhadhātuāyatanapaccayākārasatipaṭṭhānādīsu uggahaparipucchāvinicchayavirahitattā yathābhūtañāṇapaṭivedhasādhako neva āgamo, paṭipattiyā adhigantabbassa anadhigatattā na adhigamo atthi.
Indeed, a person who, examining this Sutta from the beginning in terms of its meaning, does not know, neither through scriptural knowledge nor through penetrative knowledge, that "this bhavaṅga-citta, though naturally pure, is defiled by adventitious defilements like greed that arise during the javana-moment," and for whom there is no scriptural knowledge that accomplishes penetration of reality-as-it-is, due to lacking learning, inquiry, and determination regarding aggregates, elements, sense-bases, dependent origination, foundations of mindfulness, etc., and for whom there is no penetrative knowledge, due to not having attained what is to be attained through practice.
Thật vậy, người nào từ đầu đến cuối, khi quán xét ý nghĩa của bài kinh này, không biết rằng: “Tâm Hộ phần này, dù vốn thanh tịnh tự nhiên, nhưng bị ô nhiễm bởi các phiền não như tham, v.v., sinh khởi trong sát-na tốc hành tâm”, không biết điều này qua sự học hỏi (āgama) cũng không qua sự chứng đắc (adhigama); và người nào do thiếu sự học hỏi, tìm hiểu, quyết định về các uẩn, giới, xứ, duyên khởi, niệm xứ, v.v., nên không có sự học hỏi (āgama) để thành tựu trí tuệ thấu suốt chân lý, và do chưa chứng đắc những gì cần chứng đắc qua sự thực hành, nên không có sự chứng đắc (adhigama).
So āgamādhigamābhāvā ñeyyo assutavā iti.
Such a person is to be known as "uninstructed" due to the absence of scriptural and penetrative knowledge.
Người đó nên được hiểu là người không nghe pháp (assutavā) do không có sự học hỏi và không có sự chứng đắc.
Svāyaṃ –
And such a person is called –
Người ấy –
52. Dutiye sutavāti sutasampanno.
52. In the second, sutavā means "learned" or "endowed with learning."
52. Trong bài kinh thứ hai, sutavā (người nghe pháp) có nghĩa là người đầy đủ sự nghe pháp.
Vitthārato panettha assutavāti padassa paṭipakkhavasena attho veditabbo.
The meaning here should be understood in detail as the opposite of the term "assutavā" (uninstructed).
Ở đây, ý nghĩa nên được hiểu một cách chi tiết theo nghĩa đối lập với từ “assutavā” (người không nghe pháp).
Ariyasāvakoti atthi ariyo na sāvako, seyyathāpi buddhā ceva paccekabuddhā ca; atthi sāvako na ariyo, seyyathāpi gihī anāgataphalo; atthi neva ariyo na sāvako seyyathāpi puthutitthiyā.
Ariyasāvako (noble disciple): There is a noble one who is not a disciple, such as the Buddhas and Paccekabuddhas; there is a disciple who is not a noble one, such as a lay person who has not yet attained a fruit; there is one who is neither noble nor a disciple, such as external ascetics.
Ariyasāvako (Thánh đệ tử) có những bậc là Thánh nhưng không phải đệ tử, ví dụ như các vị Phật Chánh Đẳng Giác và các vị Phật Độc Giác; có những bậc là đệ tử nhưng không phải Thánh, ví dụ như các cư sĩ chưa chứng đắc quả vị; có những bậc không phải Thánh cũng không phải đệ tử, ví dụ như các ngoại đạo.
Atthi ariyoceva sāvako ca, seyyathāpi samaṇā sakyaputtiyā āgataphalā viññātasāsanā.
And there is one who is both noble and a disciple, such as the samaṇas, the Sakyaputtiyas, who have attained fruits and understood the teaching.
Có những bậc vừa là Thánh vừa là đệ tử, ví dụ như các vị Sa-môn Thích tử đã chứng đắc quả vị, đã thấu hiểu giáo pháp.
Idha pana gihī vā hotu pabbajito vā, yo koci sutavāti ettha vuttassa atthassa vasena sutasampanno, ayaṃ ariyasāvakoti veditabbo.
Here, however, whether lay or renunciant, anyone who is endowed with learning in the sense of what is meant by "sutavā" should be understood as an ariyasāvaka.
Ở đây, dù là cư sĩ hay xuất gia, bất cứ ai đầy đủ sự nghe pháp theo ý nghĩa của từ “sutavā” (người nghe pháp) được đề cập ở đây, thì người đó nên được hiểu là Thánh đệ tử.
Yathābhūtaṃ pajānātīti ‘‘evamidaṃ bhavaṅgacittaṃ āgantukehi upakkilesehi vippamuttaṃ hoti, evaṃ upakkiliṭṭha’’nti yathāsabhāvato jānāti.
Yathābhūtaṃ pajānāti (understands things as they really are) means he knows according to its true nature that "this bhavaṅga-citta is thus liberated from adventitious defilements, and thus defiled."
Yathābhūtaṃ pajānāti (như thật biết) có nghĩa là như thật biết rằng: “Tâm Hộ phần này thoát ly khỏi các phiền não khách trần như vậy, và bị ô nhiễm như vậy.”
Cittabhāvanā atthīti cittaṭṭhiti cittapariggaho atthi, atthibhāveneva ‘‘atthī’’ti vadāmīti dasseti.
Cittabhāvanā atthī (there is development of mind) means there is steadfastness of mind, full comprehension of mind, and it shows that "I say 'there is' precisely because there is such a state."
Cittabhāvanā atthī (có sự tu tập tâm) có nghĩa là có sự an trú tâm, có sự nắm giữ tâm; và chỉ ra rằng: “Tôi nói là ‘có’ vì có.”
Imasmiṃ sutte balavavipassanā kathitā.
In this Sutta, strong vipassanā is taught.
Trong bài kinh này, thiền quán mạnh mẽ (balavavipassanā) đã được thuyết giảng.
Keci taruṇavipassanāti vadanti.
Some call it "young vipassanā."
Một số người gọi đó là thiền quán sơ khởi (taruṇavipassanā).
53. Tatiyaṃ aṭṭhuppattiyaṃ kathitaṃ.
53. The third discourse is explained in the origin story.
53. Bài kinh thứ ba đã được kể lại trong phần khởi nguyên (aṭṭhuppatti).
Katarāyaṃ pana aṭṭhuppattiyaṃ?
In which origin story, then?
Vậy thì trong phần khởi nguyên nào?
Aggikkhandhopamasuttantaaṭṭhuppattiyaṃ.
In the origin story of the Aggikkhandhopama Sutta.
Trong phần khởi nguyên của bài kinh Aggikkhandhopama.
Bhagavā kira ekasmiṃ samaye sāvatthiṃ upanissāya jetavanamahāvihāre paṭivasati.
Indeed, the Blessed One resided in the Jeta Grove, near Sāvatthī, at one time.
Đức Thế Tôn được biết là vào một thời gian nọ, Ngài trú ngụ tại Đại Tịnh Xá Jetavana, gần Sāvatthī.
Buddhānañca yattha katthaci paṭivasantānaṃ pañcavidhaṃ kiccaṃ avijahitameva hoti.
For Buddhas, wherever they reside, five duties are invariably present.
Và đối với các vị Phật, dù trú ngụ ở bất cứ nơi đâu, năm loại phận sự không bao giờ bị bỏ qua.
Pañca hi buddhakiccāni – purebhattakiccaṃ, pacchābhattakiccaṃ, purimayāmakiccaṃ, majjhimayāmakiccaṃ, pacchimayāmakiccanti.
There are indeed five duties of a Buddha: the duty before the meal, the duty after the meal, the duty of the first watch, the duty of the middle watch, and the duty of the last watch.
Thật vậy, có năm phận sự của chư Phật: phận sự trước bữa ăn, phận sự sau bữa ăn, phận sự canh đầu, phận sự canh giữa, phận sự canh cuối.
Tatridaṃ purebhattakiccaṃ – bhagavā hi pātova vuṭṭhāya upaṭṭhākānuggahatthaṃ sarīraphāsukatthañca mukhadhovanādisarīraparikammaṃ katvā yāva bhikkhācāravelā tāva vivittāsane vītināmetvā bhikkhācāravelāya nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ pārupitvā pattamādāya kadāci ekakova, kadāci bhikkhusaṅghaparivuto gāmaṃ vā nigamaṃ vā piṇḍāya pavisati kadāci pakatiyā, kadāci anekehi pāṭihāriyehi vattamānehi.
Herein, the duty before the meal is this: the Blessed One, having risen early in the morning, for the benefit of His attendants and for the comfort of His body, performed His bodily duties such as washing His face, and having spent time in seclusion until the alms-round time, He put on His lower robe, fastened His waist-band, draped His outer robe, and taking His bowl, sometimes alone, sometimes surrounded by the community of bhikkhus, He entered a village or town for alms, sometimes in the ordinary manner, sometimes with numerous miraculous displays occurring.
Trong đó, đây là phận sự trước bữa ăn: Đức Thế Tôn, sau khi thức dậy vào buổi sáng, vì lợi ích của các vị thị giả và vì sự thoải mái của thân thể, Ngài thực hiện các công việc vệ sinh thân thể như rửa mặt, v.v., rồi dành thời gian ở một nơi vắng vẻ cho đến giờ đi khất thực. Đến giờ khất thực, Ngài đắp y, thắt đai y, khoác y, cầm bát, đôi khi một mình, đôi khi có Tăng đoàn vây quanh, Ngài đi vào làng hoặc thị trấn để khất thực, đôi khi theo cách thông thường, đôi khi với nhiều phép lạ đang diễn ra.
Seyyathidaṃ – piṇḍāya pavisato lokanāthassa purato purato gantvā mudugatavātā pathaviṃ sodhenti, valāhakā udakaphusitāni muñcantā magge reṇuṃ vūpasametvā upari vitānaṃ hutvā tiṭṭhanti, apare vātā pupphāni upasaṃharitvā magge okiranti, unnatā bhūmippadesā onamanti, onatā unnamanti, pādanikkhepasamaye samāva bhūmi hoti, sukhasamphassāni padumapupphāni vā pāde sampaṭicchanti.
Thus, as the Protector of the World enters for alms, gentle breezes go forth, sweeping the ground clean; clouds release drops of water, settling the dust on the path, and remain above as a canopy; other winds gather flowers and scatter them on the path; elevated areas of ground become level, and low areas rise up; at the moment of setting foot, the ground becomes even; or soft, pleasant lotus flowers receive his feet.
Đó là – khi Đức Thế Tôn (Lokanātha) đi khất thực, những làn gió nhẹ nhàng đi trước, làm sạch mặt đất; những đám mây thả những hạt nước làm lắng bụi trên đường, rồi đứng lại phía trên như một tán lọng; những làn gió khác mang hoa đến rải trên đường; những vùng đất nhô cao thì hạ thấp xuống, những vùng đất trũng thì nâng cao lên; khi đặt chân xuống, mặt đất trở nên bằng phẳng, hoặc những đóa hoa sen êm ái đón lấy bàn chân.
Indakhīlassa anto ṭhapitamatte dakkhiṇapāde sarīrato chabbaṇṇarasmiyo nikkhamitvā suvaṇṇarasapiñjarāni viya citrapaṭaparikkhittāni viya ca pāsādakūṭāgārādīni alaṅkarontiyo ito cito ca dhāvanti, hatthiassavihaṅgādayo sakasakaṭṭhānesu ṭhitāyeva madhurenākārena saddaṃ karonti, tathā bherivīṇādīni tūriyāni manussānañca kāyūpagāni ābharaṇāni.
As soon as his right foot is placed within the threshold stone, six-colored rays emerge from his body, adorning palaces, pinnacled mansions, and other structures as if cast in molten gold or encircled by embroidered cloths, and they dart here and there. Elephants, horses, birds, and others, remaining in their respective places, make sweet sounds, as do drums, lutes, and other musical instruments, and the ornaments worn by people.
Khi bàn chân phải vừa đặt vào ngưỡng cửa (Indakhīla), sáu màu hào quang từ thân Ngài phóng ra, như được dát vàng hoặc như được bao phủ bởi những tấm vải thêu, trang hoàng các tháp, lầu các, v.v., và tỏa sáng khắp nơi. Voi, ngựa, chim chóc, v.v., đang đứng yên tại chỗ của chúng, cất tiếng kêu ngọt ngào; các nhạc cụ như trống (bherī), đàn vīṇā, v.v., và các trang sức trên người của chúng sinh cũng vậy.
Tena saññāṇena manussā jānanti ‘‘ajja bhagavā idha piṇḍāya paviṭṭho’’ti.
By that sign, people know, “Today the Blessed One has entered here for alms.”
Nhờ dấu hiệu đó, mọi người biết rằng: “Hôm nay, Đức Thế Tôn đã vào đây để khất thực.”
Te sunivatthā supārutā gandhapupphādīni ādāya gharā nikkhamitvā antaravīthiṃ paṭipajjitvā bhagavantaṃ gandhapupphādīhi sakkaccaṃ pūjetvā vanditvā ‘‘amhākaṃ, bhante, dasa bhikkhū, amhākaṃ vīsati, paññāsaṃ…pe… sataṃ dethā’’ti yācitvā bhagavatopi pattaṃ gahetvā āsanaṃ paññāpetvā sakkaccaṃ piṇḍapātena paṭimānenti.
Well-clothed and well-robed, they take perfumes, flowers, and other offerings, leave their homes, proceed along the main street, reverently worship the Blessed One with perfumes and flowers, bow to him, and request, “Venerable Sir, give us ten bhikkhus, give us twenty, fifty… and so forth… give us a hundred.” Having received the Buddha’s bowl, they arrange seats and reverently wait upon him with almsfood.
Họ, ăn mặc chỉnh tề, khoác y cẩn thận, mang theo hương hoa, v.v., rời nhà, đi ra giữa đường, cung kính cúng dường Đức Thế Tôn bằng hương hoa, v.v., đảnh lễ Ngài, rồi thỉnh cầu: “Bạch Thế Tôn, xin Ngài ban cho chúng con mười vị tỳ khưu, hai mươi vị, năm mươi vị... hoặc một trăm vị.” Sau đó, họ nhận bát của Đức Thế Tôn, sắp đặt chỗ ngồi, và cung kính chờ đợi Ngài thọ thực.
Bhagavā katabhattakicco tesaṃ upanissayacittasantānāni oloketvā tathā dhammaṃ deseti, yathā keci saraṇagamanesu patiṭṭhahanti, keci pañcasu sīlesu, keci sotāpattisakadāgāmianāgāmiphalānaṃ aññatarasmiṃ, keci pabbajitvā aggaphale arahatteti.
After completing his meal, the Blessed One observes the mental dispositions and inclinations of those people and teaches the Dhamma in such a way that some establish themselves in the refuges, some in the five precepts, some in one of the fruits of Stream-entry, Once-returning, or Non-returning, and some, having gone forth, attain Arahantship, the highest fruit.
Sau khi thọ thực xong, Đức Thế Tôn quán xét tâm thức và căn cơ của họ, rồi thuyết Pháp sao cho một số người quy y Tam Bảo, một số giữ năm giới, một số chứng đắc một trong các quả vị Dự Lưu (Sotāpatti), Nhất Lai (Sakadāgāmī), Bất Hoàn (Anāgāmī), và một số xuất gia rồi chứng đắc quả vị tối thượng là A-la-hán.
Evaṃ mahājanaṃ anuggahetvā uṭṭhāyāsanā vihāraṃ gacchati.
Having thus favored the multitude, he rises from his seat and goes to the monastery.
Sau khi giúp đỡ đại chúng như vậy, Ngài đứng dậy khỏi chỗ ngồi và trở về tu viện.
Tattha gantvā gandhamaṇḍalamāḷe paññattavarabuddhāsane nisīdati bhikkhūnaṃ bhattakiccapariyosānaṃ āgamayamāno.
Having gone there, he sits on the supreme Buddha-seat arranged in the Fragrant Pavilion, awaiting the completion of the bhikkhus’ mealtime.
Khi đến đó, Ngài ngồi trên Phật tọa cao quý đã được sắp đặt trong sảnh hương (Gandhamaṇḍalamāḷa), chờ đợi các tỳ khưu thọ thực xong.
Tato bhikkhūnaṃ bhattakiccapariyosāne upaṭṭhāko bhagavato nivedeti.
Then, at the completion of the bhikkhus’ mealtime, the attendant informs the Blessed One.
Sau đó, khi các tỳ khưu đã thọ thực xong, vị thị giả báo cho Đức Thế Tôn biết.
Atha bhagavā gandhakuṭiṃ pavisati.
Thereupon, the Blessed One enters the Fragrant Hut.
Rồi Đức Thế Tôn vào hương thất (Gandhakuṭi).
Idaṃ tāva purebhattakiccaṃ.
This, then, is the forenoon duty.
Đây là Phật sự trước bữa ăn (purebhattakicca).
Atha bhagavā evaṃ katapurebhattakicco gandhakuṭiyā upaṭṭhāne nisīditvā pāde pakkhāletvā pādapīṭhe ṭhatvā bhikkhusaṅghaṃ ovadati – ‘‘bhikkhave, appamādena sampādetha, dullabho buddhuppādo lokasmiṃ, dullabho manussattapaṭilābho, dullabhā khaṇasampatti, dullabhā pabbajjā, dullabhaṃ saddhammassavana’’nti.
Then, having completed his forenoon duty in this way, the Blessed One sits near the Fragrant Hut, washes his feet, and standing on the foot-stool, he exhorts the Saṅgha of bhikkhus: “Bhikkhus, strive with diligence! The arising of a Buddha in the world is rare, the attainment of human existence is rare, the opportunity (khaṇasampatti) is rare, going forth is rare, the hearing of the True Dhamma is rare.”
Sau khi hoàn thành Phật sự trước bữa ăn như vậy, Đức Thế Tôn ngồi gần hương thất (Gandhakuṭi), rửa chân, đứng trên bệ rửa chân, và dạy bảo Tăng đoàn: “Này các tỳ khưu, hãy hoàn thành (việc tu tập) với sự không phóng dật (appamāda)! Sự xuất hiện của chư Phật trên thế gian là khó có được, sự tái sinh làm người là khó có được, sự hội đủ các điều kiện thuận lợi là khó có được, sự xuất gia là khó có được, và sự nghe Chánh Pháp là khó có được.”
Tattha keci bhagavantaṃ kammaṭṭhānaṃ pucchanti.
Among them, some ask the Blessed One for a meditation subject.
Trong số đó, một số vị hỏi Đức Thế Tôn về đề mục thiền định (kammaṭṭhāna).
Bhagavā tesaṃ cariyānurūpaṃ kammaṭṭhānaṃ deti.
The Blessed One gives them a meditation subject suitable to their character.
Đức Thế Tôn ban cho họ đề mục thiền định phù hợp với căn tánh của họ.
Tato sabbepi bhagavantaṃ vanditvā attano attano rattiṭṭhānadivāṭṭhānāni gacchanti.
Then, all of them bow to the Blessed One and go to their respective night and day abiding places.
Sau đó, tất cả đều đảnh lễ Đức Thế Tôn và trở về nơi trú ngụ ban đêm và ban ngày của mình.
Keci araññaṃ, keci rukkhamūlaṃ, keci pabbatādīnaṃ aññataraṃ, keci cātumahārājikabhavanaṃ…pe… keci vasavattibhavananti.
Some go to the forest, some to the root of a tree, some to one of the mountains or other places, some to the realm of the Four Great Kings… and so forth… some to the Vasavatti realm.
Một số vị đi vào rừng, một số đến gốc cây, một số đến một trong các ngọn núi, v.v., một số đến cõi Tứ Đại Thiên Vương (Cātumahārājika-bhavana)... một số đến cõi Tha Hóa Tự Tại Thiên (Vasavatti-bhavana).
Tato bhagavā gandhakuṭiṃ pavisitvā sace ākaṅkhati, dakkhiṇena passena sato sampajāno muhuttaṃ sīhaseyyaṃ kappeti.
Then, the Blessed One enters the Fragrant Hut and, if he wishes, lies down on his right side, mindful and clearly comprehending, in the lion’s posture for a moment.
Sau đó, Đức Thế Tôn vào hương thất (Gandhakuṭi), nếu Ngài muốn, Ngài sẽ nằm nghỉ kiểu sư tử (sīhaseyya) trong chốc lát, nằm nghiêng về bên phải, với tâm tỉnh giác và chánh niệm (sato sampajāno).
Atha samassāsitakāyo uṭṭhahitvā dutiyabhāge lokaṃ voloketi.
Then, with his body rested, he arises and surveys the world during the second part of the day.
Rồi, với thân thể đã được nghỉ ngơi, Ngài đứng dậy và quán sát thế gian trong phần thứ hai (của đêm).
Tatiyabhāge yaṃ gāmaṃ vā nigamaṃ vā upanissāya viharati, tattha mahājano purebhattaṃ dānaṃ datvā pacchābhattaṃ sunivattho supāruto gandhapupphādīni ādāya vihāre sannipatati.
In the third part of the day, in the village or town where he resides for alms, the multitude, having offered alms in the forenoon, gather at the monastery in the afternoon, well-clothed and well-robed, carrying perfumes, flowers, and other offerings.
Vào phần thứ ba (của đêm), đại chúng ở làng hoặc thị trấn mà Ngài đang trú ngụ, sau khi đã cúng dường trước bữa ăn, ăn mặc chỉnh tề, khoác y cẩn thận, mang theo hương hoa, v.v., tập trung tại tu viện.
Tato bhagavā sampattaparisāya anurūpena pāṭihāriyena gantvā dhammasabhāyaṃ paññattavarabuddhāsane nisajja dhammaṃ deseti kālayuttaṃ samayayuttaṃ, atha kālaṃ viditvā parisaṃ uyyojeti, manussā bhagavantaṃ vanditvā pakkamanti.
Then, the Blessed One goes there with a suitable miracle for the assembled gathering and, sitting on the supreme Buddha-seat arranged in the Dhamma hall, teaches the Dhamma, appropriate to the time and occasion. Then, knowing the time, he dismisses the assembly, and the people, having bowed to the Blessed One, depart.
Sau đó, Đức Thế Tôn đến đó bằng một phép lạ phù hợp với hội chúng đang có mặt, ngồi trên Phật tọa cao quý đã được sắp đặt trong Pháp đường, và thuyết Pháp đúng thời, đúng lúc. Rồi, biết đã đến lúc, Ngài cho phép hội chúng ra về, và mọi người đảnh lễ Đức Thế Tôn rồi rời đi.
Idaṃ pacchābhattakiccaṃ.
This is the afternoon duty.
Đây là Phật sự sau bữa ăn (pacchābhattakicca).
