Tattha udānanti kenaṭṭhena udānaṃ?
Now, why is it called Udāna? It is called Udāna by reason of its being an uttering.
Trong đó, Udāna được gọi là Udāna theo nghĩa nào?
Udānanaṭṭhena.
What is this Udāna?
Theo nghĩa là sự cảm hứng (udānana).
Kimidaṃ udānaṃ nāma?
It is an utterance brought about by a surge of rapture (pīti).
Udāna này có nghĩa là gì?
Pītivegasamuṭṭhāpito udāhāro.
Just as a substance to be measured, such as oil, cannot be contained by the measure and overflows, it is called "overflow" (avaseka).
Là lời nói được phát ra do sự bùng phát của hỷ (pīti-vega).
Yathā hi yaṃ telādi minitabbavatthu mānaṃ gahetuṃ na sakkoti, vissanditvā gacchati, taṃ ‘‘avaseko’’ti vuccati.
And just as water that a pond cannot hold overflows, it is called a "flood" (ogha).
Giống như một vật chất cần được đo lường như dầu, không thể chứa trong một dụng cụ đo lường, mà tràn ra ngoài, thì được gọi là "avaseka" (sự tràn ra).
Yañca jalaṃ taḷākaṃ gahetuṃ na sakkoti, ajjhottharitvā gacchati, taṃ ‘‘ogho’’ti vuccati.
Similarly, that special utterance, which is a proliferation of thought brought about by a surge of rapture, which the inner heart cannot contain, which has become excessive and has gone forth through the door of speech without remaining within, and which is independent of a receiver, is called "Udāna".
Và như nước không thể chứa trong ao, mà chảy tràn ra ngoài, thì được gọi là "ogha" (lũ lụt).
Evameva yaṃ pītivegasamuṭṭhāpitaṃ vitakkavipphāraṃ antohadayaṃ sandhāretuṃ na sakkoti, so adhiko hutvā anto asaṇṭhahitvā bahi vacīdvārena nikkhanto paṭiggāhakanirapekkho udāhāraviseso ‘‘udāna’’nti vuccati.
This manner is also obtained due to the urgency regarding the Dhamma.
Cũng vậy, một lời nói đặc biệt được phát ra do sự bùng phát của hỷ, một sự lan tỏa của tư duy không thể giữ lại trong tâm, mà trào ra ngoài qua cửa lời nói, không cần người tiếp nhận, thì được gọi là "Udāna".
Dhammasaṃvegavasenapi ayamākāro labbhateva.
This Udāna is sometimes expressed in verse and sometimes in prose.
Tương tự, trạng thái này cũng có thể đạt được do sự xúc động đối với Pháp (Dhamma-saṃvega).
Tayidaṃ katthaci gāthābandhavasena katthaci vākyavasena pavattaṃ.
However, the characteristic of Udāna stated in the commentaries as "connected with verses arisen from gladness-knowledge" (somanassañāṇamayikagāthāpaṭisaṃyuttā) is said largely.
Lời nói Udāna này đôi khi xuất hiện dưới dạng kệ tụng (gāthā-bandha), đôi khi dưới dạng văn xuôi (vākya).
Yaṃ pana aṭṭhakathāsu ‘‘somanassañāṇamayikagāthāpaṭisaṃyuttā’’ti udānalakkhaṇaṃ vuttaṃ, taṃ yebhuyyavasena vuttaṃ.
For the most part, Udāna is spoken in verse and is produced by rapture and gladness.
Tuy nhiên, định nghĩa về Udāna được nêu trong các bản chú giải là "kệ tụng liên quan đến trí tuệ và hoan hỷ" (somanassa-ñāṇamayika-gāthā-paṭisaṃyuttā), thì đó là một định nghĩa theo nghĩa phổ biến (yebhuyyavasena).
Yebhuyyena hi udānaṃ gāthābandhavasena bhāsitaṃ pītisomanassasamuṭṭhāpitañca.