So evaṃ niṭṭhitapacchābhattakicco sace gattāni osiñcitukāmo hoti, buddhāsanā uṭṭhāya nhānakoṭṭhakaṃ pavisitvā upaṭṭhākena paṭiyāditaudakena gattāni utuṃ gaṇhāpeti.
Having thus completed his afternoon duty, if he wishes to bathe his limbs, he rises from the Buddha-seat, enters the bathing room, and has his limbs bathed with water prepared by the attendant to suit the season.
Sau khi hoàn thành Phật sự sau bữa ăn như vậy, nếu Ngài muốn tắm rửa thân thể, Ngài đứng dậy khỏi Phật tọa, vào phòng tắm, và để thị giả chuẩn bị nước tắm cho thân thể Ngài tùy theo mùa.
Upaṭṭhākopi buddhāsanaṃ ānetvā gandhakuṭipariveṇe paññapeti.
The attendant also brings the Buddha-seat and arranges it in the area of the Fragrant Hut.
Vị thị giả cũng mang Phật tọa đến và sắp đặt trong khu vực hương thất (Gandhakuṭi).
Bhagavā surattadupaṭṭaṃ nivāsetvā kāyabandhanaṃ bandhitvā uttarāsaṅgaṃ ekaṃsaṃ katvā tattha āgantvā nisīdati ekakova muhuttaṃ paṭisallīno, atha bhikkhū tato tato āgamma bhagavato upaṭṭhānaṃ āgacchanti.
The Blessed One puts on his inner robe of deep red, fastens his waist-band, arranges his outer robe over one shoulder, comes there and sits alone, secluded for a moment. Then, bhikkhus come from various places and approach the Blessed One for attendance.
Đức Thế Tôn mặc y nội (dūpaṭṭa) màu đỏ thắm, thắt dây lưng, vắt y vai (uttarāsaṅga) qua một bên vai, rồi đến đó ngồi một mình, tĩnh lặng trong chốc lát. Sau đó, các tỳ khưu từ khắp nơi đến hầu hạ Đức Thế Tôn.
Tattha ekacce pañhaṃ pucchanti, ekacce kammaṭṭhānaṃ, ekacce dhammassavanaṃ yācanti.
Some among them ask questions, some ask for meditation subjects, some request to hear the Dhamma.
Trong số đó, một số vị hỏi về các vấn đề, một số hỏi về đề mục thiền định (kammaṭṭhāna), một số thỉnh cầu được nghe Pháp.
Bhagavā tesaṃ adhippāyaṃ sampādento purimayāmaṃ vitināmeti.
Fulfilling their wishes, the Blessed One spends the first watch of the night.
Đức Thế Tôn đáp ứng nguyện vọng của họ, và trải qua canh đầu (purimayāma).
Idaṃ purimayāmakiccaṃ.
This is the first watch duty.
Đây là Phật sự canh đầu (purimayāmakicca).
Pacchimayāmaṃ pana tayo koṭṭhāse katvā purebhattato paṭṭhāya nisajjāpīḷitassa sarīrassa kilāsubhāvamocanatthaṃ ekaṃ koṭṭhāsaṃ caṅkamena vītināmeti, dutiyakoṭṭhāse gandhakuṭiṃ pavisitvā dakkhiṇena passena sato sampajāno sīhaseyyaṃ kappeti.
As for the last watch, dividing it into three parts, to relieve the fatigue of the body from sitting since the forenoon, he spends one part walking. In the second part, he enters the Fragrant Hut and lies down on his right side, mindful and clearly comprehending, in the lion’s posture.
Đối với canh cuối (pacchimayāma), Ngài chia làm ba phần: một phần Ngài đi kinh hành để giải tỏa sự mệt mỏi của thân thể do ngồi lâu từ bữa ăn sáng; trong phần thứ hai, Ngài vào hương thất (Gandhakuṭi) và nằm nghỉ kiểu sư tử (sīhaseyya), nằm nghiêng về bên phải, với tâm tỉnh giác và chánh niệm; trong phần thứ ba, Ngài thức dậy và ngồi, quán sát thế gian bằng Phật nhãn để thấy những người đã tích lũy công đức như bố thí (dāna), trì giới (sīla), v.v., dưới sự hướng dẫn của chư Phật quá khứ.
Tatiyakoṭṭhāse paccuṭṭhāya nisīditvā purimabuddhānaṃ santike dānasīlādivasena katādhikārapuggaladassanatthaṃ buddhacakkhunā lokaṃ voloketi.
In the third part, he rises and sits, surveying the world with his Buddha-eye to see those individuals who have cultivated merit through giving, sīla, and so forth, in the presence of past Buddhas.
Trong phần thứ ba, Ngài thức dậy và ngồi, quán sát thế gian bằng Phật nhãn để thấy những người đã tích lũy công đức như bố thí (dāna), trì giới (sīla), v.v., dưới sự hướng dẫn của chư Phật quá khứ.
Idaṃ pacchimayāmakiccaṃ.
This is the last watch duty.
Đây là Phật sự canh cuối (pacchimayāmakicca).
Tampi divasaṃ bhagavā imasmiṃyeva kicce ṭhito lokaṃ olokento idaṃ addasa – mayā kosalaraṭṭhe cārikaṃ carantena aggikkhandhena upametvā ekasmiṃ sutte desite saṭṭhi bhikkhū arahattaṃ pāpuṇissanti, saṭṭhimattānaṃ uṇhaṃ lohitaṃ mukhato uggacchissati, saṭṭhimattā gihibhāvaṃ gamissanti.
On that day, while the Blessed One was engaged in this very duty and surveying the world, he saw this: Sixty bhikkhus would attain Arahantship upon hearing a discourse given by him in Kosala country, compared to a mass of fire. Sixty would experience hot blood issuing from their mouths, and sixty would return to lay life.
Vào ngày đó, Đức Thế Tôn đang thực hiện Phật sự này, khi quán sát thế gian, Ngài thấy rằng: “Khi Ta du hành trong xứ Kosala, sau khi thuyết một bài kinh ví dụ về đống lửa, sáu mươi tỳ khưu sẽ chứng đắc A-la-hán, máu nóng sẽ trào ra từ miệng của sáu mươi vị, và sáu mươi vị sẽ trở lại đời sống cư sĩ.”
Tattha ye arahattaṃ pāpuṇissanti, te yaṃkiñci dhammadesanaṃ sutvā pāpuṇissanteva.
Those who would attain Arahantship would do so upon hearing any Dhamma discourse.
Trong số đó, những vị sẽ chứng đắc A-la-hán thì dù nghe bất kỳ lời thuyết pháp nào cũng sẽ chứng đắc.
Itaresaṃ pana bhikkhūnaṃ saṅgahatthāya cārikaṃ caritukāmo hutvā, ‘‘ānanda, bhikkhūnaṃ ārocehī’’ti āha.
However, desiring to wander for the welfare of the other bhikkhus, he said, “Ānanda, inform the bhikkhus.”
Nhưng để giúp đỡ các tỳ khưu còn lại, Ngài muốn du hành và nói: “Này Ānanda, hãy báo cho các tỳ khưu biết.”
Thero anupariveṇaṃ gantvā, ‘‘āvuso, satthā mahājanassa saṅgahatthāya cārikaṃ caritukāmo, gantukāmā āgacchathā’’ti āha.
The Elder went around the monastic enclosure and said, “Friends, the Teacher wishes to wander for the welfare of the multitude. Those who wish to go, come forward.”
Trưởng lão đi vòng quanh các khu nhà và nói: “Này các hiền giả, Đức Đạo Sư muốn du hành để giúp đỡ đại chúng. Những ai muốn đi, hãy đến đây.”
Bhikkhū mahālābhaṃ labhitvā viya tuṭṭhamānasā ‘‘labhissāma vata mahājanassa dhammaṃ desentassa bhagavato suvaṇṇavaṇṇaṃ sarīraṃ oloketuṃ madhurañca dhammakathaṃ sotu’’nti paruḷhakesā kese ohāretvā malaggahitapattā patte pacitvā kiliṭṭhacīvarā cīvarāni dhovitvā gamanasajjā ahesuṃ.
The bhikkhus, delighted as if they had received a great gain, thinking, “We shall indeed have the opportunity to see the Blessed One’s golden-hued body as he teaches the Dhamma to the multitude, and to hear his sweet Dhamma talk,” cut their overgrown hair, cleaned their dirty bowls, washed their soiled robes, and were ready for the journey.
Các tỳ khưu, với tâm hoan hỷ như vừa nhận được lợi lộc lớn, nghĩ: “Chắc chắn chúng ta sẽ được nhìn thấy thân vàng của Đức Thế Tôn khi Ngài thuyết Pháp cho đại chúng, và được nghe Pháp thoại ngọt ngào của Ngài.” Họ cạo tóc đã mọc dài, rửa sạch bát đã dơ, giặt y đã bẩn, và sẵn sàng lên đường.
Satthā aparicchinnena bhikkhusaṅghena parivuto kosalaraṭṭhaṃ cārikāya nikkhanto gāmanigamapaṭipāṭiyā ekadivasaṃ gāvutaaḍḍhayojanatigāvutayojanaparamaṃ cārikaṃ caranto ekasmiṃ padese mahantaṃ susirarukkhaṃ agginā sampajjalitaṃ disvā ‘‘imameva vatthuṃ katvā sattahi aṅgehi paṭimaṇḍetvā dhammadesanaṃ kathessāmī’’ti gamanaṃ pacchinditvā aññataraṃ rukkhamūlaṃ upasaṅkamitvā nisajjākāraṃ dassesi.
The Teacher, surrounded by an immeasurable assembly of bhikkhus, set out on a wandering tour in the Kosala country, traversing from village to village and town to town, one day covering a distance of a gāvuta, half a yojana, three gāvutas, or a full yojana. He saw a large hollow tree burning fiercely with fire in a certain place. Thinking, "I shall take this very object as a theme and, having adorned it with seven points, deliver a discourse on the Dhamma," he halted his journey, approached a certain tree root, and indicated his intention to sit.
Đức Bổn Sư, được hội chúng Tỳ-kheo vô số vây quanh, đã khởi hành du hành đến xứ Kosala. Ngài đi du hành mỗi ngày một gāvuta, nửa yojana, ba gāvuta, tối đa một yojana, theo thứ tự làng mạc và thị trấn. Tại một nơi, thấy một cây cổ thụ lớn rỗng ruột đang cháy rực lửa, Ngài nghĩ: “Ta sẽ lấy chính cái này làm đề tài, trang hoàng với bảy chi phần, và thuyết pháp.” Ngài liền ngừng cuộc hành trình, đến một gốc cây nào đó và ra hiệu ngồi xuống.
Ānandatthero satthu adhippāyaṃ ñatvā ‘‘addhā kāraṇaṃ bhavissati, na akāraṇena tathāgatā gamanaṃ pacchinditvā nisīdantī’’ti catugguṇaṃ saṅghāṭiṃ paññāpesi.
Knowing the Teacher’s intention, Venerable Ānanda thought, “Surely there must be a reason; the Tathāgatas do not halt their journey and sit down without a cause,” and he arranged the fourfold saṅghāṭi.
Trưởng lão Ānanda, biết ý của Đức Bổn Sư, nghĩ: “Chắc chắn có lý do, chư Như Lai không bao giờ ngừng cuộc hành trình và ngồi xuống mà không có lý do.” Ngài liền trải y Saṅghāṭi gấp tư.
Satthā nisīditvā bhikkhū āmantetvā ‘‘passatha no tumhe, bhikkhave, amuṃ mahantaṃ aggikkhandha’’nti aggikkhandhopamasuttantaṃ (a. ni. 7.72) deseti.
The Teacher sat down and addressed the bhikkhus, saying, ‘‘Bhikkhus, do you see that great mass of fire?’’ Then he taught the Aggikkhandhopamasuttanta.
Đức Bổn Sư ngồi xuống, gọi các Tỳ-kheo và hỏi: “Này các Tỳ-kheo, các ông có thấy khối lửa lớn kia không?” Ngài liền thuyết Kinh Aggikkhandhopama (Kinh ví dụ về khối lửa).
Imasmiñca pana veyyākaraṇe bhaññamāne saṭṭhimattānaṃ bhikkhūnaṃ uṇhaṃ lohitaṃ mukhato uggañchi, saṭṭhimattā bhikkhū sikkhaṃ paccakkhāya hīnāyāvattiṃsu, saṭṭhimattānaṃ bhikkhūnaṃ anupādāya āsavehi cittāni vimucciṃsu.
While this explanation was being delivered, hot blood gushed from the mouths of sixty bhikkhus, sixty bhikkhus renounced the training and returned to a lower state, and the minds of sixty bhikkhus were liberated from the defilements without clinging.
Trong khi bài pháp này được thuyết, máu nóng phun ra từ miệng sáu mươi Tỳ-kheo, sáu mươi Tỳ-kheo từ bỏ giới học và trở lại đời sống thấp kém, và tâm của sáu mươi Tỳ-kheo được giải thoát khỏi các lậu hoặc mà không còn chấp thủ.
Tañhi veyyākaraṇaṃ sutvā saṭṭhimattānaṃ bhikkhūnaṃ nāmakāyo santatto, nāmakāye santatte karajakāyo santatto, karajakāye santatte nidhānagataṃ uṇhaṃ lohitaṃ mukhato uggañchi.
Indeed, upon hearing that explanation, the mind-body (nāmakāya) of sixty bhikkhus became heated. When the mind-body became heated, the physical body (karajakāya) became heated. When the physical body became heated, the accumulated hot blood gushed from their mouths.
Thật vậy, sau khi nghe bài pháp đó, thân danh (nāmakāya) của sáu mươi Tỳ-kheo trở nên nóng bỏng; khi thân danh nóng bỏng, thân vật chất (karajakāya) cũng nóng bỏng; khi thân vật chất nóng bỏng, máu nóng tích tụ phun ra từ miệng.
Saṭṭhimattā bhikkhū ‘‘dukkaraṃ vata buddhasāsane yāvajīvaṃ paripuṇṇaṃ parisuddhaṃ brahmacariyaṃ caritu’’nti sikkhaṃ paccakkhāya hīnāyāvattā, saṭṭhimattā bhikkhū satthu desanābhimukhaṃ ñāṇaṃ pesetvā saha paṭisambhidāhi arahattaṃ pattā.
Sixty bhikkhus, thinking, ‘‘It is difficult to practice the complete and purified holy life in the Buddha’s Dispensation for a lifetime,’’ renounced the training and returned to a lower state. Sixty bhikkhus directed their knowledge towards the Teacher's teaching and attained Arahantship together with the analytical knowledges (paṭisambhidā).
Sáu mươi Tỳ-kheo nghĩ: “Thật khó thay để sống một đời phạm hạnh hoàn hảo và thanh tịnh trọn đời trong giáo pháp của Đức Phật,” liền từ bỏ giới học và trở lại đời sống thấp kém. Sáu mươi Tỳ-kheo khác hướng trí tuệ của mình về bài pháp của Đức Bổn Sư và đạt được quả A-la-hán cùng với các tuệ phân tích (paṭisambhidā).
Tattha yesaṃ uṇhaṃ lohitaṃ mukhato uggañchi, te pārājikaṃ āpajjiṃsu.
Among them, those whose hot blood gushed from their mouths incurred a pārājika offense.
Trong số đó, những vị mà máu nóng phun ra từ miệng đã phạm tội Pārājika.
Ye gihibhāvaṃ pattā, te khuddānukhuddakāni sikkhāpadāni maddantā vicariṃsu.
Those who reverted to the lay state wandered about, transgressing minor training rules.
Những vị đã trở thành cư sĩ thì sống vi phạm các giới học nhỏ nhặt.
Ye arahattaṃ pattā, te parisuddhasīlāva ahesuṃ.
Those who attained Arahantship remained perfectly pure in conduct.
Những vị đạt được quả A-la-hán thì giữ giới hoàn toàn thanh tịnh.
Satthu dhammadesanā imesaṃ tiṇṇampi saphalāva jātāti.
Thus, the Teacher’s discourse on the Dhamma was fruitful for all three groups.
Bài thuyết pháp của Đức Bổn Sư đã mang lại thành quả cho cả ba nhóm này.
Arahattaṃ pattānaṃ tāva saphalā hotu, itaresaṃ kathaṃ saphalā jātāti?
It is fruitful for those who attained Arahantship, but how was it fruitful for the others?
Đối với những vị đạt A-la-hán thì có thành quả, còn những vị kia thì thành quả như thế nào?
Tepi hi sace imaṃ dhammadesanaṃ na suṇeyyuṃ, pamattāva hutvā ṭhānaṃ jahituṃ na sakkuṇeyyuṃ.
If even they had not heard this discourse on the Dhamma, they would have remained heedless and would not have been able to abandon their position.
Nếu những vị ấy không nghe bài thuyết pháp này, họ sẽ tiếp tục phóng dật và không thể từ bỏ địa vị của mình.
Tato nesaṃ taṃ pāpaṃ vaḍḍhamānaṃ apāyesuyeva saṃsīdāpeyya.
Then, their demerit would have grown, plunging them into the lower realms.
Khi đó, nghiệp ác của họ sẽ tăng trưởng và sẽ nhấn chìm họ vào các cảnh khổ.
Imaṃ pana desanaṃ sutvā jātasaṃvegā ṭhānaṃ jahitvā sāmaṇerabhūmiyaṃ ṭhitā dasa sīlāni pūretvā yoniso manasikāre yuttappayuttā keci sotāpannā keci sakadāgāmino keci anāgāmino ahesuṃ, keci devaloke nibbattiṃsu, evaṃ pārājikāpannānampi saphalā ahosi.
However, having heard this discourse, they became agitated, abandoned their position, and standing on the ground of novice monks, they perfected the ten precepts and, being diligently engaged in wise attention, some became Stream-Enterers, some Once-Returners, some Non-Returners, and some were reborn in the deva world. In this way, it was fruitful even for those who incurred pārājika offenses.
Nhưng sau khi nghe bài thuyết pháp này, họ đã khởi tâm xúc động, từ bỏ địa vị Tỳ-kheo và đứng trên địa vị Sa-di, giữ trọn mười giới. Nhờ chú tâm đúng đắn, một số vị đã trở thành Tu-đà-hoàn, một số thành Tư-đà-hàm, một số thành A-na-hàm, và một số tái sinh vào cõi trời. Như vậy, ngay cả đối với những vị phạm Pārājika, bài pháp cũng có thành quả.
Itare pana sace imaṃ dhammadesanaṃ na suṇeyyuṃ, gacchante gacchante kāle anupubbena saṅghādisesampi pārājikampi pāpuṇitvā apāyesuyeva uppajjitvā mahādukkhaṃ anubhaveyyuṃ.
As for the others, if they had not heard this discourse on the Dhamma, as time went on, they would have gradually incurred saṅghādisesa and even pārājika offenses, and would have been reborn in the lower realms, experiencing great suffering.
Còn những vị khác, nếu không nghe bài thuyết pháp này, theo thời gian trôi qua, họ sẽ dần dần phạm các giới Saṅghādisesa và Pārājika, rồi tái sinh vào các cảnh khổ và chịu đựng đại khổ.
Imaṃ pana desanaṃ sutvā ‘‘aho sallekhitaṃ buddhasāsanaṃ, na sakkā amhehi yāvajīvaṃ imaṃ paṭipattiṃ pūretuṃ, sikkhaṃ paccakkhāya upāsakadhammaṃ pūretvā dukkhā muccissāmā’’ti gihibhāvaṃ upagamiṃsu.
However, having heard this discourse, they thought, "Oh, the Buddha's Dispensation is austere! We cannot fulfill this practice for a lifetime. Let us renounce the training, fulfill the duties of a lay follower, and be liberated from suffering," and they reverted to the lay state.
Nhưng sau khi nghe bài thuyết pháp này, họ nghĩ: “Ôi, giáo pháp của Đức Phật thật tinh nghiêm! Chúng ta không thể hoàn thành con đường tu tập này trọn đời. Chúng ta hãy từ bỏ giới học, hoàn thành bổn phận của một cư sĩ và thoát khỏi khổ đau.” Thế là họ trở lại đời sống cư sĩ.
Te tīsu saraṇesu patiṭṭhāya pañca sīlāni rakkhitvā upāsakadhammaṃ pūretvā keci sotāpannā keci sakadāgāmino keci anāgāmino jātā, keci devaloke nibbattāti.
Having established themselves in the three refuges and observed the five precepts, fulfilling the duties of a lay follower, some became Stream-Enterers, some Once-Returners, some Non-Returners, and some were reborn in the deva world.
Những vị ấy nương tựa vào Tam Bảo, giữ năm giới, hoàn thành bổn phận của một cư sĩ. Một số vị đã trở thành Tu-đà-hoàn, một số thành Tư-đà-hàm, một số thành A-na-hàm, và một số tái sinh vào cõi trời.
Evaṃ tesampi saphalāva ahosi.
Thus, for them too, it was fruitful.
Như vậy, đối với họ, bài pháp cũng có thành quả.
Imaṃ pana satthu dhammadesanaṃ sutvā devasaṅghā yehipi sutā, yehipi na sutā, sabbesaṃyeva ārocentā vicariṃsu.
Moreover, having heard this discourse on the Dhamma from the Teacher, the assemblies of devas, both those who had heard it and those who had not, went about proclaiming it to everyone.
Sau khi nghe bài thuyết pháp này của Đức Bổn Sư, chư thiên, cả những vị đã nghe và những vị chưa nghe, đều đi khắp nơi loan báo.
Bhikkhū sutvā sutvā ‘‘dukkaraṃ, bho, buddhānaṃ sāsane yāvajīvaṃ paripuṇṇaṃ parisuddhaṃ brahmacariyaṃ caritu’’nti ekakkhaṇeneva dasapi bhikkhū vīsatipi saṭṭhipi satampi sahassampi bhikkhū gihī honti.
Bhikkhus, hearing it again and again, thought, "Friends, it is difficult to practice the complete and purified holy life in the Buddha’s Dispensation for a lifetime," and in a single moment, ten, twenty, sixty, a hundred, even a thousand bhikkhus became lay followers.
Các Tỳ-kheo nghe xong, đều nghĩ: “Thật khó thay để sống một đời phạm hạnh hoàn hảo và thanh tịnh trọn đời trong giáo pháp của chư Phật,” và ngay lập tức mười, hai mươi, sáu mươi, một trăm, thậm chí một ngàn Tỳ-kheo trở thành cư sĩ.
Satthā yathāruciyā cārikaṃ caritvā puna jetavanameva āgantvā bhikkhū āmantesi – ‘‘bhikkhave, tathāgato cārikaṃ caramāno ciraṃ ākiṇṇo vihāsi, icchāmahaṃ, bhikkhave, aḍḍhamāsaṃ paṭisallīyituṃ, nāmhi kenaci upasaṅkamitabbo aññatra ekena piṇḍapātanīhārakenā’’ti.