But it is also found in other cases, such as "Bhikkhus, there is that dimension where there is neither earth nor water," and so forth, "those beings who desire happiness, who harm with a stick," and "if you fear suffering, if suffering is unpleasant to you," and so forth.
Phần lớn, Udāna được thuyết bằng thể kệ (gāthābandha) và khởi lên từ hỷ lạc (pītisomanassa).
Itarampi pana ‘‘atthi, bhikkhave, tadāyatanaṃ, yattha neva pathavī na āpo’’tiādīsu (udā. 71) ‘‘sukhakāmāni bhūtāni, yo daṇḍena vihiṃsatī’’ti (dha. pa. 131), ‘‘sace bhāyatha dukkhassa, sace vo dukkhamappiya’’nti evamādīsu (udā. 44; netti. 91) ca labbhati.
And elsewhere, the characteristic of udāna is found in passages such as, "Monks, there is that dimension where there is neither earth nor water," and "All beings desire happiness; whoever harms them with a stick," and "If you fear suffering, if suffering is displeasing to you."
Nhưng có những trường hợp khác được tìm thấy, như trong các đoạn: “Này các tỳ-khưu, có một xứ, ở đó không có đất, không có nước…”; “Chúng sanh ưa thích hạnh phúc, kẻ nào dùng gậy làm hại…”; “Nếu các ngươi sợ khổ, nếu các ngươi không ưa khổ…” v.v...
Ādinā therīgāthāsu ca āgatāni.
which are found in the Therīgāthā. However, these are not merely Udānas of those elders (thera) and elderesses (therī), but are also lion's roars. There are indeed Udānas uttered by devas such as Sakka, beginning with "Oh, what a supreme gift, well established in Kassapa," and those uttered by humans such as the brahmin Ārāmadanḍa, beginning with "Homage to the Blessed One," which were included in the three recitations. But these are not intended here. Rather, what is taken here as worthy of commentary is precisely those words of the Buddha that were spontaneously uttered by the Perfectly Enlightened One Himself, and which, with reference to them, the Blessed One divided the Dhamma into nine sections and designated them as Udāna, and which the Dhamma reciters chanted as the "Udāna."
Và những câu tương tự trong Therīgāthā.
Tāni pana tesaṃ therānaṃ therīnañca na kevalaṃ udānāni eva, atha kho sīhanādāpi honti.
Those are not merely Udānas of those elder monks and nuns, but also their lion's roars (sīhanāda).
Những câu đó không chỉ là Udāna của các vị Trưởng lão Tỳ-khưu và Trưởng lão Tỳ-khưu-ni đó, mà còn là những tiếng rống sư tử (sīhanāda) của các vị ấy.
Sakkādīhi devehi bhāsitāni ‘‘aho dānaṃ paramadānaṃ, kassape suppatiṭṭhita’’ntiādīni (udā. 27), ārāmadaṇḍabrāhmaṇādīhi manussehi ca bhāsitāni ‘‘namo tassa bhagavato’’tiādīni (a. ni. 2.38) tisso saṅgītiyo ārūḷhāni udānāni santi eva, na tāni idha adhippetāni.
There are indeed Udānas spoken by deities like Sakka, such as "Oh, the supreme gift, well-established in Kassapa," and those spoken by humans like the brahmin Ārāmadaṇḍa, such as "Homage to the Blessed One," which were included in the three recitations (saṅgīti); those are not intended here.
Có những Udāna do chư thiên như Sakka v.v… thuyết, như: “Ôi, bố thí thật tối thượng, được thiết lập vững chắc nơi Kassapa…” và những câu do loài người như Bà-la-môn Ārāmadaṇḍa v.v… thuyết, như: “Kính lễ Đức Thế Tôn…” Những Udāna này đã được kết tập trong ba kỳ kết tập, nhưng chúng không được đề cập ở đây.