The Teacher, having wandered as he pleased, returned to Jetavana and addressed the bhikkhus: ‘‘Bhikkhus, the Tathāgata has been constantly engaged in wandering for a long time. I wish, bhikkhus, to seclude myself for half a month. Let no one approach me except for one who brings almsfood.’’
Đức Bổn Sư du hành tùy thích, rồi trở về lại Jetavana và gọi các Tỳ-kheo: “Này các Tỳ-kheo, Như Lai đã du hành trong một thời gian dài. Này các Tỳ-kheo, Như Lai muốn nhập thất trong nửa tháng. Không ai được đến gần Như Lai, trừ một người mang bát đi khất thực.”
Aḍḍhamāsaṃ ekībhāvena vītināmetvā paṭisallānā vuṭṭhito ānandattherena saddhiṃ vihāracārikaṃ caramāno olokitolokitaṭṭhāne tanubhūtaṃ bhikkhusaṅghaṃ disvā jānantoyeva theraṃ pucchi – ‘‘ānanda, aññasmiṃ kāle tathāgate cārikaṃ caritvā jetavanaṃ āgate sakalavihāro kāsāvapajjoto isivātappaṭivāto hoti, idāni pana tanubhūto bhikkhusaṅgho dissati, yebhuyyena ca uppaṇḍupaṇḍukajātā bhikkhū, kiṃ nu kho eta’’nti?
Having spent half a month in solitude, he emerged from seclusion and, while wandering through the monastery with Venerable Ānanda, he saw the assembly of bhikkhus greatly diminished in all the places he looked. Knowing this, he asked the Elder, ‘‘Ānanda, at other times, when the Tathāgata returned to Jetavana after wandering, the entire monastery glowed with saffron robes and was cooled by the breeze of ascetics. But now, the assembly of bhikkhus appears diminished, and most bhikkhus have become pale and wan. What is the reason for this?’’
Sau khi trải qua nửa tháng trong sự độc cư và xuất thất, Đức Bổn Sư cùng với Trưởng lão Ānanda đi dạo quanh tu viện. Ngài thấy hội chúng Tỳ-kheo thưa thớt ở những nơi Ngài nhìn đến, và phần lớn các Tỳ-kheo đều có vẻ xanh xao, vàng vọt. Ngài biết rõ nhưng vẫn hỏi Trưởng lão: “Này Ānanda, những lúc khác, khi Như Lai du hành trở về Jetavana, toàn bộ tu viện rực rỡ sắc y cà sa, như một khu rừng được gió thổi. Nhưng bây giờ, hội chúng Tỳ-kheo có vẻ thưa thớt, và phần lớn các Tỳ-kheo đều có vẻ xanh xao, vàng vọt. Chuyện gì vậy?”
Etarahi bhagavā tumhākaṃ aggikkhandhopamadhammadesanaṃ kathitakālato paṭṭhāya bhikkhū saṃvegappattā hutvā ‘‘mayaṃ etaṃ dhammaṃ sabbappakārena paripūretuṃ na sakkhissāma, asammāvattantānañca janassa saddhādeyyaṃ paribhuñjituṃ ayutta’’nti gihibhāvaṃ saṅkamantīti.
‘‘Venerable Sir, since the time you delivered the discourse on the Dhamma likened to a mass of fire, the bhikkhus have become agitated, thinking, 'We will not be able to fulfill this Dhamma in every way, and it is improper to partake of the offerings given by the faithful when we are not behaving correctly,' and they are reverting to the lay state.’’
Bạch Thế Tôn, kể từ khi Thế Tôn thuyết bài pháp ví dụ về khối lửa, các Tỳ-kheo đã khởi tâm xúc động và nghĩ: “Chúng con không thể hoàn thành pháp này bằng mọi cách. Thật không xứng đáng để thọ dụng vật cúng dường của những người có đức tin khi chúng con không sống đúng đắn.” Thế là họ đã trở lại đời cư sĩ.
Tasmiṃ khaṇe bhagavato dhammasaṃvego uppajji.
At that moment, a sense of urgency concerning the Dhamma arose in the Blessed One.
Vào khoảnh khắc đó, một sự xúc động về Pháp đã khởi lên trong Đức Thế Tôn.
Tato theraṃ āha – ‘‘mayi paṭisallāne vītināmente na koci mama puttānaṃ ekaṃ assāsaṭṭhānaṃ kathesi.
Then he said to the Elder, ‘‘While I was in seclusion, no one offered any solace to my sons.
Rồi Ngài nói với Trưởng lão: “Trong khi Như Lai nhập thất, không ai đã nói một lời an ủi nào cho các con của Như Lai.
Sāgarassa hi otaraṇatitthāni viya bahūni imasmiṃ sāsane assāsakāraṇāni.
Indeed, there are many sources of solace in this Dispensation, like the various fords for descending into the ocean.
Thật vậy, có rất nhiều lý do để an ủi trong giáo pháp này, giống như những bến xuống biển cả.
Gacchānanda, gandhakuṭipariveṇe buddhāsanaṃ paññāpetvā bhikkhusaṅghaṃ sannipātehī’’ti.
Go, Ānanda, arrange the Buddha-seat in the Gandhakūṭi precinct and gather the assembly of bhikkhus.’’
Này Ānanda, hãy đi trải tòa Phật trong tịnh xá Gandhakuti và tập hợp hội chúng Tỳ-kheo.”
Thero tathā akāsi.
The Elder did so.
Trưởng lão đã làm như vậy.
Satthā buddhāsanavaragato bhikkhū āmantetvā, ‘‘bhikkhave, mettāya sabbapubbabhāgo nāma neva appanā, na upacāro, sattānaṃ hitapharaṇamattamevā’’ti vatvā imissā aṭṭhuppattiyā imaṃ cūḷaccharāsaṅghātasuttaṃ desesi.
The Teacher ascended the excellent Buddha-seat and addressed the bhikkhus, saying, ‘‘Bhikkhus, the preliminary stage of mettā is neither absorption (appanā) nor access concentration (upacāra), but merely the diffusion of well-wishing towards beings,’’ and with this origin, he taught this Cūḷaccharāsaṅghātasutta.
Đức Bổn Sư, ngồi trên tòa Phật cao quý, gọi các Tỳ-kheo và nói: “Này các Tỳ-kheo, phần mở đầu của tâm từ (mettā) không phải là sự chứng đắc (appanā) hay cận định (upacāro), mà chỉ là sự lan tỏa lợi ích cho chúng sanh,” rồi Ngài thuyết bài kinh Cūḷaccharāsaṅghāta này với sự kiện phát sinh như vậy.
Tattha accharāsaṅghātamattanti accharāpaharaṇamattaṃ, dve aṅguliyo paharitvā saddakaraṇamattanti attho.
Here, accharāsaṅghātamatta means merely the snapping of fingers, that is, making a sound by striking two fingers together.
Trong đó, accharāsaṅghātamatta có nghĩa là chỉ một cái búng ngón tay, tức là chỉ một cái tạo âm thanh bằng cách búng hai ngón tay.
Mettācittanti sabbasattānaṃ hitapharaṇacittaṃ.
Mettācitta means a mind diffusing well-wishing to all beings.
Mettācitta là tâm lan tỏa lợi ích cho tất cả chúng sanh.
Āsevatīti kathaṃ āsevati?
Āsevati (cultivates): How does one cultivate it?
Āsevatī có nghĩa là thực hành như thế nào?
Āvajjento āsevati, jānanto āsevati, passanto āsevati, paccavekkhanto āsevati, cittaṃ adhiṭṭhahanto āsevati, saddhāya adhimuccanto āsevati, vīriyaṃ paggaṇhanto āsevati, satiṃ upaṭṭhāpento āsevati, cittaṃ samādahanto āsevati, paññāya pajānanto āsevati, abhiññeyyaṃ abhijānanto āsevati, pariññeyyaṃ parijānanto āsevati, pahātabbaṃ pajahanto āsevati, bhāvetabbaṃ bhāvento āsevati, sacchikātabbaṃ sacchikaronto āsevatīti (paṭi. ma. 2.2).
One cultivates by attending, cultivates by knowing, cultivates by seeing, cultivates by reviewing, cultivates by establishing the mind, cultivates by resolute faith, cultivates by exerting effort, cultivates by establishing mindfulness, cultivates by concentrating the mind, cultivates by understanding with wisdom, cultivates by directly knowing what is to be directly known, cultivates by fully understanding what is to be fully understood, cultivates by abandoning what is to be abandoned, cultivates by developing what is to be developed, cultivates by realizing what is to be realized.
Thực hành bằng cách chú ý, thực hành bằng cách hiểu biết, thực hành bằng cách thấy, thực hành bằng cách quán xét, thực hành bằng cách quyết tâm trong tâm, thực hành bằng cách tin tưởng vững chắc, thực hành bằng cách nỗ lực tinh tấn, thực hành bằng cách thiết lập chánh niệm, thực hành bằng cách định tâm, thực hành bằng cách hiểu biết với trí tuệ, thực hành bằng cách thấu hiểu điều cần phải thấu hiểu, thực hành bằng cách hiểu rõ điều cần phải hiểu rõ, thực hành bằng cách từ bỏ điều cần phải từ bỏ, thực hành bằng cách tu tập điều cần phải tu tập, thực hành bằng cách chứng đạt điều cần phải chứng đạt.
Idha pana mettāpubbabhāgena hitapharaṇappavattanamatteneva āsevatīti veditabbo.
Here, however, it should be understood that one practices merely by the spreading of welfare, which is the preliminary stage of mettā.
Còn ở đây, cần được hiểu là thực hành chỉ bằng sự diễn tiến của việc lan tỏa lợi ích với phần sơ khởi của tâm từ.
Arittajjhānoti atucchajjhāno apariccattajjhāno vā.
Arittajjhāno means one whose jhāna is not barren, or whose jhāna is not abandoned.
Arittajjhāno nghĩa là thiền không trống rỗng, hoặc thiền không bị từ bỏ.
Viharatīti iriyati pavattati pāleti yapeti yāpeti carati viharati.
Viharati means to move, to proceed, to guard, to maintain, to sustain, to conduct oneself, to dwell.
Viharatīti là đi đứng, diễn tiến, duy trì, bảo tồn, tồn tại, hành động, an trú.
Tena vuccati viharatīti.
Therefore, it is called viharati.
Do đó, được gọi là an trú.
Iminā padena mettaṃ āsevantassa bhikkhuno iriyāpathavihāro kathito.
By this word, the mode of conduct of a bhikkhu who practices mettā is described.
Bằng từ này, sự an trú trong oai nghi của vị tỳ khưu thực hành tâm từ đã được nói đến.
Satthusāsanakaroti satthu anusāsanikaro.
Satthusāsanakaro means one who carries out the Teacher's instruction.
Satthusāsanakaroti là người làm theo lời giáo huấn của Bậc Đạo Sư.
Ovādapatikaroti ovādakārako.
Ovādapatikaro means one who acts according to the advice.
Ovādapatikaroti là người thực hành lời giáo giới.
Ettha ca sakiṃvacanaṃ ovādo, punappunavacanaṃ anusāsanī.
Here, a single utterance is ovāda (advice), while repeated utterance is anusāsanī (instruction).
Và ở đây, lời nói một lần là ovāda, lời nói lặp đi lặp lại là anusāsanī.
Sammukhāvacanampi ovādo, pesetvā parammukhāvacanaṃ, anusāsanī.
An utterance made in the presence of someone is also ovāda, while an utterance made in their absence by sending someone is anusāsanī.
Lời nói trực diện cũng là ovāda, lời nói gián tiếp qua người khác là anusāsanī.
Otiṇṇe vatthusmiṃ vacanaṃ ovādo, otiṇṇe vā anotiṇṇe vā vatthusmiṃ tantiṭhapanavasena vacanaṃ anusāsanī.
An utterance concerning an arisen matter is ovāda, while an utterance in the manner of establishing a principle concerning an arisen or unarisen matter is anusāsanī.
Lời nói khi sự việc đã xảy ra là ovāda, lời nói nhằm thiết lập giáo điển khi sự việc đã xảy ra hay chưa xảy ra là anusāsanī.
Evaṃ viseso veditabbo.
Thus, the distinction should be understood.
Sự khác biệt nên được hiểu như vậy.
Paramatthato pana ovādoti vā anusāsanīti vā ese eke ekaṭṭhe same samabhāge tajjāte taññevāti.
In the ultimate sense, however, whether it is called ovāda or anusāsanī, these are one and the same in meaning, equivalent, having the same aspect, and are indeed of that nature.
Tuy nhiên, về mặt chân nghĩa, ovāda hay anusāsanī đều là một, có cùng một nghĩa, tương đồng, cùng một phần, cùng một bản chất, và chính là nó.
Ettha ca ‘‘accharāsaṅghātamattampi ce, bhikkhave, bhikkhu mettācittaṃ āsevatī’’ti idameva satthusāsanañceva ovādo ca, tassa karaṇato esa sāsanakaro ovādapatikaroti veditabbo.
Here, the statement, “If, bhikkhus, a bhikkhu cultivates a mind of mettā even for the snapping of a finger,” this itself is the Teacher's sāsana and ovāda, and because he acts upon it, he should be understood as sāsanakaro and ovādapatikaro.
Và ở đây, câu “Này các tỳ khưu, nếu vị tỳ khưu thực hành tâm từ dù chỉ trong khoảnh khắc búng ngón tay” chính là giáo huấn và giáo giới của Bậc Đạo Sư, do thực hành điều đó nên vị ấy được hiểu là người làm theo giáo huấn, người thực hành lời giáo giới.
Amoghanti atucchaṃ.
Amogha means not empty.
Amoghanti là không trống rỗng.
Raṭṭhapiṇḍanti ñātiparivaṭṭaṃ pahāya raṭṭhaṃ nissāya pabbajitena paresaṃ gehato paṭiladdhattā piṇḍapāto raṭṭhapiṇḍo nāma vuccati.
Raṭṭhapiṇḍa is so called because the almsfood received from others' houses by one who has gone forth, abandoning their family circle and relying on the country, is called almsfood from the nation.
Raṭṭhapiṇḍanti vật thực khất thực được gọi là raṭṭhapiṇḍa (vật thực của quốc độ) vì được nhận từ nhà của người khác bởi người đã xuất gia, từ bỏ quyến thuộc, nương tựa vào quốc độ.
Paribhuñjatīti cattāro paribhogā theyyaparibhogo iṇaparibhogo dāyajjaparibhogo sāmiparibhogoti.
Paribhuñjati refers to four ways of consuming: consumption as a thief, consumption as a debtor, consumption as an heir, and consumption as a master.
Paribhuñjatīti có bốn cách thọ dụng: thọ dụng như kẻ trộm, thọ dụng như người mắc nợ, thọ dụng như người thừa kế, và thọ dụng như người làm chủ.
Tattha dussīlassa paribhogo theyyaparibhogo nāma.
Among these, consumption by an immoral person is called consumption as a thief.
Trong đó, sự thọ dụng của người ác giới được gọi là thọ dụng như kẻ trộm.
Sīlavato apaccavekkhitaparibhogo iṇaparibhogo nāma.
Consumption by a virtuous person without proper reflection is called consumption as a debtor.
Sự thọ dụng không quán xét của người có giới được gọi là thọ dụng như người mắc nợ.
Sattannaṃ sekkhānaṃ paribhogo dāyajjaparibhogā nāma.
Consumption by the seven trainees (sekkhā) is called consumption as an heir.
Sự thọ dụng của bảy bậc hữu học được gọi là thọ dụng như người thừa kế.
Khīṇāsavassa paribhogo sāmiparibhogo nāma.
Consumption by one whose taints are destroyed (khīṇāsava) is called consumption as a master.
Sự thọ dụng của bậc lậu tận được gọi là thọ dụng như người làm chủ.
Tattha imassa bhikkhuno ayaṃ raṭṭhapiṇḍaparibhogo dvīhi kāraṇehi amogho hoti.
Among these, the consumption of almsfood by this bhikkhu becomes not empty for two reasons.
Trong đó, sự thọ dụng vật thực của quốc độ này của vị tỳ khưu này là không vô ích vì hai lý do.
Accharāsaṅghātamattampi mettācittaṃ āsevanto bhikkhu raṭṭhapiṇḍassa sāmiko hutvā, aṇaṇo hutvā, dāyādo hutvā paribhuñjatītipissa amogho raṭṭhapiṇḍaparibhogo.
A bhikkhu who cultivates a mind of mettā even for the snapping of a finger consumes the almsfood from the nation as its owner, free from debt, and as an heir, hence his consumption of almsfood is not empty.
Vị tỳ khưu thực hành tâm từ dù chỉ trong khoảnh khắc búng ngón tay, khi thọ dụng vật thực của quốc độ, vị ấy trở thành người làm chủ, người không mắc nợ, người thừa kế, do đó sự thọ dụng vật thực của quốc độ của vị ấy là không vô ích.
Accharāsaṅghātamattampi mettaṃ āsevantassa bhikkhuno dinnadānaṃ mahaṭṭhiyaṃ hoti mahapphalaṃ mahānisaṃsaṃ mahājutikaṃ mahāvipphārantipissa amogho raṭṭhapiṇḍaparibhogo.
For a bhikkhu who cultivates mettā even for the snapping of a finger, the gift given becomes mighty, of great fruit, of great benefit, of great radiance, of great pervading power, hence his consumption of almsfood is not empty.
Việc bố thí cho vị tỳ khưu thực hành tâm từ dù chỉ trong khoảnh khắc búng ngón tay cũng có năng lực lớn, quả lớn, lợi ích lớn, ánh sáng lớn, và lan tỏa rộng lớn, do đó sự thọ dụng vật thực của quốc độ của vị ấy là không vô ích.
Ko pana vādo ye naṃ bahulīkarontīti ye pana imaṃ mettācittaṃ bahulaṃ āsevanti bhāventi punappunaṃ karonti, te amoghaṃ raṭṭhapiṇḍaṃ paribhuñjantīti ettha vattabbameva kiṃ?
What then of those who make it abundant? What needs to be said about those who cultivate, develop, and repeatedly practice this mettā-citta abundantly? That they consume the almsfood from the nation without it being empty?
Ko pana vādo ye naṃ bahulīkarontīti còn nói gì đến những vị thực hành tâm từ này một cách thường xuyên? Ở đây, cần phải nói gì về việc các vị ấy thọ dụng vật thực của quốc độ một cách không vô ích?
Evarūpā hi bhikkhū raṭṭhapiṇḍassa sāmino aṇaṇā dāyādā hutvā paribhuñjantīti.
Indeed, such bhikkhus consume the almsfood from the nation as its owners, free from debt, and as heirs.
Bởi vì những vị tỳ khưu như vậy thọ dụng với tư cách là người làm chủ, người không mắc nợ, và người thừa kế của vật thực quốc độ.
54-55. Catutthe bhāvetīti uppādeti vaḍḍheti.
54-55. In the fourth discourse, bhāveti means to produce, to increase.
54-55. Trong bài kinh thứ tư, bhāvetīti là làm cho sanh khởi, làm cho tăng trưởng.
Pañcame manasi karotīti manasmiṃ karoti.
In the fifth, manasi karoti means to fix in mind.
Trong bài kinh thứ năm, manasi karotīti là tác ý trong tâm.
Sesaṃ imesu dvīsupi tatiye vuttanayeneva veditabbaṃ.
The rest in these two discourses should also be understood in the manner stated in the third.
Phần còn lại trong cả hai bài kinh này nên được hiểu theo cách đã nói trong bài kinh thứ ba.
Yo hi āsevati, ayameva bhāveti, ayaṃ manasi karoti.
Indeed, he who practices, he himself develops, he attends to it in mind.
Bởi vì người nào thực hành, chính vị ấy tu tập, chính vị ấy tác ý.
Yena cittena āsevati, teneva bhāveti, tena manasi karoti.
With the same mind with which he practices, he develops, with that he attends to it in mind.
Vị ấy tu tập bằng chính tâm mà vị ấy thực hành, vị ấy tác ý bằng chính tâm đó.
Sammāsambuddho pana yāya dhammadhātuyā suppaṭividdhattā desanāvilāsappatto nāma hoti, tassā suppaṭividdhattā attano desanāvilāsaṃ dhammissariyataṃ paṭisambhidāpabhedakusalataṃ appaṭihatasabbaññutaññāṇañca nissāya ekakkhaṇe uppannaṃ ekacittameva tīhi koṭṭhāsehi vibhajitvā dassesīti.
But the Perfectly Self-Enlightened One, being fully enlightened in that dhamma-dhātu by which he attains distinction in teaching, relying on his distinction in teaching, his mastery of the Dhamma, his skill in the various analyses (paṭisambhidā), and his unobstructed omniscience, showed a single mind arisen in one moment, divided into three parts.
Tuy nhiên, Đức Chánh Đẳng Giác, do đã thấu triệt pháp giới nào mà Ngài đạt đến sự vẻ vang trong thuyết pháp, nương vào sự thấu triệt đó, nương vào sự vẻ vang trong thuyết pháp của mình, vào quyền uy về pháp, vào sự thiện xảo trong các phân tích của tuệ phân tích, và vào trí tuệ toàn giác không bị ngăn ngại, Ngài đã phân chia và chỉ ra chính một tâm sanh khởi trong một khoảnh khắc thành ba phần.
56. Chaṭṭhe ye kecīti aniyāmitavacanaṃ.
56. In the sixth discourse, ye keci is an indefinite expression.
56. Trong bài kinh thứ sáu, ye kecīti là lời nói không xác định.
Akusalāti tesaṃ niyāmitavacanaṃ.
Akusalā is a definite expression for them.
Akusalāti là lời nói xác định về chúng.
Ettāvatā sabbākusalā asesato pariyādinnā honti.
By this much, all unwholesome states are entirely encompassed.
Với chừng ấy, tất cả các pháp bất thiện được bao gồm không còn sót lại.
Akusalabhāgiyā akusalapakkhikāti akusalānamevetaṃ nāmaṃ.
Akusalabhāgiyā and akusalapakkhikā are indeed names for the unwholesome states themselves.
Akusalabhāgiyā akusalapakkhikāti đây là tên gọi của chính các pháp bất thiện.
Akusalāyeva hi ekacce akusalaṃ sahajātavasena, ekacce upanissayavasena bhajanti ceva, tesañca pakkhā bhavantīti ‘‘akusalabhāgiyā akusalapakkhikā’’ti vuccanti.
For some unwholesome states are associated with unwholesome states by way of co-arising, and others by way of strong supporting condition; and they are also sides (pakkhā) of those unwholesome states; thus they are called "akusalabhāgiyā akusalapakkhikā".
Bởi vì chính các pháp bất thiện, một số kết giao với bất thiện theo cách đồng sanh, một số theo cách y chỉ, và trở thành phe phái của chúng, nên được gọi là “akusalabhāgiyā akusalapakkhikā”.
Sabbete manopubbaṅgamāti mano pubbaṃ paṭhamataraṃ gacchati etesanti manopubbaṅgamā.
Sabbete manopubbaṅgamā means that mind goes before, earlier than these (unwholesome states).
Sabbete manopubbaṅgamāti tâm đi trước, đi hàng đầu đối với chúng, nên chúng là manopubbaṅgamā.
Ete hi kiñcāpi manena saddhiṃ ekuppādā ekavatthukā ekanirodhā ekārammaṇā ca honti.
For even though these (unwholesome states) have the same arising, the same basis, the same cessation, and the same object as mind.
Bởi vì mặc dù chúng cùng sanh, cùng một vật, cùng diệt và cùng một đối tượng với tâm.
Yasmā pana tesaṃ mano uppādako kārako janako samuṭṭhāpako nibbattako, tasmā manopubbaṅgamā nāma honti.
Yet, because mind is their producer, agent, generator, originator, and bringer-forth, they are called manopubbaṅgamā (mind-foremost).
Nhưng vì tâm là tác nhân sanh khởi, tác nhân tạo tác, tác nhân phát sanh, tác nhân khởi dựng, tác nhân hình thành của chúng, nên chúng được gọi là manopubbaṅgamā.
Paṭhamaṃ uppajjatīti yathā nāma ‘‘rājā nikkhanto’’ti vutte ‘‘rājāyeva nikkhanto, sesā rājasenā nikkhantā anikkhantā’’ti pucchitabbakāraṇaṃ natthi, sabbā nikkhantāteva paññāyanti, evameva mano uppannoti vuttakālato paṭṭhāya avasesā sahajātasaṃsaṭṭhasampayuttā uppannā na uppannāti pucchitabbakāraṇaṃ natthi, sabbe te uppannā tveva paññāyanti.
Paṭhamaṃ uppajjati (arises first): Just as when it is said, "The king has departed," there is no need to ask, "Has only the king departed, or have the rest of the royal army departed or not departed?", as it is understood that all have departed; so too, from the time it is said that "mind has arisen," there is no need to ask whether the remaining co-arisen, associated, and conjoined mental factors have arisen or not, as it is understood that all of them have arisen.
Paṭhamaṃ uppajjatīti cũng như khi nói “vua đã ra đi”, không có lý do gì để hỏi “chỉ có vua ra đi, hay các quân lính còn lại đã ra đi hay chưa ra đi?”, mà được hiểu rằng tất cả đều đã ra đi; cũng vậy, từ lúc nói rằng tâm đã sanh khởi, không có lý do gì để hỏi các pháp đồng sanh, tương hợp, tương ưng còn lại đã sanh hay chưa sanh, mà được hiểu rằng tất cả chúng đều đã sanh khởi.
Etamatthavasaṃ paṭicca tehi saṃsaṭṭhasampayutto ekuppādekanirodhopi samāno mano tesaṃ dhammānaṃ paṭhamaṃ uppajjatīti vutto.
By virtue of this meaning, mind, even though co-arisen and co-ceased, and associated with those mental factors, is said to arise first among those phenomena.
Dựa vào ý nghĩa này, tâm, mặc dù tương hợp, tương ưng, cùng sanh cùng diệt với các pháp ấy, được nói là sanh khởi trước các pháp ấy.
Anvadevāti anudeva, saheva ekatoyevāti attho.
Anvadevā means anudeva (following after), saheva (together with), ekatoyeva (as one), that is the meaning.
Anvadevāti là anudeva, có nghĩa là cùng theo sau, cùng nhau.
Byañjanacchāyaṃ pana gahetvā paṭhamaṃ cittaṃ uppajjati, pacchā cetasikāti na gahetabbaṃ.
However, one should not take it literally to mean that consciousness arises first, and then mental factors.
Tuy nhiên, không nên hiểu theo nghĩa đen của từ ngữ rằng tâm sanh trước, các tâm sở sanh sau.
Attho hi paṭisaraṇaṃ, na byañjanaṃ.
For the meaning is the refuge, not the mere expression.
Bởi vì ý nghĩa mới là nơi nương tựa, chứ không phải từ ngữ.
‘‘Manopubbaṅgamā dhammā, manoseṭṭhā manomayā’’ti gāthāyapi eseva nayo.
The same principle applies to the verse: "All phenomena are preceded by mind, mind-dominated, mind-made."
Trong câu kệ “Các pháp do tâm dẫn đầu, tâm làm chủ, do tâm tạo tác”, phương pháp cũng tương tự như vậy.
‘‘Tattha katamo pamādo?
“Therein, what is heedlessness?
“Trong đó, thế nào là phóng dật?
Kāyaduccarite vā vacīduccarite vā manoduccarite vā pañcasu vā kāmaguṇesu cittassa vossaggo vossaggānuppadānaṃ kusalānaṃ vā dhammānaṃ bhāvanāya asakkaccakiriyatā asātaccakiriyatā anaṭṭhitakiriyatā olīnavuttitā nikkhittachandatā nikkhittadhuratā anadhiṭṭhānaṃ ananuyogo anāsevanā abhāvanā abahulīkammaṃ.
It is the abandoning of the mind, or the repeated abandoning, in bodily misconduct, verbal misconduct, mental misconduct, or in the five strands of sensual pleasure; it is the not-doing with respect, the not-doing continuously, the not-doing steadfastly, the dwelling in sluggishness, the casting away of desire, the casting away of burden, the not-being resolved, the not-applying oneself, the not-cultivating, the not-developing, the not-making it abundant for the development of wholesome states.
Sự buông thả, sự liên tục buông thả tâm trong thân ác hạnh, khẩu ác hạnh, hay ý ác hạnh, hoặc trong năm dục trưởng dưỡng; sự không thực hành một cách cẩn trọng, không thực hành một cách liên tục, không thực hành một cách kiên cố, thái độ buông xuôi, từ bỏ ý muốn, từ bỏ gánh nặng, không quyết tâm, không nỗ lực, không thực hành, không tu tập, không làm cho sung mãn trong việc tu tập các pháp thiện.
Yo evarūpo pamādo pamajjanā pamajjitattaṃ, ayaṃ vuccati pamādo’’ti (vibha. 846).
Such heedlessness, negligence, being negligent, is called heedlessness.”
Sự phóng dật, sự buông lung, trạng thái phóng dật như vậy, đây được gọi là phóng dật”.
‘‘Tattha katamā mahicchatā?
‘‘What is great desire (mahicchatā)?
“Trong đó, thế nào là đại dục (mahicchatā)?
Itarītaracīvarapiṇḍapātasenāsanagilānapaccayabhesajjaparikkhārehi pañcahi vā kāmaguṇehi asantuṭṭhassa bhiyyokamyatā, yā evarūpā icchā icchāgatā mahicchatā rāgo sārāgo cittassa sārāgo.
It is the desire for more of one's robes, alms-food, lodgings, medicines, and requisites for the sick, whether inferior or excellent, or of the five sense-pleasures, by one who is not content; such a desire, a state of desiring, great desire, lust, strong lust of the mind.
Đó là sự không thỏa mãn của người không biết đủ với y phục, đồ ăn khất thực, chỗ ở, thuốc men và các vật dụng cần thiết cho người bệnh, hoặc với năm dục lạc, mà chỉ mong muốn nhiều hơn nữa. Đó là sự ham muốn, sự khao khát, đại dục, tham ái, sự tham ái mạnh mẽ trong tâm.
Ayaṃ vuccati mahicchatā’’ti (vibha. 850).
This is called great desire’’.
Đây được gọi là đại dục (mahicchatā)” (Vibha. 850).
Apicettha atricchatā, pāpicchatā, mahicchatā appicchatāti ayaṃ bhedo veditabbo.
Furthermore, here the distinction of atricchatā, pāpicchatā, mahicchatā, and appicchatā should be understood.
Ngoài ra, ở đây cần hiểu sự khác biệt giữa atricchatā (tham lam quá mức), pāpicchatā (ác dục), mahicchatā (đại dục) và appicchatā (thiểu dục).
Tattha sakalābhe atittassa paralābhe patthanā atricchatā nāma, yāya samannāgatassa ekabhājane pakkapūvepi attano patte patite na supakko viya khuddako ca viya khāyati, sveva pana parassa patte pakkhitto supakko viya mahanto viya ca khāyati.
Among these, atricchatā is the desire for others' gains by one who is discontent with his own gains; one endowed with this will find that even a well-cooked cake placed in his own bowl seems uncooked and small, but the same cake placed in another's bowl seems well-cooked and large.
Trong đó, sự mong muốn có được những gì người khác có, của người không thỏa mãn với những gì mình đã có, được gọi là atricchatā. Người bị chi phối bởi điều này, ngay cả khi có một chiếc bánh chín trong cùng một nồi, khi rơi vào bát của mình, nó dường như chưa chín kỹ và nhỏ bé, nhưng khi đặt vào bát của người khác, nó lại dường như chín kỹ và to lớn.
Asantaguṇasambhāvanatā pana paṭiggahaṇe ca amattaññutā pāpicchatā nāma, sā ‘‘idhekacco assaddho samāno saddhoti maṃ jano jānātū’’tiādinā nayena abhidhamme āgatāyeva, tāya samannāgato puggalo kohaññe patiṭṭhāti.
Pāpicchatā is the assumption of non-existent qualities and immoderation in acceptance; this is found in the Abhidhamma in the manner beginning with ‘‘here, a certain faithless person, being faithless, desires that people should know him as faithful,’’ and a person endowed with this establishes himself in imposture.
Sự tự cho là có những phẩm chất không có và sự không biết đủ khi nhận vật phẩm được gọi là pāpicchatā. Điều này đã được đề cập trong Abhidhamma theo cách như: “Một người không có đức tin, lại mong muốn mọi người biết mình là người có đức tin,” v.v. Người bị chi phối bởi điều này sẽ rơi vào sự lừa dối.
Santaguṇasambhāvanatā pana paṭiggahaṇe ca amattaññutā mahicchatā nāma, sāpi ‘‘idhekacco saddho samāno saddhoti maṃ jano jānātūti icchati, sīlavā samāno sīlavāti maṃ jano jānātū’’ti iminā nayena āgatāyeva.
Mahicchatā is the assumption of existing qualities and immoderation in acceptance; this is also found in the manner: ‘‘here, a certain faithful person, being faithful, desires that people should know him as faithful; a virtuous person, being virtuous, desires that people should know him as virtuous.’’
Sự tự cho là có những phẩm chất hiện có và sự không biết đủ khi nhận vật phẩm được gọi là mahicchatā. Điều này cũng đã được đề cập theo cách như: “Một người có đức tin, lại mong muốn mọi người biết mình là người có đức tin; một người có giới hạnh, lại mong muốn mọi người biết mình là người có giới hạnh,” v.v.
Tāya samannāgato puggalo dussantappayo hoti, vijātamātāpissa cittaṃ gahetuṃ na sakkoti.
A person endowed with this is difficult to satisfy; even his own mother who gave birth to him cannot grasp his mind.
Người bị chi phối bởi điều này rất khó làm hài lòng, ngay cả mẹ ruột cũng không thể nắm bắt được tâm ý của người ấy.
Tenetaṃ vuccati –
Therefore, it is said –
Vì thế, điều này đã được nói:
Santaguṇanigūhanatā pana paṭiggahaṇe ca mattaññutā appicchatā nāma, tāya samannāgato puggalo attani vijjamānampi guṇaṃ paṭicchādetukāmatāya saddho samāno ‘‘saddhoti maṃ jano jānātū’’ti na icchati.
Appicchatā is the concealment of existing qualities and moderation in acceptance; a person endowed with this, desiring to conceal his own existing qualities, does not wish that people should know him as faithful, though he is faithful.
Sự che giấu những phẩm chất hiện có và sự biết đủ khi nhận vật phẩm được gọi là appicchatā. Người bị chi phối bởi điều này, vì muốn che giấu những phẩm chất hiện có trong mình, nên dù có đức tin, cũng không mong muốn “mọi người biết tôi là người có đức tin.”
Sīlavā, pavivitto, bahussuto, āraddhavīriyo, samādhisampanno, paññavā, khīṇāsavo samāno ‘‘khīṇāsavoti maṃ jano jānātū’’ti na icchati seyyathāpi majjhantikatthero.
Though he is virtuous, secluded, learned, energetic, accomplished in concentration, wise, an Arahant, he does not wish that people should know him as an Arahant, just like Elder Majjhantika.
Dù có giới hạnh, sống độc cư, học rộng, tinh tấn, thành tựu định, có trí tuệ, đã đoạn tận lậu hoặc, cũng không mong muốn “mọi người biết tôi là người đã đoạn tận lậu hoặc,” giống như Trưởng lão Majjhantika.
Thero kira mahākhīṇāsavo ahosi, pattacīvaraṃ panassa pādamattameva agghati.
The Elder was indeed a great Arahant, but his bowl and robe were worth only a quarter-value.
Nghe nói, vị Trưởng lão ấy là một A-la-hán vĩ đại, nhưng y bát của ngài chỉ đáng giá một đồng bạc.
So asokassa dhammarañño vihāramahadivase saṅghatthero ahosi.
On the day of King Asoka's great monastery offering, he was the Elder of the Saṅgha.
Trong ngày đại lễ cúng dường tịnh xá của vua Dhammāsoka, ngài là Trưởng lão Tăng chúng.
Athassa atilūkhabhāvaṃ disvā manussā, ‘‘bhante, thokaṃ bahi hothā’’ti āhaṃsu.
Seeing his extreme austerity, the people said, ‘‘Venerable sir, please step outside for a while.’’
Khi thấy sự khắc khổ tột cùng của ngài, mọi người nói: “Bạch Đại đức, xin ngài hãy ra ngoài một lát.”
Thero ‘‘mādise khīṇāsave rañño saṅgahaṃ akaronte añño ko karissatī’’ti pathaviyaṃ nimujjitvā saṅghattherassa ukkhittapiṇḍaṃ gaṇhantoyeva ummujji.
The Elder thought, ‘‘If Arahants like me do not honor the King, who else will?’’ and so he submerged himself into the earth and emerged just as the offering of alms-food to the Saṅgha's Elder was being received.
Vị Trưởng lão nghĩ: “Nếu những vị A-la-hán như ta không được vua cúng dường, thì ai sẽ được?” rồi ngài chìm xuống đất và nổi lên ngay khi vị Trưởng lão Tăng chúng đang nhận bát cúng dường.
Evaṃ khīṇāsavo samāno ‘‘khīṇāsavoti maṃ jano jānātū’’ti na icchati.
Even though he was an Arahant, he did not wish that people should know him as an Arahant.
Như vậy, dù đã đoạn tận lậu hoặc, ngài vẫn không mong muốn “mọi người biết tôi là người đã đoạn tận lậu hoặc.”
Evaṃ appiccho ca pana bhikkhu anuppannaṃ lābhaṃ uppādeti, uppannaṃ thāvaraṃ karoti, dāyakānaṃ cittaṃ ārādheti.
Such a bhikkhu of little desire generates gains that have not arisen, makes those that have arisen stable, and gladdens the minds of donors.
Và một vị tỳ-khưu thiểu dục như vậy sẽ tạo ra những lợi lộc chưa có, duy trì những lợi lộc đã có, và làm hài lòng tâm ý của các thí chủ.
Yathā yathā hi so attano appicchatāya appaṃ gaṇhāti, tathā tathā tassa vatte pasannā manussā bahū denti.
For the less he accepts out of his little desire, the more people, pleased with his conduct, give him much.
Quả thật, càng ít nhận vì sự thiểu dục của mình, thì mọi người càng hoan hỷ với hạnh của ngài và cúng dường nhiều hơn.
Aparopi catubbidho appiccho – paccayaappiccho, dhutaṅgaappiccho, pariyattiappiccho, adhigamaappicchoti.
There is also another fourfold classification of one of little desire: one of little desire regarding requisites, one of little desire regarding dhutaṅga, one of little desire regarding learning, and one of little desire regarding attainment.
Cũng có bốn loại thiểu dục khác: paccayaappiccha (thiểu dục về vật dụng), dhutaṅgaappiccha (thiểu dục về khổ hạnh), pariyattiappiccha (thiểu dục về học vấn), adhigamaappiccha (thiểu dục về thành tựu).
Tattha catūsu paccayesu appiccho paccayaappiccho nāma.
Among these, a person of little desire regarding the four requisites is called paccayaappiccho.
Trong đó, người thiểu dục đối với bốn vật dụng được gọi là paccayaappiccha.
So dāyakassa vasaṃ jānāti, deyyadhammassa vasaṃ jānāti, attano thāmaṃ jānāti.
He knows the capacity of the donor, knows the nature of the gift, and knows his own strength.
Vị ấy biết ý của thí chủ, biết giá trị của vật cúng dường, biết sức lực của mình.
Yadi hi deyyadhammo bahu hoti, dāyako appamattakaṃ dātukāmo, dāyakassa vasena appaṃ gaṇhāti.
If the gift is abundant and the donor wishes to give a small amount, he accepts little according to the donor's wish.
Nếu vật cúng dường nhiều, nhưng thí chủ chỉ muốn cúng ít, vị ấy sẽ nhận ít theo ý của thí chủ.
Deyyadhammo appo, dāyako bahuṃ dātukāmo, deyyadhammassa vasena appaṃ gaṇhāti.
If the gift is small and the donor wishes to give much, he accepts little according to the nature of the gift.
Nếu vật cúng dường ít, nhưng thí chủ muốn cúng nhiều, vị ấy sẽ nhận ít theo giá trị của vật cúng dường.
Deyyadhammopi bahu, dāyakopi bahuṃ dātukāmo, attano thāmaṃ ñatvā pamāṇeneva gaṇhāti.
If the gift is abundant and the donor also wishes to give much, he accepts only a suitable amount, knowing his own strength.
Nếu vật cúng dường nhiều và thí chủ cũng muốn cúng nhiều, vị ấy sẽ nhận vừa đủ theo sức lực của mình.
Cetiyapabbate dve bhātikattherā vasiṃsu.
Two brother Elders lived on Cetiyapabbata.
Trên núi Cetiyapabbata có hai vị Trưởng lão bhātika (anh em) sống.
Kaniṭṭho upaṭṭhākena pesitaṃ ucchukhaṇḍikaṃ gahetvā jeṭṭhassa santikaṃ agamāsi ‘‘paribhogaṃ, bhante, karothā’’ti.
The younger, taking a piece of sugarcane sent by a lay supporter, went to the elder, saying, ‘‘Please partake, Venerable sir.’’
Vị tiểu đệ mang một khúc mía do người hộ độ gửi đến, đến chỗ vị đại đệ và nói: “Bạch Đại đức, xin ngài dùng.”
Therassa ca bhattakiccaṃ katvā mukhavikkhālanakālo ahosi.
It was the Elder's time for rinsing his mouth after his meal.
Khi đó là lúc vị Trưởng lão đã dùng bữa xong và đang súc miệng.
So ‘‘alaṃ, āvuso’’ti āha.
He said, ‘‘Enough, friend.’’
Ngài nói: “Đủ rồi, này hiền giả.”
Kacci, bhante, ekāsanikatthāti?
‘‘Venerable sir, are you an 'one-sitter' (ekāsanika)?’’
“Bạch Đại đức, ngài có thực hành hạnh nhất tọa thực không?”
Āharāvuso, ucchukhaṇḍikanti paññāsa vassāni ekāsaniko samānopi dhutaṅgaṃ nigūhamāno paribhogaṃ katvā mukhaṃ vikkhāletvā puna dhutaṅgaṃ adhiṭṭhāya gato.
‘‘Bring, friend, the piece of sugarcane.’’ Although he had been an 'one-sitter' for fifty years, he concealed his dhutaṅga, partook, rinsed his mouth, reaffirmed his dhutaṅga, and left.
“Mang khúc mía đến đây, này hiền giả.” Dù đã thực hành hạnh nhất tọa thực năm mươi năm, ngài vẫn che giấu hạnh đầu đà của mình, dùng khúc mía, súc miệng, rồi lại phát nguyện hạnh đầu đà và ra đi.
Yo pana sāketatissatthero viya bahussutabhāvaṃ jānāpetuṃ na icchati, ayaṃ pariyattiappiccho nāma.
One who, like Elder Sāketatissa, does not wish to make known his extensive learning is called pariyattiappiccho.
Người không muốn cho người khác biết về sự học rộng của mình, giống như Trưởng lão Sāketatissa, được gọi là pariyattiappiccha.
Thero kira ‘‘khaṇo natthīti uddesaparipucchāsu okāsaṃ akaronto kadā maraṇakkhaṇaṃ, bhante, labhissathā’’ti codito gaṇaṃ vissajjetvā kaṇikāravālikasamuddavihāraṃ gato.
It is said that the Elder, not making time for instruction and questioning due to thinking ‘‘there is no moment (for death),’’ was pressed, ‘‘Venerable sir, when will you get the moment of death?’’ He dismissed his assembly and went to the Kanikāravālikasamudda Monastery.
Nghe nói, vị Trưởng lão ấy, vì không có thời gian để giảng dạy và vấn đáp, khi được hỏi: “Bạch Đại đức, bao giờ ngài mới có thời gian chết?” thì ngài đã giải tán chúng và đến tịnh xá Kaṇikāravālikasamudda.
Tattha antovassaṃ theranavamajjhimānaṃ upakāro hutvā mahāpavāraṇāya uposathadivase dhammakathāya janapadaṃ khobhetvā gato.
There, during the rainy season, he was helpful to the Elders, middle-bhikkhus, and junior bhikkhus, and on the Uposatha day of the Mahāpavāraṇā, he stirred the populace with a Dhamma talk and then departed.
Ở đó, trong mùa an cư, ngài đã giúp đỡ các vị Trưởng lão, Trung lão và Tân học, rồi vào ngày Uposatha của Đại Lễ Pavāraṇā, ngài đã thuyết pháp làm chấn động cả vùng và ra đi.
65. Pañcame santuṭṭhitāti santuṭṭhe puggale sevantassa bhajantassa payirupāsantassa uppanno alobhasaṅkhāto santoso.
65. In the fifth (discourse), santuṭṭhitā means the contentment, in the nature of non-greed, that arises in one who associates with, frequents, or attends upon a contented person.
65. Trong phần thứ năm, santuṭṭhitā (biết đủ) là sự hài lòng, hay sự vô tham, phát sinh trong người khi tiếp xúc, kết giao, hoặc phục vụ một người biết đủ.
Santuṭṭhassāti itarītarapaccayasantosena samannāgatassa.
Santuṭṭhassa means one endowed with contentment regarding requisites, whether inferior or excellent.
Santuṭṭhassa (của người biết đủ) là của người được chi phối bởi sự biết đủ đối với các vật dụng tầm thường.