Yāni pana sammāsambuddhena sāmaṃ āhacca bhāsitāni jinavacanabhūtāni, yāni sandhāya bhagavatā pariyattidhammaṃ navadhā vibhajitvā uddisantena udānanti vuttāni, tāneva dhammasaṅgāhakehi ‘‘udāna’’nti saṅgītanti tadevettha saṃvaṇṇetabbabhāvena gahitaṃ.
However, those Udānas that were personally uttered by the Perfectly Enlightened One, being the words of the Victor, and which the Blessed One referred to as Udāna when classifying the Pariyatti Dhamma into nine divisions—those alone were recited as "Udāna" by the Dhamma reciters, and only that is taken here as the subject for explanation.
Chỉ những Udāna do Đức Chánh Đẳng Giác tự mình thuyết ra, là lời của Đức Phật (jinavacana), và những Udāna mà Đức Thế Tôn đã chia Chánh Pháp (Pariyattidhamma) thành chín phần và gọi là Udāna khi tóm tắt, thì những vị kết tập Pháp đã kết tập chúng là Udāna, và chính những Udāna đó được chấp nhận ở đây để giải thích.
Yā pana ‘‘anekajātisaṃsāra’’ntiādigāthāya dīpitā bhagavatā bodhimūle udānavasena pavattitā anekasatasahassānaṃ sammāsambuddhānaṃ avijahitaudānagāthā ca, etā aparabhāge pana dhammabhaṇḍāgārikassa bhagavatā desitattā dhammasaṅgāhakehi udānapāḷiyaṃ saṅgahaṃ anāropetvā dhammapade saṅgītā.
However, the verse beginning "Through many a birth I wandered," which was expressed by the Blessed One at the root of the Bodhi tree as an Udāna, and which is an Udāna-verse not abandoned by hundreds of thousands of Perfectly Enlightened Ones, was, at a later time, taught by the Blessed One to the Dhamma Treasurer (Dhammabhaṇḍāgārika), and thus the Dhamma reciters did not include it in the Udāna Pāli, but chanted it in the Dhammapada. And the Udāna-utterance, "Kondañña has indeed understood, Kondañña has indeed understood," which was spoken by the Blessed One with a powerful resonance capable of making it known to devas and humans in the ten-thousandfold world-system, that utterance too, at the conclusion of the Dhammacakkappavattana Sutta discourse, was merely an utterance of gladness and joy, occasioned by reflecting on the fruitfulness of His own effort, because the venerable Koṇḍañña was the very first among the disciples to attain the Ariya Path as taught, a part of the Dhamma discovered by the Buddha Himself, just as the statement "The bhikkhus indeed delighted me at one time" was occasioned by reflecting on the right practice of all bhikkhus at the first enlightenment. It does not proclaim occurrence or non-occurrence, like the utterance "When the dhammas appear," etc. Therefore, it should be understood that it was not chanted in the Udāna Pāli by the Dhamma reciters.
Còn bài kệ bắt đầu bằng “Anekajāti-saṃsāra…” do Đức Thế Tôn thuyết dưới cội Bồ-đề theo cách Udāna, là bài kệ Udāna không bị bỏ sót bởi hàng trăm ngàn Đức Chánh Đẳng Giác, nhưng sau này, vì Đức Thế Tôn đã thuyết bài kệ đó cho vị Thủ kho Pháp (Dhammabhaṇḍāgārika), nên các vị kết tập Pháp đã không đưa nó vào Udānapāḷi mà đã kết tập nó trong Dhammapada.