So panesa santoso dvādasavidho hoti.
This contentment is twelvefold.
Sự biết đủ này có mười hai loại.
Seyyathidaṃ – cīvare yathālābhasantoso, yathābalasantoso, yathāsāruppasantosoti tividho.
Namely: contentment with robes according to what is obtained, contentment according to one's strength, contentment according to what is suitable—these are three kinds.
Đó là: sự biết đủ theo những gì có được (yathālābhasantosa), sự biết đủ theo sức lực (yathābalasantosa), sự biết đủ theo sự phù hợp (yathāsāruppasantosa) đối với y phục – có ba loại.
Evaṃ piṇḍapātādīsu.
Similarly for alms-food and so forth.
Tương tự đối với đồ ăn khất thực, v.v.
Tassāyaṃ pabhedasaṃvaṇṇanā – idha bhikkhu cīvaraṃ labhati sundaraṃ vā asundaraṃ vā.
This is its detailed description: here, a bhikkhu obtains a robe, whether beautiful or not beautiful.
Đây là sự giải thích chi tiết về điều đó: Ở đây, một tỳ-khưu nhận được y phục, dù đẹp hay không đẹp.
So teneva yāpeti aññaṃ na pattheti, labhantopi na gaṇhāti.
He sustains himself with that and desires nothing else; even if he receives more, he does not take it.
Vị ấy sống chỉ với y phục đó, không mong cầu cái khác, dù được cũng không nhận.
Ayamassa cīvare yathālābhasantoso.
This is his contentment with whatever robes are obtained.
Đây là sự tùy duyên tri túc của vị ấy đối với y phục.
Atha pana pakatidubbalo vā hoti ābādhajarābhibhūto vā, garuṃ cīvaraṃ pārupanto kilamati.
But if he is naturally weak or afflicted by illness and old age, he becomes weary when wearing a heavy robe.
Lại nữa, nếu vị ấy vốn yếu đuối hoặc bị bệnh tật, tuổi già hành hạ, khi khoác y nặng thì bị mệt mỏi.
So sabhāgena bhikkhunā saddhiṃ taṃ parivattetvā lahukena yāpentopi santuṭṭhova hoti.
So, exchanging it with a fellow bhikkhu, he remains content even when sustaining himself with a lighter robe.
Vị ấy đổi y đó với một Tỳ-kheo đồng hạnh, rồi sống với y nhẹ hơn mà vẫn tri túc.
Ayamassa cīvare yathābalasantoso.
This is his contentment according to his strength in robes.
Đây là sự tùy lực tri túc của vị ấy đối với y phục.
Aparo paṇītapaccayalābhī hoti.
Another receives exquisite requisites.
Một vị khác được các vật dụng thượng hạng.
So paṭṭacīvarādīnaṃ aññataraṃ mahagghacīvaraṃ bahūni vā pana cīvarāni labhitvā ‘‘idaṃ therānaṃ cirapabbajitānaṃ, idaṃ bahussutānaṃ anurūpaṃ, idaṃ gilānānaṃ, idaṃ appalābhānaṃ hotū’’ti datvā tesaṃ purāṇacīvaraṃ vā saṅkārakūṭādito vā nantakāni uccinitvā tehi saṅghāṭiṃ katvā dhārentopi santuṭṭhova hoti.
Having received an expensive robe, one of those made of fine cloth and so forth, or many robes, he gives them, saying, "May this be suitable for the elder bhikkhus, for those long ordained, for the learned, for the sick, for those with few gains," and picking up old robes from them or rags from a rubbish heap, he makes a double robe from them and wears it, still remaining content.
Vị ấy nhận được một chiếc y giá trị cao như y bằng vải lụa, v.v., hoặc nhiều y phục, rồi nghĩ: “Y này thích hợp cho các vị Trưởng lão đã xuất gia lâu năm, y này thích hợp cho các vị đa văn, y này cho các vị bệnh, y này cho các vị ít lợi lộc”, rồi đem cho các vị ấy. Vị ấy nhặt các mảnh vải vụn từ đống rác, v.v., hoặc từ y cũ của các vị ấy, rồi may thành y Saṅghāṭi (tăng-già-lê) mà mặc, vẫn tri túc.
Ayamassa cīvare yathāsāruppasantoso.
This is his contentment according to suitability in robes.
Đây là sự tùy nghi tri túc của vị ấy đối với y phục.
Idha pana bhikkhu piṇḍapātaṃ labhati lūkhaṃ vā paṇītaṃ vā, so teneva yāpeti, aññaṃ na pattheti, labhantopi na gaṇhāti.
Here, a bhikkhu receives alms-food, coarse or refined; he sustains himself with that and desires nothing else; even if he receives more, he does not take it.
Ở đây, một Tỳ-kheo nhận được vật thực khất thực thô sơ hay thượng hạng, vị ấy sống chỉ với vật thực đó, không mong cầu cái khác, dù được cũng không nhận.
Ayamassa piṇḍapāte yathālābhasantoso.
This is his contentment with whatever alms-food is obtained.
Đây là sự tùy duyên tri túc của vị ấy đối với vật thực khất thực.
Yo pana attano pakativiruddhaṃ vā byādhiviruddhaṃ vā piṇḍapātaṃ labhati, yenassa paribhuttena aphāsu hoti, so sabhāgassa bhikkhuno taṃ datvā tassa hatthato sappāyabhojanaṃ bhuñjitvā samaṇadhammaṃ karontopi santuṭṭhova hoti.
But if one receives alms-food that is unsuitable for one's nature or harmful for one's illness, and is unwell after consuming it, then, having given it to a fellow bhikkhu and taken suitable food from his hand, he remains content even while performing the ascetic's practice.
Còn vị nào nhận được vật thực khất thực không hợp với thể chất hoặc không hợp với bệnh của mình, nếu dùng vào thì sẽ không được thoải mái, vị ấy đem vật thực đó cho một Tỳ-kheo đồng hạnh, rồi nhận thức ăn thích hợp từ tay vị ấy để dùng, và vẫn tri túc khi thực hành pháp Sa-môn.
Ayamassa piṇḍapāte yathābalasantoso.
This is his contentment according to his strength in alms-food.
Đây là sự tùy lực tri túc của vị ấy đối với vật thực khất thực.
Aparo bahuṃ paṇītaṃ piṇḍapātaṃ labhati.
Another receives abundant and exquisite alms-food.
Một vị khác nhận được nhiều vật thực khất thực thượng hạng.
So taṃ cīvaraṃ viya theracirapabbajitabahussutaappalābhagilānānaṃ datvā tesaṃ vā sesakaṃ piṇḍāya vā caritvā missakāhāraṃ bhuñjantopi santuṭṭhova hoti.
Having given it, just like robes, to elder bhikkhus, long-ordained bhikkhus, learned bhikkhus, bhikkhus with few gains, and sick bhikkhus, he remains content even if he sustains himself with their leftovers or with mixed food obtained by going on alms-round.
Vị ấy đem vật thực đó cho các vị Trưởng lão đã xuất gia lâu năm, các vị đa văn, các vị ít lợi lộc, các vị bệnh như đã nói về y phục, hoặc dùng phần còn lại của các vị ấy, hoặc đi khất thực rồi dùng vật thực hỗn hợp, vẫn tri túc.
Ayamassa piṇḍapāte yathāsāruppasantoso.
This is his contentment according to suitability in alms-food.
Đây là sự tùy nghi tri túc của vị ấy đối với vật thực khất thực.
Idha pana bhikkhu senāsanaṃ labhati manāpaṃ vā amanāpaṃ vā, so tena neva somanassaṃ na domanassaṃ uppādeti, antamaso tiṇasanthārakenāpi yathāladdheneva tussati.
Here, a bhikkhu receives a dwelling, pleasant or unpleasant; he produces neither joy nor sorrow with it; he is content even with a grass mat, whatever he obtains.
Ở đây, một Tỳ-kheo nhận được chỗ ở vừa ý hay không vừa ý, vị ấy không khởi lên sự hoan hỷ hay ưu phiền với chỗ ở đó, thậm chí chỉ với một tấm chiếu cỏ tùy duyên mà vẫn mãn nguyện.
Ayamassa senāsane yathālābhasantoso.
This is his contentment with whatever dwelling is obtained.
Đây là sự tùy duyên tri túc của vị ấy đối với chỗ ở.
Yo pana attano pakativiruddhaṃ vā byādhiviruddhaṃ vā senāsanaṃ labhati, yatthassa vasato aphāsu hoti, so taṃ sabhāgassa bhikkhuno datvā tassa santake sappāyasenāsane vasantopi santuṭṭhova hoti.
But if one receives a dwelling that is unsuitable for one's nature or harmful for one's illness, and is unwell when residing there, then, having given it to a fellow bhikkhu and resided in a suitable dwelling belonging to that bhikkhu, he remains content.
Vị nào nhận được chỗ ở không hợp với thể chất hoặc không hợp với bệnh của mình, nơi mà khi sống vị ấy không được thoải mái, vị ấy đem chỗ ở đó cho một Tỳ-kheo đồng hạnh, rồi sống trong chỗ ở thích hợp của vị ấy mà vẫn tri túc.
Ayamassa senāsane yathābalasantoso.
This is his contentment according to his strength in dwellings.
Đây là sự tùy lực tri túc của vị ấy đối với chỗ ở.
Aparo mahāpuñño leṇamaṇḍapakūṭāgārādīni bahūni paṇītasenāsanāni labhati.
Another, a greatly meritorious person, receives many exquisite dwellings such as caves, pavilions, or storied mansions.
Một vị khác có phước lớn, nhận được nhiều chỗ ở thượng hạng như hang động, nhà mái vòm, nhà có chóp nhọn, v.v.
So tāni cīvarādīni viya theracirapabbajitabahussutaappalābhagilānānaṃ datvā yattha katthaci vasantopi santuṭṭhova hoti.
Having given them, just like robes and so forth, to elder bhikkhus, long-ordained bhikkhus, learned bhikkhus, bhikkhus with few gains, and sick bhikkhus, he remains content even if he resides wherever he can.
Vị ấy đem những chỗ ở đó cho các vị Trưởng lão đã xuất gia lâu năm, các vị đa văn, các vị ít lợi lộc, các vị bệnh như đã nói về y phục, v.v., rồi sống ở bất cứ đâu mà vẫn tri túc.
Ayamassa senāsane yathāsāruppasantoso.
This is his contentment according to suitability in dwellings.
Đây là sự tùy nghi tri túc của vị ấy đối với chỗ ở.
Yopi ‘‘uttamasenāsanaṃ nāma pamādaṭṭhānaṃ, tattha nisinnassa thinamiddhaṃ okkamati, niddābhibhūtassa puna paṭibujjhato pāpavitakkā pātubhavantī’’ti paṭisañcikkhitvā tādisaṃ senāsanaṃ pattampi na sampaṭicchati, so taṃ paṭikkhipitvā abbhokāsarukkhamūlādīsu vasantopi santuṭṭhova hoti.
And if one, reflecting that "an excellent dwelling is a cause for heedlessness; torpor and drowsiness overcome one sitting there, and evil thoughts arise again when one awakes overcome by sleep," does not accept such a dwelling even when it is available, but rejects it and resides in the open air or at the foot of a tree, he too remains content.
Vị nào quán xét rằng: “Chỗ ở tốt nhất là nơi dễ sanh phóng dật, khi ngồi ở đó thì hôn trầm, thụy miên khởi lên, khi thức dậy sau khi bị buồn ngủ chi phối thì các ác tầm phát khởi”, rồi không chấp nhận chỗ ở như vậy dù đã được ban tặng, vị ấy từ chối chỗ ở đó và sống ở nơi trống trải, dưới gốc cây, v.v., mà vẫn tri túc.
Ayampissa senāsane yathāsāruppasantoso.
This also is his contentment according to suitability in dwellings.
Đây cũng là sự tùy nghi tri túc của vị ấy đối với chỗ ở.
Idha pana bhikkhu bhesajjaṃ labhati lūkhaṃ vā paṇītaṃ vā, so yaṃ labhati, teneva tussati, aññaṃ na pattheti, labhantopi na gaṇhāti.
Here, a bhikkhu receives medicine, coarse or refined; he is content with whatever he receives, desires nothing else, and does not take more even if he receives it.
Ở đây, một Tỳ-kheo nhận được thuốc thô sơ hay thượng hạng, vị ấy mãn nguyện với những gì mình nhận được, không mong cầu cái khác, dù được cũng không nhận.
Ayamassa gilānapaccaye yathālābhasantoso.
This is his contentment with whatever medicinal requisites are obtained.
Đây là sự tùy duyên tri túc của vị ấy đối với thuốc men trị bệnh.
Yo pana telena atthiko phāṇitaṃ labhati, so taṃ sabhāgassa bhikkhuno datvā tassa hatthato telaṃ gahetvā aññadeva vā pariyesitvā bhesajjaṃ karontopi santuṭṭhova hoti.
But if one desires oil and receives molasses, then, having given the molasses to a fellow bhikkhu and taken oil from his hand or sought out other oil, he remains content even while taking medicine.
Vị nào cần dầu mà lại nhận được đường mật, vị ấy đem đường mật đó cho một Tỳ-kheo đồng hạnh, rồi nhận dầu từ tay vị ấy hoặc tìm kiếm một loại dầu khác để làm thuốc, vẫn tri túc.
Ayamassa gilānapaccaye yathābalasantoso.
This is his contentment according to his strength in medicinal requisites.
Đây là sự tùy lực tri túc của vị ấy đối với thuốc men trị bệnh.
Aparo mahāpuñño bahuṃ telamadhuphāṇitādipaṇītabhesajjaṃ labhati.
Another, a greatly meritorious person, receives much exquisite medicine such as oil, honey, molasses, and so forth.
Một vị khác có phước lớn, nhận được nhiều thuốc men thượng hạng như dầu, mật, đường mật, v.v.
So taṃ cīvaraṃ viya theracirapabbajitabahussutaappalābhagilānānaṃ datvā tesaṃ ābhatena yena kenaci yāpentopi santuṭṭhova hoti.
Having given it, just like robes, to elder bhikkhus, long-ordained bhikkhus, learned bhikkhus, bhikkhus with few gains, and sick bhikkhus, he remains content even if he sustains himself with whatever they bring.
Vị ấy đem thuốc đó cho các vị Trưởng lão đã xuất gia lâu năm, các vị đa văn, các vị ít lợi lộc, các vị bệnh như đã nói về y phục, rồi sống với bất cứ thứ gì được mang đến mà vẫn tri túc.
Yo pana ekasmiṃ bhājane muttaharītakaṃ ṭhapetvā ekasmiṃ catumadhuraṃ – ‘‘gaṇhatha, bhante, yadicchaka’’nti vuccamāno ‘‘sacassa tesu aññatarenapi rogo vūpasammati, atha muttaharītakaṃ nāma buddhādīhi vaṇṇita’’nti catumadhuraṃ paṭikkhipitvā muttaharītakena bhesajjaṃ karontopi paramasantuṭṭhova hoti.
And if one, having placed cow's urine and myrobalan in one bowl and the four choice sweets in another, is told, "Reverend Sir, take whatever you wish," he reflects, "If his illness is alleviated by either of these, then cow's urine and myrobalan have been praised by the Buddhas and others," and rejecting the four choice sweets, takes medicine with cow's urine and myrobalan, he is supremely content.
Vị nào, khi được hỏi: “Bạch Đại đức, xin hãy lấy bất cứ thứ thuốc nào ngài muốn”, trong khi một bát có Mutthaharītaka (cây Muttha và Harītaka) và một bát có Catumadhura (bốn loại mật ngọt), vị ấy quán xét rằng: “Nếu bệnh của ta có thể thuyên giảm với một trong hai loại này, thì Mutthaharītaka đã được Đức Phật và các bậc Thánh tán thán”, rồi từ chối Catumadhura và dùng Mutthaharītaka để làm thuốc, vị ấy vẫn cực kỳ tri túc.
Ayamassa gilānapaccaye yathāsāruppasantoso.
This is his contentment according to suitability in medicinal requisites.
Đây là sự tùy nghi tri túc của vị ấy đối với thuốc men trị bệnh.
Imesaṃ pana paccekapaccayesu tiṇṇaṃ tiṇṇaṃ santosānaṃ yathāsāruppasantosova aggo.
Among these three types of contentment for each requisite, the contentment according to suitability is the foremost.
Trong số ba loại tri túc đối với mỗi vật dụng này, sự tùy nghi tri túc là tối thượng.
‘‘Tattha katamā pāpamittatā?
"Therein, what is evil companionship?
“Ở đây, thế nào là bạn ác?
Ye te puggalā assaddhā dussīlā appassutā maccharino duppaññā.
Those individuals who are faithless, immoral, unlearned, stingy, and unwise.
Những người không có đức tin, không giữ giới, ít học, keo kiệt, kém trí tuệ.
Yā tesaṃ sevanā nisevanā saṃsevanā bhajanā sambhajanā bhatti sambhatti sampavaṅkatā.
The association, frequenting, intimacy, companionship, fondness, devotion, and attachment to them.
Sự giao du, thân cận, kết hợp, gần gũi, gắn bó, hòa hợp với họ.
Ayaṃ vuccati pāpamittatā’’ti (vibha. 901).
This is called evil companionship."
Đây được gọi là bạn ác.”
74. Catutthe bojjhaṅgāti bujjhanakasattassa aṅgabhūtā satta dhammā.
In the fourth, bojjhaṅgā are the seven factors that are constituents for a being who is awakening.
74. Trong kinh thứ tư, bojjhaṅgā (các chi giác ngộ) là bảy pháp là các chi phận của chúng sanh giác ngộ.
Yāya vā dhammasāmaggiyā so bujjhati, sammohaniddāto vā vuṭṭhāti, catusaccadhammaṃ vā sacchikaroti.
Or, they are the constituents of enlightenment (bodhi) through the combination of which one awakens, or arises from the sleep of delusion, or realizes the four noble truths.
Hoặc do sự hòa hợp của các pháp mà vị ấy giác ngộ, hoặc thoát khỏi giấc ngủ của si mê, hoặc chứng đạt Tứ Thánh Đế.
Tassā bodhiyā aṅgabhūtātipi bojjhaṅgā.
Thus, they are called bojjhaṅgā, the factors of enlightenment.
Chúng cũng được gọi là bojjhaṅgā vì là các chi phận của sự giác ngộ đó.
‘‘Bojjhaṅgāti kenaṭṭhena bojjhaṅgā?
"Bojjhaṅgā – in what sense are they bojjhaṅgā?
“Bojjhaṅgā, theo nghĩa nào là bojjhaṅgā?
Bujjhantīti bojjhaṅgā, anubujjhantīti bojjhaṅgā, paṭibujjhantīti bojjhaṅgā, sambujjhantīti bojjhaṅgā, bodhāya saṃvattantīti bojjhaṅgā’’ti (paṭi. ma. 2.17).
They awaken, therefore bojjhaṅgā; they fully awaken, therefore bojjhaṅgā; they perfectly awaken, therefore bojjhaṅgā; they conduce to enlightenment, therefore bojjhaṅgā."
Chúng giác ngộ nên là bojjhaṅgā, chúng tùy giác ngộ nên là bojjhaṅgā, chúng phản giác ngộ nên là bojjhaṅgā, chúng chánh giác ngộ nên là bojjhaṅgā, chúng dẫn đến giác ngộ nên là bojjhaṅgā.”
Evaṃ panetaṃ padaṃ vibhattameva.
Thus is this term analyzed.
Như vậy, từ này đã được phân tích.
75. Pañcame bhāvanāpāripūriṃ gacchantīti iminā padena bojjhaṅgānaṃ yāthāvasarasabhūmi nāma kathitā.
In the fifth, the phrase bhāvanāpāripūriṃ gacchantī states the actual ground of the bojjhaṅgas.
75. Trong kinh thứ năm, với từ bhāvanāpāripūriṃ gacchanti (đạt đến sự viên mãn của sự tu tập), cõi chân thực của các chi giác ngộ đã được nói đến.
Sā panesā catubbidhā hoti – vipassanā, vipassanāpādakajjhānaṃ, maggo, phalanti.
That (true essence-ground) is of four kinds: vipassanā, jhāna as the basis for vipassanā, the path (magga), and the fruition (phala).
Tuy nhiên, điều này có bốn loại – thiền quán (vipassanā), thiền định làm nền tảng cho thiền quán (vipassanāpādakajjhāna), đạo (magga), và quả (phala).
Tattha vipassanāya uppajjanakāle bojjhaṅgā kāmāvacarā honti, vipassanāpādakajjhānamhi uppajjanakāle rūpāvacaraarūpāvacarā, maggaphalesu uppajjanakāle lokuttarā.
Among these, when vipassanā arises, the bojjhaṅgas are of the kāma sphere; when jhāna as the basis for vipassanā arises, they are of the rūpa and arūpa spheres; when the path and fruition arise, they are supramundane (lokuttara).
Trong đó, khi thiền quán (vipassanā) khởi sinh, các chi giác ngộ (bojjhaṅga) là thuộc cõi Dục (kāmāvacara); khi thiền định làm nền tảng cho thiền quán khởi sinh, chúng là thuộc cõi Sắc (rūpāvacara) và cõi Vô Sắc (arūpāvacara); khi đạo và quả khởi sinh, chúng là siêu thế (lokuttara).
Iti imasmiṃ sutte bojjhaṅgā catubhūmakā kathitā.
Thus, in this Sutta, the bojjhaṅgas are described as belonging to the four planes (catubhūmaka).
Như vậy, trong bài kinh này, các chi giác ngộ (bojjhaṅga) được nói là có bốn cõi.
76. Chaṭṭhassa aṭṭhuppattiko nikkhepo.
76. The introductory explanation (aṭṭhuppattiko nikkhepo) of the sixth (sutta).
76. Bài kinh thứ sáu được đặt ra dựa trên duyên khởi.
Aṭṭhuppattiyaṃ hetaṃ nikkhittaṃ, sambahulā kira bhikkhū dhammasabhāyaṃ sannisinnā.
Indeed, this (sutta) was laid down due to its origin. To elaborate, many bhikkhus were sitting together in the Dhamma hall.
Thật vậy, bài kinh này được đặt ra dựa trên duyên khởi, khi nhiều Tỳ-khưu đang ngồi họp tại Pháp đường.
Tesaṃ antare bandhulamallasenāpatiṃ ārabbha ayaṃ kathā udapādi, ‘‘āvuso, asukaṃ nāma kulaṃ pubbe bahuñātikaṃ ahosi bahupakkhaṃ, idāni appañātikaṃ appapakkhaṃ jāta’’nti.
Among them, a discussion arose concerning the commander-in-chief Bandhula Mallika: “Friends, a certain family was formerly endowed with many relatives and much support, but now it has become one with few relatives and little support.”
Trong số họ, câu chuyện này đã khởi lên về vị tướng quân Bandhula Malla: "Thưa các hiền giả, gia đình nọ trước đây có nhiều thân quyến, nhiều phe cánh; nay đã trở thành ít thân quyến, ít phe cánh."
Atha bhagavā tesaṃ cittācāraṃ ñatvā ‘‘mayi gate mahatī desanā bhavissatī’’ti ñatvā gandhakuṭito nikkhamma dhammasabhāyaṃ paññattavarabuddhāsane nisīditvā ‘‘kāya nuttha, bhikkhave, etarahi kathāya sannisinnā’’ti āha.
Then the Blessed One, knowing their mental inclination, and realizing, “When I am gone, a great discourse will take place,” emerged from the Perfumed Chamber and, seated on the excellent Buddha-seat prepared in the Dhamma hall, said, “Bhikkhus, what is the topic of your discussion as you sit here now?”
Bấy giờ, Đức Thế Tôn biết được tâm tư của họ, nghĩ rằng: "Khi Ta đi rồi, sẽ có một bài thuyết pháp lớn," Ngài liền rời hương thất, đến Pháp đường, ngồi trên tòa Phật ngự cao quý đã được sắp đặt, và hỏi: "Này các Tỳ-khưu, hiện giờ các ông đang ngồi họp nói chuyện gì vậy?"
Bhagavā aññā gāmanigamādikathā natthi, asukaṃ nāma kulaṃ pubbe bahuñātikaṃ ahosi bahupakkhaṃ, idāni appañātikaṃ appapakkhaṃ jātanti vadantā nisinnamhāti.
“Blessed One, there is no other talk concerning villages, towns, and so forth. We are sitting here discussing that a certain family was formerly endowed with many relatives and much support, but now it has become one with few relatives and little support.”
Họ đáp: "Bạch Đức Thế Tôn, không có chuyện gì khác về làng mạc hay thị trấn, v.v. Chúng con đang ngồi nói rằng: 'Gia đình nọ trước đây có nhiều thân quyến, nhiều phe cánh; nay đã trở thành ít thân quyến, ít phe cánh'."
Satthā imissā aṭṭhuppattiyā appamattikā esā, bhikkhave, parihānīti idaṃ suttaṃ ārabhi.
Because of this circumstance, the Teacher initiated this Sutta, “Bhikkhus, this decline is trifling (appamattikā esā parihānī).”
Đức Đạo Sư đã khởi xướng bài kinh này, "Này các Tỳ-khưu, sự suy giảm này là nhỏ nhặt", dựa trên duyên khởi này.
Tattha appamattikāti parittā parittappamāṇā.
Here, appamattikā means insignificant, of little measure.
Trong đó, appamattikā có nghĩa là nhỏ, có mức độ nhỏ.
Etāya hi parihāniyā saggato vā maggato vā parihāni nāma natthi, diṭṭhadhammikaparihānimattameva etanti āha.
Indeed, by this decline, there is no decline from heaven or from the path; it is merely a decline relating to this present life, thus it is stated.
Thật vậy, với sự suy giảm này, không có sự suy giảm về cõi trời hay về đạo, mà chỉ là sự suy giảm trong đời hiện tại mà thôi, Ngài đã nói như vậy.
Etaṃ patikiṭṭhanti etaṃ pacchimaṃ etaṃ lāmakaṃ.
Etaṃ patikiṭṭhaṃ means this is the lowest, this is vile.
Etaṃ patikiṭṭhaṃ có nghĩa là điều này là thấp kém nhất, điều này là tồi tệ.
Yadidaṃ paññāparihānīti yā esā mama sāsane kammassakatapaññāya jhānapaññāya vipassanāpaññāya maggapaññāya phalapaññāya ca parihāni, esā pacchimā, esā lāmakā, esā chaḍḍanīyāti attho.
Yadidaṃ paññāparihānī means that decline of knowledge of kamma as one’s own (kammassakatapaññā), of jhāna-wisdom, of vipassanā-wisdom, of path-wisdom, and of fruition-wisdom, which exists in my Dispensation—that is the lowest, that is vile, that is to be rejected.
Yadidaṃ paññāparihānī có nghĩa là sự suy giảm trí tuệ này, tức là sự suy giảm về trí tuệ về nghiệp, trí tuệ thiền định, trí tuệ thiền quán, trí tuệ đạo và trí tuệ quả trong giáo pháp của Ta, điều này là thấp kém nhất, điều này là tồi tệ, điều này đáng bị loại bỏ.
77. Sattamampi aṭṭhuppattiyameva kathitaṃ.
77. The seventh (sutta) was also taught based on its origin.
77. Bài kinh thứ bảy cũng được nói ra dựa trên duyên khởi.
Dhammasabhāyaṃ kira nisinnesu bhikkhūsu ekacce evaṃ āhaṃsu – ‘‘asukaṃ nāma kulaṃ pubbe appañātikaṃ appapakkhaṃ ahosi, idāni taṃ bahuñātikaṃ bahupakkhaṃ jāta’’nti.
Indeed, among the bhikkhus sitting in the Dhamma hall, some said, “A certain family was formerly one with few relatives and little support, but now it has become one with many relatives and much support.”
Thật vậy, khi các Tỳ-khưu đang ngồi trong Pháp đường, một số vị đã nói: "Gia đình nọ trước đây ít thân quyến, ít phe cánh; nay đã trở thành nhiều thân quyến, nhiều phe cánh."
Kaṃ sandhāya evamāhaṃsūti?
Referring to whom did they speak thus?
Họ nói điều này ám chỉ ai?
Visākhaṃ upāsikaṃ vesālike ca licchavī.
Referring to Visākhā the lay follower and the Licchavis of Vesāli.
Họ ám chỉ nữ cư sĩ Visākhā và các hoàng tử Licchavi ở Vesālī.
Satthā tesaṃ cittācāraṃ ñatvā purimanayeneva āgantvā dhammāsane nisinno ‘‘kāya nuttha, bhikkhave, etarahi kathāya sannisinnā’’ti pucchi.
The Teacher, knowing their mental inclination, approached as before and, seated on the Dhamma-seat, asked, “Bhikkhus, what is the topic of your discussion as you sit here now?”
Đức Đạo Sư biết được tâm tư của họ, Ngài đến theo cách cũ, ngồi trên tòa Pháp, và hỏi: "Này các Tỳ-khưu, hiện giờ các ông đang ngồi họp nói chuyện gì vậy?"
Te yathābhūtaṃ kathayiṃsu.
They explained it as it truly was.
Họ đã kể lại sự thật.
Satthā imissā aṭṭhuppattiyā imaṃ suttaṃ ārabhi.
Because of this circumstance, the Teacher initiated this Sutta.
Đức Đạo Sư đã khởi xướng bài kinh này dựa trên duyên khởi đó.
Tattha appamattikāti taṃ sampattiṃ nissāya saggaṃ vā maggaṃ vā sampattānaṃ abhāvato parittā.
Here, appamattikā means trifling, due to the absence of those who attained heaven or the path by relying on that attainment.
Trong đó, appamattikā có nghĩa là nhỏ nhặt, vì không có những người đã đạt đến cõi trời hay đạo nhờ vào sự thành tựu đó.
Yadidaṃ paññāvuddhīti kammassakatapaññādīnaṃ vuddhi.
Yadidaṃ paññāvuddhī means the growth of knowledge such as the knowledge of kamma as one’s own.
Yadidaṃ paññāvuddhī có nghĩa là sự tăng trưởng của trí tuệ về nghiệp, v.v.
Tasmāti yasmā ñātīnaṃ vuddhi nāma diṭṭhadhammikamattā appā parittā, sā saggaṃ vā maggaṃ vā pāpetuṃ asamatthā, tasmā.
Tasmā means: because the growth of relatives is merely an increase in this visible existence, it is small and trifling; that (growth) is incapable of leading to heaven or to the path; therefore.
Tasmā có nghĩa là vì sự tăng trưởng của thân quyến chỉ là sự tăng trưởng trong đời hiện tại, nhỏ nhặt, không có khả năng đưa đến cõi trời hay đạo, nên.
Paññāvuddhiyāti kammassakatādipaññāya vuddhiyā.
Paññāvuddhiyā means by the growth of knowledge such as knowledge of kamma as one’s own.
Paññāvuddhiyā có nghĩa là sự tăng trưởng của trí tuệ về nghiệp, v.v.
81. Navamassāpi paṭhamaṃ aṭṭhuppattiyameva kathitaṃ.
81. The first (sutta) of the ninth (vagga) was also taught based on its origin.
81. Bài kinh đầu tiên của phẩm thứ chín cũng được nói ra dựa trên duyên khởi.
Sambahulā kira bhikkhū dhammasabhāyaṃ nisinnā kumbhaghosakaṃ ārabbha ‘‘asukaṃ nāma kulaṃ pubbe appayasaṃ appaparivāraṃ ahosi, idāni mahāyasaṃ mahāparivāraṃ jāta’’nti kathayiṃsu.
Indeed, many bhikkhus were sitting in the Dhamma hall, discussing Kumbhaghosaka: “A certain family was formerly one with little fame and few followers, but now it has become one with great fame and many followers.”
Thật vậy, nhiều Tỳ-khưu đang ngồi trong Pháp đường, nói về Kumbhaghosaka: "Gia đình nọ trước đây ít danh tiếng, ít tùy tùng; nay đã trở thành nhiều danh tiếng, nhiều tùy tùng."
Satthā purimanayeneva āgantvā tesaṃ vacanaṃ sutvā imaṃ suttaṃ ārabhi.
The Teacher approached as before, heard their words, and initiated this Sutta.
Đức Đạo Sư đến theo cách cũ, nghe lời họ nói, và khởi xướng bài kinh này.
Tassattho heṭṭhā vuttanayeneva veditabbo.
Its meaning should be understood according to the method stated below.
Ý nghĩa của nó nên được hiểu theo cách đã nói ở trên.
130. Ito paresu adhammaṃ dhammoti dīpentītiādīsu suttantapariyāyena tāva dasa kusalakammapathā dhammo, dasa akusalakammapathā adhammo.
130. In the suttas beyond this, such as adhammaṃ dhammoti dīpenti (declare what is not Dhamma to be Dhamma), the ten wholesome courses of action (kusalakammapathā) are Dhamma, and the ten unwholesome courses of action (akusalakammapathā) are not Dhamma, according to the Suttanta method.
130. Trong các bài kinh tiếp theo, như adhammaṃ dhammoti dīpentī, v.v., theo cách nói của kinh tạng, mười nghiệp đạo thiện là pháp (dhamma), mười nghiệp đạo bất thiện là phi pháp (adhamma).
Tathā cattāro satipaṭṭhānā cattāro sammappadhānā cattāro iddhipādā pañcindriyāni pañca balāni satta bojjhaṅgā ariyo aṭṭhaṅgiko maggoti sattatiṃsa bodhipakkhiyadhammā dhammo nāma; tayo satipaṭṭhānā tayo sammappadhānā tayo iddhipādā cha indriyāni cha balāni aṭṭha bojjhaṅgā navaṅgiko maggoti ca cattāro upādānā pañca nīvaraṇāni satta anusayā aṭṭha micchattāni ca ayaṃ adhammo.
Likewise, the thirty-seven factors conducive to awakening (bodhipakkhiyadhammā), namely the four foundations of mindfulness (satipaṭṭhānā), the four right efforts (sammappadhānā), the four bases of psychic power (iddhipādā), the five faculties (indriyāni), the five powers (balāni), the seven factors of awakening (bojjhaṅgā), and the Noble Eightfold Path (ariyo aṭṭhaṅgiko maggo), are Dhamma; and not Dhamma (adhammo) are the three foundations of mindfulness, the three right efforts, the three bases of psychic power, the six faculties, the six powers, the eight factors of awakening, and the ninefold path, as well as the four clingings (upādānā), the five hindrances (nīvaraṇāni), the seven latent tendencies (anusayā), and the eight wrongnesses (micchattāni).
Tương tự, bốn niệm xứ, bốn chánh cần, bốn thần túc, năm căn, năm lực, bảy chi giác ngộ, và Bát chánh đạo cao thượng – ba mươi bảy pháp trợ bồ-đề này được gọi là pháp (dhamma); còn ba niệm xứ, ba chánh cần, ba thần túc, sáu căn, sáu lực, tám chi giác ngộ, và Cửu chi đạo, cùng với bốn thủ, năm triền cái, bảy tùy miên, và tám tà kiến – đây là phi pháp (adhamma).
Tattha yaṃkiñci ekaṃ adhammakoṭṭhāsaṃ gahetvā ‘‘imaṃ adhammaṃ dhammoti karissāma, evaṃ amhākaṃ ācariyakulaṃ niyyānikaṃ bhavissati, mayaṃ ca loke pākaṭā bhavissāmā’’ti taṃ adhammaṃ ‘‘dhammo aya’’nti kathayantā adhammaṃ dhammoti dīpenti nāma.
Among these, taking any one part of what is not Dhamma and saying, “We will make this not-Dhamma to be Dhamma; thus our lineage of teachers will be conducive to liberation, and we ourselves will become famous in the world,” those who declare that not-Dhamma to be “this is Dhamma” are said to be declaring what is not Dhamma to be Dhamma.
Trong đó, lấy một phần phi pháp nào đó, và nói rằng: "Chúng ta sẽ biến phi pháp này thành pháp. Như vậy, dòng truyền thừa của chúng ta sẽ được giải thoát, và chúng ta sẽ trở nên nổi tiếng trên thế gian," những người nói rằng phi pháp này là pháp thì được gọi là biến phi pháp thành pháp.
Tatheva dhammakoṭṭhāsesu ekaṃ gahetvā ‘‘ayaṃ adhammo’’ti kathentā dhammaṃ adhammoti dīpenti nāma.
Similarly, taking one of the aspects of Dhamma and stating, "This is not Dhamma," they declare Dhamma to be not Dhamma.
Tương tự như vậy, khi lấy một phần trong các bộ phận của pháp và nói rằng “đây là phi pháp”, thì gọi là trình bày pháp là phi pháp.
Vinayapariyāyena pana bhūtena vatthunā codetvā sāretvā yathāpaṭiññāya kattabbaṃ kammaṃ dhammo nāma, abhūtena vatthunā acodetvā asāretvā apaṭiññāya kattabbaṃ kammaṃ adhammo nāma.
However, according to the Vinaya system, an action that is to be done after having been accused and reminded based on an existing matter, in accordance with the admission, is called Dhamma. An action that is to be done without accusation, without reminder, and without admission, based on a non-existent matter, is called not Dhamma.
Nhưng theo phương pháp của Luật, hành động cần phải làm sau khi quở trách, nhắc nhở với một sự việc có thật và theo lời thú nhận, thì gọi là pháp; hành động cần phải làm mà không quở trách, không nhắc nhở với một sự việc không có thật và không có lời thú nhận, thì gọi là phi pháp.
Suttantapariyāyena rāgavinayo dosavinayo mohavinayo saṃvaro pahānaṃ paṭisaṅkhāti ayaṃ vinayo nāma, rāgādīnaṃ avinayo asaṃvaro appahānaṃ apaṭisaṅkhāti ayaṃ avinayo nāma.
According to the Suttanta system, the subduing of lust, the subduing of hatred, the subduing of delusion, restraint, abandoning, and contemplation—this is called Vinaya. The non-subduing of lust, etc., non-restraint, non-abandoning, and non-contemplation—this is called Avinaya.
Theo phương pháp của Kinh tạng, sự đoạn trừ tham, đoạn trừ sân, đoạn trừ si, sự phòng hộ, sự đoạn trừ, sự quán xét, đây gọi là Luật (Vinaya); sự không đoạn trừ, không phòng hộ, không đoạn trừ, không quán xét tham và các phiền não khác, đây gọi là Phi Luật (Avinaya).
Vinayapariyāyena vatthusampatti, ñattisampatti, anussāvanasampatti, sīmāsampatti, parisasampattīti ayaṃ vinayo nāma.
According to the Vinaya system, the success of the case, the success of the motion, the success of the announcement, the success of the boundary, and the success of the assembly—this is called Vinaya.
Theo phương pháp của Luật tạng, sự thành tựu sự việc, thành tựu lời tuyên bố, thành tựu lời tuyên đọc, thành tựu giới hạn (sīmā), thành tựu hội chúng, đây gọi là Luật.
Vatthuvipatti, ñattivipatti, anussāvanavipatti, sīmāvipatti parisavipattīti ayaṃ avinayo nāma.
The failure of the case, the failure of the motion, the failure of the announcement, the failure of the boundary, and the failure of the assembly—this is called Avinaya.
Sự thất bại về sự việc, thất bại về lời tuyên bố, thất bại về lời tuyên đọc, thất bại về giới hạn (sīmā), thất bại về hội chúng, đây gọi là Phi Luật.
Suttantapariyāyena cattāro satipaṭṭhānā cattāro sammappadhānā…pe… ariyo aṭṭhaṅgiko maggoti idaṃ bhāsitaṃ lapitaṃ tathāgatena; tayo satipaṭṭhānā tayo sammappadhānā tayo iddhipādā cha indriyāni cha balāni aṭṭha bojjhaṅgā navaṅgiko maggoti idaṃ abhāsitaṃ alapitaṃ tathāgatena.
According to the Suttanta system, the four foundations of mindfulness, the four right exertions... and the Noble Eightfold Path—this is spoken and declared by the Tathāgata; the three foundations of mindfulness, the three right exertions, the three bases of psychic power, the six faculties, the six powers, the eight factors of awakening, and the ninefold path—this is not spoken and not declared by the Tathāgata.
Theo phương pháp của Kinh tạng, bốn pháp niệm xứ (satipaṭṭhāna), bốn pháp chánh cần (sammappadhāna)… (tức là) Bát Chánh Đạo (ariyo aṭṭhaṅgiko maggo), đây gọi là điều Như Lai đã nói, đã thuyết giảng; ba pháp niệm xứ, ba pháp chánh cần, ba pháp thần túc (iddhipāda), sáu căn (indriya), sáu lực (bala), tám chi phần giác ngộ (bojjhaṅga), Cửu Chánh Đạo, đây gọi là điều Như Lai không nói, không thuyết giảng.
Vinayapariyāyena cattāro pārājikā terasa saṅghādisesā dve aniyatā tiṃsa nissaggiyā pācittiyāti idaṃ bhāsitaṃ lapitaṃ tathāgatena; tayo pārājikā cuddasa saṅghādisesā tayo aniyatā ekatiṃsa nissaggiyā pācittiyāti idaṃ abhāsitaṃ alapitaṃ tathāgatena.
According to the Vinaya system, the four pārājikas, the thirteen saṅghādisesas, the two aniyatas, and the thirty nissaggiya pācittiyas—this is spoken and declared by the Tathāgata; the three pārājikas, the fourteen saṅghādisesas, the three aniyatas, and the thirty-one nissaggiya pācittiyas—this is not spoken and not declared by the Tathāgata.
Theo phương pháp của Luật tạng, bốn giới Pārājika, mười ba giới Saṅghādisesa, hai giới Aniyata, ba mươi giới Nissaggiya Pācittiya, đây gọi là điều Như Lai đã nói, đã thuyết giảng; ba giới Pārājika, mười bốn giới Saṅghādisesa, ba giới Aniyata, ba mươi mốt giới Nissaggiya Pācittiya, đây gọi là điều Như Lai không nói, không thuyết giảng.
Suttantapariyāyena devasikaṃ phalasamāpattisamāpajjanaṃ mahākaruṇāsamāpattisamāpajjanaṃ buddhacakkhunā lokavolokanaṃ aṭṭhuppattivasena suttantadesanā jātakakathāti idaṃ āciṇṇaṃ, na devasikaṃ phalasamāpattisamāpajjanaṃ…pe… na jātakakathāti idaṃ anāciṇṇaṃ.
According to the Suttanta system, the daily attainment of fruition concentration, the attainment of great compassion concentration, observing the world with the Buddha-eye, teaching Suttantas based on their arising, and Jātaka stories—this is customary; not daily attainment of fruition concentration... and not Jātaka stories—this is uncustomary.
Theo phương pháp của Kinh tạng, sự nhập quả định hàng ngày, sự nhập đại bi định, sự quán sát thế gian bằng Phật nhãn, sự thuyết giảng kinh điển theo sự việc phát sinh, sự kể chuyện Jātaka, đây gọi là điều đã được thực hành (āciṇṇa); sự không nhập quả định hàng ngày… (tức là) sự không kể chuyện Jātaka, đây gọi là điều không được thực hành (anāciṇṇa).
Vinayapariyāyena nimantitassa vassāvāsaṃ vasitvā apaloketvā cārikāpakkamanaṃ pavāretvā cārikāpakkamanaṃ, āgantukehi saddhiṃ paṭhamaṃ paṭisanthārakaraṇanti idaṃ āciṇṇaṃ, tasseva āciṇṇassa akaraṇaṃ anāciṇṇaṃ nāma.
According to the Vinaya system, having spent the Rains-residence after being invited, departing on a journey after informing, departing on a journey after having performed the pavāraṇā ceremony, and first extending hospitality to arriving monastics—this is customary; not doing what is customary in these cases is called uncustomary.
Theo phương pháp của Luật tạng, sau khi an cư mùa mưa theo lời thỉnh cầu, sau khi tự mãn nguyện (pavāraṇā) rồi đi du hành, sự chào hỏi các Tỳ-khưu mới đến trước tiên, đây gọi là điều đã được thực hành; sự không thực hành điều đã được thực hành đó, thì gọi là điều không được thực hành.
Yaṃ panetaṃ sabbasuttānaṃ pariyosāne tecimaṃ saddhammaṃ antaradhāpentīti vuttaṃ, tattha pañca antaradhānāni nāma adhigamaantaradhānaṃ, paṭipattiantaradhānaṃ, pariyattiantaradhānaṃ, liṅgaantaradhānaṃ, dhātuantaradhānanti.
And as for what is stated at the end of all suttas, "They cause this good Dhamma to disappear," there are five kinds of disappearance: the disappearance of attainment, the disappearance of practice, the disappearance of study, the disappearance of the characteristic, and the disappearance of the relics.
Và điều đã được nói ở cuối tất cả các kinh rằng “họ làm cho Chánh pháp này biến mất”, ở đây năm sự biến mất là: sự biến mất của sự chứng đắc (adhigama), sự biến mất của sự thực hành (paṭipatti), sự biến mất của sự học hỏi (pariyatti), sự biến mất của hình tướng (liṅga), sự biến mất của xá-lợi (dhātu).
Tattha adhigamoti cattāro maggā, cattāri phalāni, catasso paṭisambhidā, tisso vijjā, cha abhiññāti.
Among these, attainment means the four paths, the four fruitions, the four analytical knowledges (paṭisambhidā), the three knowledges (vijjā), and the six supernormal powers (abhiññā).
Trong đó, sự chứng đắc là bốn đạo, bốn quả, bốn tuệ phân tích (paṭisambhidā), ba minh (vijjā), sáu thắng trí (abhiññā).
So parihāyamāno paṭisambhidāto paṭṭhāya parihāyati.
When this declines, it declines starting from the analytical knowledges.
Khi sự chứng đắc suy giảm, nó sẽ suy giảm bắt đầu từ tuệ phân tích.
Buddhānaṃ hi parinibbānato vassasahassameva paṭisambhidā nibbattetuṃ sakkonti, tato paraṃ cha abhiññā, tato tāpi nibbattetuṃ asakkontā tisso vijjā nibbattenti.
Indeed, for a thousand years after the Buddhas' Parinibbāna, it is possible to generate analytical knowledges; after that, the six supernormal powers; and when those too cannot be generated, they generate the three knowledges.
Thật vậy, chỉ một ngàn năm sau khi chư Phật nhập Niết-bàn, tuệ phân tích mới có thể phát sinh; sau đó là sáu thắng trí; sau khi không thể phát sinh sáu thắng trí, thì ba minh phát sinh.
Gacchante gacchante kāle tāpi nibbattetuṃ asakkontā sukkhavipassakā honti.
As time passes, when even those cannot be generated, they become bare-insight meditators (sukkhavipassaka).
Thời gian trôi qua, khi không thể phát sinh ba minh, thì trở thành những người tuệ quán thuần túy (sukkhavipassakā).
Eteneva upāyena anāgāmino sakadāgāmino sotāpannāti.
By this same method, non-returners, once-returners, and stream-enterers are meant.
Cũng theo cách này là các bậc Bất Lai (Anāgāmī), Nhất Lai (Sakadāgāmī), Dự Lưu (Sotāpanna).
Tesu dharantesu adhigamo anantarahito nāma na hoti.
As long as these endure, attainment is not called disappeared.
Khi các bậc ấy còn hiện hữu, sự chứng đắc không được gọi là biến mất.
Pacchimakassa pana sotāpannassa jīvitakkhayena adhigamo antarahito nāma hoti.
But with the demise of the last stream-enterer's life, attainment is called disappeared.
Nhưng khi vị Dự Lưu cuối cùng chấm dứt mạng sống, sự chứng đắc được gọi là biến mất.
Idaṃ adhigamaantaradhānaṃ nāma.
This is called the disappearance of attainment.
Đây gọi là sự biến mất của sự chứng đắc.
Paṭipattiantaradhānaṃ nāma jhānavipassanāmaggaphalāni nibbattetuṃ asakkontā catupārisuddhisīlamattaṃ rakkhanti.
The disappearance of practice means that when they cannot generate jhāna, vipassanā, path, and fruition, they maintain only the pure morality of the fourfold purity of conduct.
Sự biến mất của sự thực hành là khi không thể phát sinh thiền định, tuệ quán, đạo và quả, thì chỉ giữ gìn giới Tứ Thanh Tịnh (catupārisuddhisīla).
Gacchante gacchante kāle ‘‘sīlaṃ paripuṇṇaṃ katvā rakkhāma, padhānañca anuyuñjāma, na ca maggaṃ vā phalaṃ vā sacchikātuṃ sakkoma, natthi idāni ariyadhammapaṭivedho’’ti vosānaṃ āpajjitvā kosajjabahulā aññamaññaṃ na codenti na sārenti akukkuccakā honti, tato paṭṭhāya khuddānukhuddakāni maddanti.
As time passes, they conclude, "We maintain perfect morality and strive diligently, but we cannot realize the path or fruition; there is no penetration of the noble Dhamma now," and become prone to negligence, no longer admonishing or reminding each other, and become unconcerned, whereupon they transgress minor and lesser rules.
Thời gian trôi qua, họ đi đến kết luận rằng “chúng ta giữ gìn giới luật một cách đầy đủ, và tinh tấn thực hành, nhưng chúng ta không thể chứng đạt đạo hay quả, không còn sự thể nhập các pháp cao thượng (ariyadhamma) nữa”, rồi trở nên lười biếng, không quở trách hay nhắc nhở lẫn nhau, trở nên không còn hối hận; từ đó, họ vi phạm các giới nhỏ.
Gacchante gacchante kāle pācittiyathullaccayāni āpajjanti, tato garukāpattiṃ.
As time passes, they commit offenses of pācittiya and thullaccaya, then serious offenses.
Thời gian trôi qua, họ vi phạm các giới Pācittiya và Thullaccaya; sau đó là các trọng tội (garukāpatti).
Pārājikamattameva tiṭṭhati.
Only the pārājika offense remains.
Chỉ còn lại giới Pārājika.
Cattāri pārājikāni rakkhantānaṃ bhikkhūnaṃ satepi sahassepi dharamāne paṭipatti anantarahitā nāma na hoti.
As long as there are hundreds or thousands of monks who maintain the four pārājikas, practice is not called disappeared.
Khi hàng trăm hay hàng ngàn Tỳ-khưu giữ gìn bốn giới Pārājika còn hiện hữu, sự thực hành không được gọi là biến mất.
Pacchimakassa pana bhikkhuno sīlabhedena vā jīvitakkhayena vā antarahitā hotīti idaṃ paṭipattiantaradhānaṃ nāma.
But with the breach of the last monk's morality or the demise of his life, it is called disappeared; this is called the disappearance of practice.
Nhưng khi vị Tỳ-khưu cuối cùng phạm giới hoặc chấm dứt mạng sống, sự thực hành biến mất; đây gọi là sự biến mất của sự thực hành.
Pariyattīti tepiṭakaṃ buddhavacanaṃ sāṭṭhakathā pāḷi.
Study (Pariyatti) refers to the Tipiṭaka, the Buddha's word, including the commentaries (aṭṭhakathā) and the Pāḷi text.
Sự học hỏi là lời dạy của Đức Phật trong Tam Tạng (Tepiṭaka) cùng với các chú giải (aṭṭhakathā).
Yāva sā tiṭṭhati, tāva pariyatti paripuṇṇā nāma hoti.
As long as it endures, study is called complete.
Chừng nào nó còn tồn tại, chừng đó sự học hỏi được gọi là đầy đủ.
Gacchante gacchante kāle rājayuvarājāno adhammikā honti, tesu adhammikesu rājāmaccādayo adhammikā honti, tato raṭṭhajanapadavāsinoti.
As time passes, kings and crown princes become unrighteous; when they are unrighteous, royal ministers, etc., become unrighteous, and then the people of the country and provinces.
Thời gian trôi qua, các vị vua và hoàng tử trở nên phi pháp; khi họ phi pháp, các quan lại và những người khác cũng phi pháp; sau đó là dân chúng trong quốc gia và các vùng.
Etesaṃ adhammikatāya devo na sammā vassati, tato sassāni na sampajjanti.
Due to their unrighteousness, the sky does not rain properly, so crops do not prosper.
Do sự phi pháp của những người này, trời không mưa đúng lúc, do đó mùa màng không được tốt.
Tesu asampajjantesu paccayadāyakā bhikkhusaṅghassa paccaye dātuṃ na sakkonti, bhikkhū paccayehi kilamantā antevāsike saṅgahetuṃ na sakkonti.
When these do not prosper, those who provide requisites cannot give requisites to the community of monks, and the monks, suffering from lack of requisites, cannot retain their disciples.
Khi mùa màng không tốt, những người cúng dường không thể cúng dường các vật dụng cho Tăng đoàn; các Tỳ-khưu, vì thiếu thốn vật dụng, không thể thu nhận các đệ tử.
Gacchante gacchante kāle pariyatti parihāyati, atthavasena dhāretuṃ na sakkonti, pāḷivaseneva dhārenti.
As time passes, study declines; they cannot retain it for its meaning, they retain it only for its Pāḷi text.
Thời gian trôi qua, sự học hỏi suy giảm, họ không thể ghi nhớ theo nghĩa, mà chỉ ghi nhớ theo văn bản Pali.
Tato gacchante gacchante kāle pāḷimpi sakalaṃ dhāretuṃ na sakkonti, paṭhamaṃ abhidhammapiṭakaṃ parihāyati.
Then, as time passes, they cannot retain the entire Pāḷi text; first, the Abhidhamma Piṭaka declines.
Từ đó, thời gian trôi qua, họ cũng không thể ghi nhớ toàn bộ văn bản Pali; trước tiên là Tạng Vi Diệu Pháp (Abhidhammapiṭaka) suy giảm.
Parihāyamānaṃ matthakato paṭṭhāya parihāyati.
When it declines, it declines starting from the top.
Khi suy giảm, nó suy giảm bắt đầu từ phần trên cùng.
Paṭhamameva hi paṭṭhānamahāpakaraṇaṃ parihāyati, tasmiṃ parihīne yamakaṃ, kathāvatthu, puggalapaññatti, dhātukathā, vibhaṅgo, dhammasaṅgahoti.
Indeed, first the Mahāpakaraṇa of Paṭṭhāna declines; when that has declined, then Yamaka, Kathāvatthu, Puggalapaññatti, Dhātukathā, Vibhaṅga, and Dhammasaṅgaṇī.
Thật vậy, trước tiên là bộ Mahāpakaraṇa Paṭṭhāna suy giảm; khi bộ đó suy giảm, thì đến Yamaka, Kathāvatthu, Puggalapaññatti, Dhātukathā, Vibhaṅga, Dhammasaṅgaṇī.
Evaṃ abhidhammapiṭake parihīne matthakato paṭṭhāya suttantapiṭakaṃ parihāyati.
Thus, with the Abhidhamma Piṭaka having declined, the Suttanta Piṭaka declines starting from the top.
Như vậy, khi Tạng Vi Diệu Pháp suy giảm, Tạng Kinh (Suttantapiṭaka) suy giảm bắt đầu từ phần trên cùng.
Paṭhamañhi aṅguttaranikāyo parihāyati, tasmimpi paṭhamaṃ ekādasakanipāto, tato dasakanipāto…pe… tato ekakanipātoti.
Indeed, first the Aṅguttaranikāya declines; and within that, first the Ekādasakanipāta, then the Dasakanipāta... then the Ekakanipāta.
Thật vậy, trước tiên là Tăng Chi Bộ Kinh (Aṅguttaranikāya) suy giảm; trong đó, trước tiên là Tập Mười Một Chi (Ekādasakanipāta), sau đó là Tập Mười Chi (Dasakanipāta)… (tức là) sau đó là Tập Một Chi (Ekakanipāta).
Evaṃ aṅguttare parihīne matthakato paṭṭhāya saṃyuttanikāyo parihāyati.
Thus, with the Aṅguttara having declined, the Saṃyuttanikāya declines starting from the top.
Như vậy, khi Tăng Chi Bộ Kinh suy giảm, Tương Ưng Bộ Kinh (Saṃyuttanikāya) suy giảm bắt đầu từ phần trên cùng.
Paṭhamaṃ hi mahāvaggo parihāyati, tato saḷāyatanavaggo, khandhavaggo, nidānavaggo, sagāthāvaggoti.
Indeed, first the Mahāvagga declines; then the Saḷāyatanavagga, Khandhavagga, Nidānavagga, and Sagāthāvagga.
Thật vậy, trước tiên là Mahāvagga suy giảm, sau đó là Saḷāyatanavagga, Khandhavagga, Nidānavagga, Sagāthāvagga.
Evaṃ saṃyuttanikāye parihīne matthakato paṭṭhāya majjhimanikāyo parihāyati.
Thus, with the Saṃyutta having declined, the Majjhimanikāya declines starting from the top.
Như vậy, khi Tương Ưng Bộ Kinh suy giảm, Trung Bộ Kinh (Majjhimanikāya) suy giảm bắt đầu từ phần trên cùng.
Paṭhamaṃ hi uparipaṇṇāsako parihāyati, tato majjhimapaṇṇāsako, tato mūlapaṇṇāsakoti.
Indeed, first the Uparipaṇṇāsaka declines; then the Majjhimapaṇṇāsaka, then the Mūlapaṇṇāsaka.
Thật vậy, trước tiên là Uparipaṇṇāsaka suy giảm, sau đó là Majjhimapaṇṇāsaka, sau đó là Mūlapaṇṇāsaka.
Evaṃ majjhimanikāye parihīne matthakato paṭṭhāya dīghanikāyo parihāyati.
Thus, with the Majjhima having declined, the Dīghanikāya declines starting from the top.
Như vậy, khi Trung Bộ Kinh suy giảm, Trường Bộ Kinh (Dīghanikāya) suy giảm bắt đầu từ phần trên cùng.
Paṭhamañhi pāthikavaggo parihāyati, tato mahāvaggo, tato sīlakkhandhavaggoti.
First, the Pāthika Vagga declines, then the Mahāvagga, then the Sīlakkhandha Vagga.
Trước tiên, phẩm Pāthika bị biến mất, sau đó là phẩm Mahāvagga, rồi đến phẩm Sīlakkhandhavagga.
Evaṃ dīghanikāye parihīne suttantapiṭakaṃ parihīnaṃ nāma hoti.
Thus, with the Dīgha Nikāya declining, the Suttanta Piṭaka is said to have declined.
Như vậy, khi Trường Bộ Kinh biến mất, thì tên gọi Tạng Kinh (Suttantapiṭaka) cũng biến mất.
Vinayapiṭakena saddhiṃ jātakameva dhārenti.
Along with the Vinaya Piṭaka, they retain only the Jātaka.
Cùng với Tạng Luật (Vinayapiṭaka), họ chỉ còn giữ lại Jātaka (Bổn Sanh).
Vinayapiṭakaṃ lajjinova dhārenti, lābhakāmā pana ‘‘suttante kathitepi sallakkhentā natthī’’ti jātakameva dhārenti.
Those with shame retain the Vinaya Piṭaka, but those desirous of gain, thinking, “There is no one who pays attention even when the Suttantas are preached,” retain only the Jātaka.
Chỉ những người có lòng hổ thẹn mới giữ Tạng Luật, còn những người ham lợi lộc thì nghĩ rằng “dù có thuyết giảng các bài kinh, cũng không có ai để ý”, nên họ chỉ giữ lại Jātaka.
Gacchante gacchante kāle jātakampi dhāretuṃ na sakkonti.
As time passes, they are unable to retain even the Jātaka.
Thời gian trôi qua, họ cũng không thể giữ được cả Jātaka.
Atha tesaṃ paṭhamaṃ vessantarajātakaṃ parihāyati, tato paṭilomakkamena puṇṇakajātakaṃ, mahānāradajātakanti pariyosāne apaṇṇakajātakaṃ parihāyati.
Then, for them, first the Vessantara Jātaka declines, then in reverse order the Puṇṇaka Jātaka, the Mahānārada Jātaka, and finally the Apaṇṇaka Jātaka declines.
Khi đó, trước tiên, Jātaka Vessantara của họ biến mất, sau đó theo thứ tự ngược lại là Jātaka Puṇṇaka, Jātaka Mahānārada, và cuối cùng là Jātaka Apaṇṇaka cũng biến mất.
Evaṃ jātake parihīne vinayapiṭakameva dhārenti.
Thus, with the Jātaka declining, they retain only the Vinaya Piṭaka.
Như vậy, khi Jātaka biến mất, họ chỉ còn giữ Tạng Luật.
Gacchante gacchante kāle vinayapiṭakampi matthakato paṭṭhāya parihāyati.
As time passes, even the Vinaya Piṭaka declines, starting from its very top.
Thời gian trôi qua, Tạng Luật cũng biến mất từ phần trên xuống.
Paṭhamañhi parivāro parihāyati, tato khandhako, bhikkhunīvibhaṅgo, mahāvibhaṅgoti anukkamena uposathakkhandhakamattameva dhārenti.
First, the Parivāra declines, then the Khandhaka, the Bhikkhunīvibhaṅga, the Mahāvibhaṅga; in this sequence, they retain only the Uposathakkhandhaka.
Trước tiên, phần Parivāra biến mất, sau đó là Khandhaka, Bhikkhunīvibhaṅga, Mahāvibhaṅga, theo thứ tự đó, họ chỉ còn giữ lại phần Uposathakkhandhaka.
Tadāpi pariyatti antarahitā na hoti.
Even then, the Pariyatti is not yet vanished.
Ngay cả khi đó, Giáo Pháp (Pariyatti) vẫn chưa biến mất hoàn toàn.
Yāva pana manussesu cātuppadikagāthāpi pavattati, tāva pariyatti anantarahitāva hoti.
As long as a four-line stanza (cātuppadika gāthā) continues among humans, so long is the Pariyatti not vanished.
Chừng nào con người vẫn còn tụng đọc dù chỉ một bài kệ bốn câu (cātuppadikagāthā), chừng đó Giáo Pháp vẫn chưa biến mất.
Yadā saddho pasanno rājā hatthikkhandhe suvaṇṇacaṅkoṭakamhi sahassatthavikaṃ ṭhapāpetvā ‘‘buddhehi kathitaṃ cātuppadikagāthaṃ jānanto imaṃ sahassaṃ gaṇhatū’’ti nagare bheriṃ carāpetvā gaṇhanakaṃ alabhitvā ‘‘ekavāraṃ carāpite nāma suṇantāpi honti assuṇantāpī’’ti yāvatatiyaṃ carāpetvā gaṇhanakaṃ alabhitvā rājapurisā taṃ sahassatthavikaṃ puna rājakulaṃ pavesenti, tadā pariyatti antarahitā nāma hoti.
When a king, full of faith and devotion, has a thousand-worth purse placed in a golden casket on the elephant's back and has a drum beaten in the city, proclaiming, “Let whoever knows a four-line stanza spoken by the Buddhas take this thousand,” and finds no one to take it; and then, thinking, “Some might hear even if it’s proclaimed once, but others might not,” has it proclaimed a third time and still finds no one to take it, and the royal officials return that thousand-worth purse to the royal palace – then the Pariyatti is said to have vanished.
Khi một vị vua có đức tin và lòng tịnh tín, đặt một túi ngàn đồng tiền vàng lên lưng voi và cho đánh trống khắp thành rằng: “Ai biết bài kệ bốn câu do chư Phật thuyết giảng thì hãy nhận lấy ngàn đồng tiền vàng này”, nhưng không tìm được người nhận. Ngài nghĩ: “Có thể có người nghe được nhưng không nghe rõ”, nên cho đánh trống lần thứ hai, rồi lần thứ ba, nhưng vẫn không tìm được người nhận. Khi các quan lại đưa túi ngàn đồng tiền vàng trở về hoàng cung, thì lúc đó Giáo Pháp (Pariyatti) được gọi là đã biến mất hoàn toàn.
Idaṃ pariyattiantaradhānaṃ nāma.
This is called the vanishing of the Pariyatti.
Đây được gọi là sự biến mất của Giáo Pháp (Pariyattiantaradhāna).
Gacchante gacchante kāle cīvaraggahaṇaṃ pattaggahaṇaṃ sammiñjanapasāraṇaṃ ālokitavilokitaṃ na pāsādikaṃ hoti.
As time passes, the manner of taking robes, taking bowls, drawing in and extending limbs, looking forward and looking around, will no longer be pleasing.
Thời gian trôi qua, cách cầm y, cầm bát, cách co duỗi chân tay, cách nhìn ngó cũng không còn trang nghiêm.
Nigaṇṭhasamaṇā viya alābupattaṃ bhikkhū pattaṃ aggabāhāya pakkhipitvā ādāya vicaranti, ettāvatāpi liṅgaṃ anantarahitameva hoti.
Monks will carry their bowls like Nigaṇṭha ascetics, holding them tucked under their armpit; even with this, the outward appearance (liṅga) is not yet vanished.
Các tỳ-khưu mang bát như các tu sĩ Nigaṇṭha, đặt bát vào khuỷu tay và đi khất thực. Ngay cả như vậy, hình tướng (liṅga) vẫn chưa biến mất hoàn toàn.
Gacchante gacchante pana kāle aggabāhato otāretvā hatthena vā sikkāya vā olambitvā vicaranti, cīvarampi rajanasāruppaṃ akatvā oṭṭhaṭṭhivaṇṇaṃ katvā vicaranti.
But as time passes, they will take the bowl from under the armpit and carry it dangling by hand or in a net; and they will wear robes without dyeing them properly, making them the color of a camel's bone, and wander about.
Nhưng thời gian trôi qua, họ lấy bát ra khỏi khuỷu tay, cầm bằng tay hoặc treo bằng dây và đi khất thực; y phục cũng không nhuộm đúng màu mà nhuộm màu như vỏ ốc và đi khất thực.
Gacchante gacchante kāle rajanampi na hoti dasacchindanampi ovaṭṭikavijjhanampi, kappamattaṃ katvā vaḷañjenti.
As time passes, there will be no dyeing, no cutting of fringes, no piercing of loops, and they will use robes just as they are.
Thời gian trôi qua, không còn thuốc nhuộm, không còn cắt vải thành mười mảnh, không còn đục lỗ để vá, họ chỉ cắt một miếng vải nhỏ vừa đủ để sử dụng.
Puna ovaṭṭikaṃ vijjhitvā kappaṃ na karonti.
Later, they will not pierce the loops or cut the robes.
Sau đó, họ không đục lỗ để vá và cũng không cắt một miếng vải nhỏ.
Tato ubhayampi akatvā dasā chetvā paribbājakā viya caranti.
Then, without doing either, they will merely cut the fringes and wander about like wandering ascetics.
Rồi họ không làm cả hai điều đó, chỉ cắt các tua vải và đi như những người du sĩ.
Gacchante gacchante kāle ‘‘ko iminā amhākaṃ attho’’ti khuddakaṃ kāsāvakhaṇḍaṃ hatthe vā gīvāya vā bandhanti, kesesu vā allīyāpenti, dārabharaṇaṃ vā karontā kasitvā vapitvā jīvikaṃ kappetvā vicaranti.
As time passes, thinking, “What use is this to us?” they will tie small pieces of brown cloth on their hands or necks, or stick them in their hair; or they will support families, cultivating and sowing, and living their lives.
Thời gian trôi qua, họ nói: “Cái này có ích gì cho chúng ta?”, rồi cắt một mảnh vải kāṣāya nhỏ và buộc vào tay hoặc cổ, hoặc dán vào tóc, hoặc họ làm nghề nông, cày cấy để nuôi vợ con và sống qua ngày.
Tadā dakkhiṇaṃ dentā saṅghaṃ uddissa etesaṃ denti.
At that time, those who give offerings will give them to these individuals, dedicating them to the Saṅgha.
Khi đó, những người dâng cúng vật phẩm vẫn dâng cho Tăng chúng, hướng đến những người này.
Idaṃ sandhāya bhagavatā vuttaṃ – ‘‘bhavissanti kho, panānanda, anāgatamaddhānaṃ gotrabhuno kāsāvakaṇṭhā dussīlā pāpadhammā, tesu dussīlesu saṅghaṃ uddissa dānaṃ dassanti, tadāpāhaṃ, ānanda, saṅghagataṃ dakkhiṇaṃ asaṅkheyyaṃ appameyyaṃ vadāmī’’ti (ma. ni. 3.380).
Referring to this, the Blessed One said, “Ananda, in the future there will be those of the Gotama clan, wearing brown cloth on their necks, immoral and evil-natured. To these immoral ones, people will give offerings dedicated to the Saṅgha. Even then, Ananda, I say that the offering made to the Saṅgha is immeasurable and incalculable.”
Về điều này, Thế Tôn đã dạy: “Này Ānanda, trong tương lai sẽ có những người xuất gia (gotrabhuno) mặc y kāṣāya nhưng giới hạnh suy đồi, ác pháp. Khi dâng cúng vật phẩm cho Tăng chúng, hướng đến những người giới hạnh suy đồi ấy, này Ānanda, ta nói rằng phước báu dâng cúng cho Tăng chúng là vô lượng, vô biên.”
Tato gacchante kāle nānāvidhāni kammāni karontā ‘‘papañco esa, kiṃ iminā amhāka’’nti kāsāvakhaṇḍaṃ chinditvā araññe khipanti.
Then, as time passes, performing various kinds of work, thinking, “This is a nuisance, what use is this to us?” they will cut off the pieces of brown cloth and throw them into the forest.
Sau đó, thời gian trôi qua, họ làm đủ mọi thứ nghề nghiệp, nói: “Đây là phiền não, cái này có ích gì cho chúng ta?”, rồi cắt mảnh vải kāṣāya và vứt vào rừng.
Etasmiṃ kāle liṅgaṃ antarahitaṃ nāma hoti.
At this time, the outward appearance (liṅga) is said to have vanished.
Vào thời điểm này, hình tướng (liṅga) được gọi là đã biến mất.
Kassapadasabalassa kira kālato paṭṭhāya yonakānaṃ setavatthaṃ pārupitvā caraṇaṃ cārittaṃ jātanti.
It is said that from the time of Kassapa the Ten-Powered One onwards, it became a custom for Greeks to wear white clothes.
Người ta nói rằng, từ thời Đức Phật Kassapa Dasabala trở đi, việc người Yonaka mặc y trắng đi lại đã trở thành một phong tục.
Idaṃ liṅgaantaradhānaṃ nāma.
This is called the vanishing of the outward appearance (liṅga).
Đây được gọi là sự biến mất của hình tướng (Liṅgantaradhāna).
Dhātuantaradhānaṃ pana evaṃ veditabbaṃ – tīṇi parinibbānāni, kilesaparinibbānaṃ – khandhaparinibbānaṃ, dhātuparinibbānanti.
However, the vanishing of the Relics (dhātuantaradhāna) should be understood as follows: there are three kinds of Parinibbāna: the Parinibbāna of defilements (kilesaparinibbāna), the Parinibbāna of aggregates (khandhaparinibbāna), and the Parinibbāna of relics (dhātuparinibbāna).
Sự biến mất của xá-lợi (Dhātuantaradhāna) cần được hiểu như sau: có ba loại Niết-bàn (parinibbāna) – Niết-bàn phiền não (kilesaparinibbāna), Niết-bàn uẩn (khandhaparinibbāna), và Niết-bàn xá-lợi (dhātuparinibbāna).
Tattha kilesaparinibbānaṃ bodhipallaṅke ahosi, khandhaparinibbānaṃ kusinārāyaṃ, dhātuparinibbānaṃ anāgate bhavissati.
Of these, the Parinibbāna of defilements occurred at the Bodhi-seat, the Parinibbāna of aggregates occurred at Kusinārā, and the Parinibbāna of relics will occur in the future.
Trong đó, Niết-bàn phiền não xảy ra dưới cội Bồ-đề, Niết-bàn uẩn xảy ra tại Kusinārā, còn Niết-bàn xá-lợi sẽ xảy ra trong tương lai.
Kathaṃ?
How?
Như thế nào?
Tato tattha tattha sakkārasammānaṃ alabhamānā dhātuyo buddhānaṃ adhiṭṭhānabalena sakkārasammānalabhanakaṭṭhānaṃ gacchanti.
Then, the relics, not receiving honor and veneration here and there, will go to places where honor and veneration are received, by the power of the Buddhas’ determination.
Khi không còn nhận được sự tôn kính, cúng dường ở những nơi đó, các xá-lợi sẽ di chuyển đến những nơi có thể nhận được sự tôn kính, cúng dường nhờ oai lực của chư Phật.
Gacchante gacchante kāle sabbaṭṭhānesu sakkārasammāno na hoti.
As time passes, honor and veneration will cease in all places.
Thời gian trôi qua, sự tôn kính, cúng dường sẽ không còn ở tất cả mọi nơi.
Sāsanassa hi osakkanakāle imasmiṃ tambapaṇṇidīpe sabbā dhātuyo sannipatitvā mahācetiyaṃ, tato nāgadīpe rājāyatanacetiyaṃ, tato bodhipallaṅkaṃ gamissanti.
Indeed, at the time of the decline of the Sāsana, all relics in this Tambapaṇṇi island will gather at the Mahācetiya, then go to the Rājāyatana Cetiya on Nāgadīpa, and then to the Bodhi-seat.
Khi giáo pháp suy yếu, tất cả các xá-lợi trên đảo Tambapaṇṇi (Tích Lan) này sẽ tập hợp lại tại Đại Tháp (Mahācetiya), sau đó đến Tháp Rājāyatana ở Nāgadīpa, rồi đến cội Bồ-đề.
Nāgabhavanatopi devalokatopi brahmalokatopi dhātuyo mahābodhipallaṅkameva gamissanti.
From the Nāga realm and the deva realms and the Brahmā realms, the relics will all go to the great Bodhimaṇḍa.
Các xá-lợi từ cõi rồng (Nāgabhavana), cõi trời (devaloka), và cõi Phạm thiên (brahmaloka) cũng sẽ tập hợp về cội Đại Bồ-đề.
Sāsapamattāpi dhātu antarā na nassissati.
Not even a single mustard-seed-sized relic will perish along the way.
Dù chỉ một hạt xá-lợi nhỏ như hạt cải cũng sẽ không bị tiêu mất giữa chừng.
Sabbā dhātuyo mahābodhimaṇḍe sannipatitvā buddharūpaṃ gahetvā bodhimaṇḍe pallaṅkena nisinnabuddhasarīrasiriṃ dassenti.
All relics will gather at the great Bodhimaṇḍa, assume the form of the Buddha, and display the splendid body of the Buddha seated cross-legged at the Bodhimaṇḍa.
Tất cả các xá-lợi sẽ tập hợp tại Bồ-đề đạo tràng (bodhimaṇḍa), hóa hiện thành hình tướng của Đức Phật, trình bày vẻ đẹp của kim thân Đức Phật đang ngồi kiết già dưới cội Bồ-đề.
Dvattiṃsa mahāpurisalakkhaṇāni asīti anubyañjanāni byāmappabhāti sabbaṃ paripuṇṇameva hoti.
All thirty-two marks of a Great Man, eighty minor characteristics, and the fathom-wide aura will be perfectly complete.
Ba mươi hai tướng tốt của bậc Đại nhân, tám mươi tướng phụ, và ánh sáng tỏa ra một sải tay đều hoàn hảo.
Tato yamakapāṭihāriyadivase viya pāṭihāriyaṃ katvā dassenti.
Then, they will display a miracle, as on the day of the Twin Miracle (yamakapāṭihāriya).
Sau đó, các xá-lợi sẽ thị hiện thần thông như vào ngày song thần thông (yamakapāṭihāriya).
Tadā manussabhūtasatto nāma tattha gato natthi, dasasahassacakkavāḷe pana devatā sabbāva sannipatitvā ‘‘ajja dasabalo parinibbāyati, itodāni paṭṭhāya andhakāraṃ bhavissatī’’ti paridevanti.
At that time, no human being will be present there; but the devas of the ten-thousand world-systems will all gather and lament, “Today the Ten-Powered One attains Parinibbāna; from now on, there will be darkness.”
Khi đó, không có chúng sinh loài người nào có mặt ở đó, nhưng chư thiên từ mười ngàn thế giới (cakkavāḷa) đều tập hợp lại, than khóc rằng: “Hôm nay Đức Thế Tôn (Dasabala) nhập Niết-bàn, từ nay trở đi sẽ là bóng tối.”
Atha dhātusarīrato tejo samuṭṭhāya taṃ sarīraṃ apaṇṇattikabhāvaṃ gameti.
Then a flame will arise from the relic-body and bring that body to a state of being unidentifiable.
Sau đó, một luồng ánh sáng sẽ phát ra từ thân xá-lợi, khiến thân xá-lợi trở nên vô hình.
Dhātusarīrato samuṭṭhitā jālā yāva brahmalokā uggacchissati, sāsapamattāya sesāyapi dhātuyā sati ekajālāva bhavissati.
The flame arising from the relic-body will ascend as far as the Brahmā realms; as long as there is even a mustard-seed-sized relic remaining, there will be a single flame.
Ngọn lửa phát ra từ thân xá-lợi sẽ bay lên đến cõi Phạm thiên; dù chỉ còn một hạt xá-lợi nhỏ như hạt cải, cũng sẽ có một ngọn lửa duy nhất.
Dhātūsu pariyādānaṃ gatāsu pacchijjissati.
When the relics are exhausted, the flame will cease.
Khi các xá-lợi đã cạn kiệt, ngọn lửa sẽ tắt.
Evaṃ mahantaṃ ānubhāvaṃ dassetvā dhātuyo antaradhāyanti.
Having thus displayed great power, the relics will vanish.
Như vậy, sau khi thị hiện oai lực vĩ đại, các xá-lợi sẽ biến mất.
Tadā sannipatitā devasaṅghā buddhānaṃ parinibbutadivase viya dibbagandhamālātūriyādīhi sakkāraṃ katvā tikkhattuṃ padakkhiṇaṃ katvā vanditvā ‘‘anāgate uppajjanakaṃ buddhaṃ passituṃ labhissāma bhagavā’’ti vatvā sakasakaṭṭhānameva gacchanti.
Then the assembled host of devas, as on the day of the Buddhas’ Parinibbāna, will pay homage with divine perfumes, garlands, and musical instruments, circumambulate three times, bow down, and saying, “May we be able to see the Buddha who will arise in the future, O Blessed One,” they will return to their respective abodes.
Khi đó, chư thiên tập hợp lại, dâng cúng hương thơm, vòng hoa, âm nhạc thiên giới, v.v., như vào ngày chư Phật nhập Niết-bàn; sau khi đi nhiễu ba vòng, đảnh lễ, và nói: “Bạch Thế Tôn, chúng con sẽ có cơ hội được thấy một vị Phật xuất hiện trong tương lai”, rồi trở về nơi ở của mình.
Idaṃ dhātuantaradhānaṃ nāma.
This is called the vanishing of the Relics.
Đây được gọi là sự biến mất của xá-lợi (Dhātuantaradhāna).
Imassa pañcavidhassa antaradhānassa pariyattiantaradhānameva mūlaṃ.
Of these five kinds of vanishing, the vanishing of the Pariyatti is the root.
Trong năm loại biến mất này, sự biến mất của Giáo Pháp (Pariyattiantaradhāna) là căn bản.
Pariyattiyā hi antarahitāya paṭipatti antaradhāyati, pariyattiyā ṭhitāya paṭipatti patiṭṭhāti.
For when the Pariyatti vanishes, the Paṭipatti vanishes; when the Pariyatti endures, the Paṭipatti is established.
Vì khi Giáo Pháp biến mất, sự thực hành (paṭipatti) cũng biến mất; khi Giáo Pháp còn tồn tại, sự thực hành cũng được thiết lập.
Teneva imasmiṃ dīpe caṇḍālatissamahābhaye sakko devarājā mahāuḷumpaṃ māpetvā bhikkhūnaṃ ārocāpesi ‘‘mahantaṃ bhayaṃ bhavissati, na sammā devo vassissati, bhikkhū paccayehi kilamantā pariyattiṃ sandhāretuṃ na sakkhissanti, paratīraṃ gantvā ayyehi jīvitaṃ rakkhituṃ vaṭṭati.
Therefore, during the great and fearsome famine called Caṇḍālatissa on this island, Sakka, king of devas, had a large raft made and announced to the bhikkhus, “There will be great danger; the deva will not rain properly; the bhikkhus, suffering from lack of requisites, will not be able to preserve the Pariyatti. It is proper for the noble ones to preserve their lives by going to the other shore.
Chính vì thế, trong thời kỳ đại nạn Caṇḍālatissa trên đảo này, Thiên chủ Sakka đã làm một chiếc bè lớn và báo cho chư tỳ-khưu biết: “Sẽ có một tai họa lớn, trời sẽ không mưa đúng lúc, chư tỳ-khưu sẽ khốn khổ vì thiếu vật dụng và không thể duy trì Giáo Pháp. Các vị cần phải đi sang bờ bên kia để bảo toàn mạng sống.
Imaṃ mahāuḷumpaṃ āruyha gacchatha, bhante.
Venerable sirs, embark on this great raft and go.”
Bạch chư Tôn giả, hãy lên chiếc bè lớn này mà đi.”
Yesaṃ ettha nisajjaṭṭhānaṃ nappahoti, te kaṭṭhakhaṇḍepi uraṃ ṭhapetvā gacchantu, sabbesampi bhayaṃ na bhavissatī’’ti.
"For those who do not have enough seating here, let them place their chests on pieces of wood and go. There will be no danger for anyone."
Những vị nào không đủ chỗ ngồi trên bè này, hãy đặt ngực lên khúc gỗ mà đi, tất cả sẽ không có sợ hãi gì cả.”
Tadā samuddatīraṃ patvā saṭṭhi bhikkhū katikaṃ katvā ‘‘amhākaṃ ettha gamanakiccaṃ natthi, mayaṃ idheva hutvā tepiṭakaṃ rakkhissāmā’’ti tato nivattitvā dakkhiṇamalayajanapadaṃ gantvā kandamūlapaṇṇehi jīvikaṃ kappentā vasiṃsu.
Then, having reached the seashore, sixty bhikkhus made an agreement: "We have no need to go there. We will stay here and protect the Tipiṭaka." Having turned back from there, they went to the southern Malay region and lived by subsisting on roots, tubers, and leaves.
Khi đó, sáu mươi vị Tỳ-khưu đến bờ biển, lập lời ước nguyện rằng: “Chúng tôi không có việc phải đi đến đó, chúng tôi sẽ ở lại đây và gìn giữ Tam tạng.” Rồi từ đó trở về, họ đến vùng đất Malaya phía nam, sống bằng củ, rễ và lá cây.
Kāye vahante nisīditvā sajjhāyaṃ karonti, avahante vālikaṃ ussāretvā parivāretvā sīsāni ekaṭṭhāne katvā pariyattiṃ sammasanti.
When carrying (the texts), they sat and recited; when not carrying, they piled up sand around themselves, brought their heads together in one place, and deliberated on the Pariyatti.
Khi thân thể còn chịu đựng được, họ ngồi tụng kinh; khi không chịu đựng được, họ vun cát vây quanh, đặt đầu vào một chỗ và quán xét Pariyatti (giáo pháp).
Iminā niyāmena dvādasa saṃvaccharāni sāṭṭhakathaṃ tepiṭakaṃ paripuṇṇaṃ katvā dhārayiṃsu.
In this manner, for twelve years, they preserved the Tipiṭaka complete with its commentaries.
Theo cách này, họ đã gìn giữ Tam tạng cùng với các Chú giải một cách trọn vẹn trong mười hai năm.
Bhaye vūpasante sattasatā bhikkhū attano gataṭṭhāne sāṭṭhakathe tepiṭake ekakkharampi ekabyañjanampi anāsetvā imameva dīpamāgamma kallagāmajanapade maṇḍalārāmavihāraṃ pavisiṃsu.
When the danger had subsided, seven hundred bhikkhus, without losing even a single letter or syllable of the Tipiṭaka with its commentaries in the places they had gone, returned to this island and entered the Maṇḍalārāma Vihāra in the Kallagāma region.
Khi nỗi sợ hãi đã lắng xuống, bảy trăm vị Tỳ-khưu, không để mất một chữ hay một vần nào trong Tam tạng cùng với các Chú giải ở nơi họ đã đến, trở về hòn đảo này và vào trú tại tịnh xá Maṇḍalārāma ở vùng làng Kallagāma.
Therānaṃ āgamanappavattiṃ sutvā imasmiṃ dīpe ohīnā saṭṭhi bhikkhū ‘‘there passissāmā’’ti gantvā therehi saddhiṃ tepiṭakaṃ sodhentā ekakkharampi ekabyañjanampi asamentaṃ nāma na passiṃsu.
Having heard the news of the Theras' arrival, the sixty bhikkhus who had remained on this island went to "see the Theras," and while revising the Tipiṭaka with the Theras, they found not a single letter or syllable that was inconsistent.
Sáu mươi vị Tỳ-khưu còn ở lại trên đảo này, nghe tin các Trưởng lão trở về, liền nghĩ: “Chúng ta sẽ gặp các Trưởng lão.” Họ đi đến, cùng với các Trưởng lão đối chiếu Tam tạng, và không tìm thấy một chữ hay một vần nào không khớp.
Tasmiṃ ṭhāne therānaṃ ayaṃ kathā udapādi ‘‘pariyatti nu kho sāsanassa mūlaṃ, udāhu paṭipattī’’ti.
In that place, this discussion arose among the Theras: "Is Pariyatti the root of the Sāsana, or is it Paṭipatti?"
Tại nơi đó, các Trưởng lão đã khởi lên cuộc thảo luận này: “Phải chăng Pariyatti (giáo pháp) là gốc rễ của Giáo pháp, hay Paṭipatti (thực hành)?”
Paṃsukūlikattherā ‘‘paṭipattimūla’’nti āhaṃsu, dhammakathikā ‘‘pariyattī’’ti.
The Paṃsukūlika Theras said, "Paṭipatti is the root," while the Dhamma-preaching Theras said, "Pariyatti."
Các Trưởng lão Paṃsukūlika (hạnh y phấn tảo) nói: “Paṭipatti là gốc rễ.” Các vị Dhamma-kathika (thuyết pháp) nói: “Pariyatti.”
Atha ne therā ‘‘tumhākaṃ dvinnampi janānaṃ vacanamatteneva na karoma, jinabhāsitaṃ suttaṃ āharathā’’ti āhaṃsu.
Then the Theras said to them, "We will not decide based solely on the words of you two. Bring forth a Sutta spoken by the Victorious One."
Bấy giờ, các Trưởng lão nói với họ: “Chúng tôi không chấp nhận lời nói của hai vị chỉ bằng lời nói suông. Hãy dẫn ra một bài kinh do Đức Phật thuyết.”
Suttaṃ āharituṃ na bhāroti ‘‘ime ca, subhadda, bhikkhū sammā vihareyyuṃ, asuñño loko arahantehi assāti (dī. ni. 2.214).
It was not difficult to bring forth a Sutta, so they brought forth the Sutta: "And if, Subhadda, these bhikkhus were to live righteously, the world would not be devoid of Arahants.
Không khó để dẫn ra kinh, nên họ đã dẫn ra bài kinh: “Này Subhadda, nếu các Tỳ-khưu này sống đúng Pháp, thì thế gian sẽ không trống vắng các vị A-la-hán.”
Paṭipattimūlakaṃ, mahārāja, satthusāsanaṃ paṭipattisārakaṃ.
The Teacher's Dispensation, great king, has Paṭipatti as its root, Paṭipatti as its essence.
“Đại vương, Giáo pháp của Bậc Đạo Sư có Paṭipatti làm gốc rễ, có Paṭipatti làm cốt lõi.
Paṭipattiyā dharantāya tiṭṭhatī’’ti (mi. pa. 4.1.7) suttaṃ āhariṃsu.
It endures as long as Paṭipatti endures."
Khi Paṭipatti còn tồn tại, Giáo pháp còn tồn tại.”
Imaṃ suttaṃ sutvā dhammakathikā attano vādaṭhapanatthāya imaṃ suttaṃ āhariṃsu –
Having heard this Sutta, the Dhamma-preaching Theras brought forth this Sutta to establish their own view –
Nghe bài kinh này, các vị Dhamma-kathika để bảo vệ quan điểm của mình, đã dẫn ra bài kinh này –
Imasmiṃ sutte āhaṭe paṃsukūlikattherā tuṇhī ahesuṃ, dhammakathikattherānaṃyeva vacanaṃ purato ahosi.
When this Sutta was brought forth, the Paṃsukūlika Theras remained silent, and the words of the Dhamma-preaching Theras prevailed.
Khi bài kinh này được dẫn ra, các Trưởng lão Paṃsukūlika im lặng, chỉ có lời của các Trưởng lão Dhamma-kathika được chấp nhận.
Yathā hi gavasatassa vā gavasahassassa vā antare paveṇipālikāya dhenuyā asati so vaṃso sā paveṇi na ghaṭīyati, evamevaṃ āraddhavipassakānaṃ bhikkhūnaṃ satepi sahassepi saṃvijjamāne pariyattiyā asati ariyamaggapaṭivedho nāma na hoti.
Indeed, just as the lineage and succession of a hundred or a thousand cows is not maintained if there is no cow to preserve the lineage, even so, if the Pariyatti is not present, even though hundreds or thousands of bhikkhus who have undertaken vipassanā are present, there is no penetration of the Noble Path, as it is called.
Giống như trong một trăm hay một ngàn con bò, nếu không có con bò cái giữ dòng dõi, thì dòng dõi đó, huyết thống đó không được duy trì; cũng vậy, dù có hàng trăm, hàng ngàn vị Tỳ-khưu đang tinh tấn thiền quán, nếu không có Pariyatti, thì không thể có sự chứng đắc Thánh đạo.
Yathā ca nidhikumbhiyā jānanatthāya pāsāṇapiṭṭhe akkharesu ṭhapitesu yāva akkharāni dharanti, tāva nidhikumbhi naṭṭhā nāma na hoti.
And just as, for the purpose of knowing a treasure jar, if letters are placed on a stone slab, as long as those letters remain, the treasure jar is not considered lost.
Và giống như để biết được một hũ kho báu, chừng nào các chữ cái được khắc trên đá còn tồn tại, chừng đó hũ kho báu chưa được xem là mất đi.
Evamevaṃ pariyattiyā dharamānāya sāsanaṃ antarahitaṃ nāma na hotīti.
In the same way, if the Pariyatti remains, the Dispensation is not considered to have disappeared.
Cũng vậy, chừng nào Pariyatti còn tồn tại, chừng đó Giáo pháp chưa được xem là biến mất.