Yañca ‘‘aññāsi vata, bho koṇḍañño, aññāsi vata, bho koṇḍañño’’ti (mahāva. 17; saṃ. ni. 5.1081; paṭi. ma. 2.30) udānavacanaṃ dasasahassilokadhātuyā devamanussānaṃ pavedanasamatthanigghosavipphāraṃ bhagavatā bhāsitaṃ, tadapi dhammacakkappavattanasuttantadesanāpariyosāne attanā adhigatadhammekadesassa yathādesitassa ariyamaggassa sāvakesu sabbapaṭhamaṃ therena adhigatattā attano parissamassa saphalabhāvapaccavekkhaṇahetukaṃ paṭhamabodhiyaṃ sabbesaṃ eva bhikkhūnaṃ sammāpaṭipattipaccavekkhaṇahetukaṃ ‘‘ārādhayiṃsu vata maṃ bhikkhū ekaṃ samaya’’ntiādivacanaṃ (ma. ni. 1.225) viya pītisomanassajanitaṃ udāhāramattaṃ, ‘‘yadā have pātubhavanti dhammā’’tiādivacanaṃ (mahāva. 1-3; udā. 1-3) viya pavattiyā nivattiyā vā na pakāsananti, na dhammasaṅgāhakehi udānapāḷiyaṃ saṅgītanti daṭṭhabbaṃ.
And that utterance of Udāna by the Blessed One, "Indeed, Koṇḍañña has understood! Indeed, Koṇḍañña has understood!" which had the power to make known to devas and humans throughout the ten-thousand-world-system with a reverberating sound, was merely an exclamation generated by joy and happiness, due to reflecting on the fruitfulness of his own effort because the Elder had first attained among the disciples a part of the Dhamma realized by himself, namely the Noble Path as taught, at the conclusion of the Dhamma-cakka-ppavattana Sutta discourse, and due to reflecting on the proper practice of all bhikkhus at the first enlightenment, like the saying, "Indeed, the bhikkhus once pleased me." It does not reveal occurrence or cessation, and thus it should be understood that it was not recited in the Udāna Pāḷi by the Dhamma reciters.
Và câu cảm hứng ngữ (udāna-vacana) ‘‘Thật sự Koṇḍañña đã chứng ngộ, thật sự Koṇḍañña đã chứng ngộ!’’ mà Đức Thế Tôn đã nói, với âm vang lan tỏa có khả năng làm cho chư thiên và loài người trong một vạn thế giới được biết, câu ấy cũng chỉ là một lời cảm hứng do niềm hỷ lạc và hoan hỷ mà thành, giống như câu ‘‘Chư Tỳ-kheo đã làm ta hài lòng vào một thời’’ và các câu tương tự, do sự quán xét thành quả của nỗ lực tự thân khi Tôn giả là vị đệ tử đầu tiên chứng ngộ một phần Dhamma đã được chứng đắc bởi chính Đức Thế Tôn, tức là Bát Chánh Đạo đã được giảng dạy, và do sự quán xét chánh hạnh của tất cả các Tỳ-kheo trong lần giác ngộ đầu tiên. Nó không phải là lời tuyên bố về sự sinh khởi hay sự chấm dứt, giống như câu ‘‘Khi các pháp xuất hiện’’ và các câu tương tự, và không phải là lời được các Dhamma-saṅgāhaka (những vị kết tập Dhamma) kết tập trong Udāna-pāḷi, điều này cần được hiểu rõ.
Evaṃ dhammabhaṇḍāgārikena paṭiññātesu caturāsītiyā dhammakkhandhasahassesu katipayadhammakkhandhasaṅgahaṃ.
Thus, a collection of a few Dhamma aggregates from the eighty-four thousand Dhamma aggregates acknowledged by the Dhamma-treasurer.
Tổng cộng tám vạn bốn ngàn pháp uẩn, những pháp đó đã vận hành trong tôi.’’
Bodhivaggo, mucalindavaggo, nandavaggo, meghiyavaggo, soṇavaggo, jaccandhavaggo, cūḷavaggo, pāṭaligāmiyavaggoti vaggato aṭṭhavaggaṃ; suttato asītisuttasaṅgahaṃ, gāthāto pañcanavutiudānagāthāsaṅgahaṃ.
Eight sections by way of vaggas: Bodhivagga, Mucalindavagga, Nandavagga, Meghiyavagga, Soṇavagga, Jaccandhavagga, Cūḷavagga, Pāṭaligāmiyavagga; a collection of eighty suttas by way of suttas; a collection of ninety-five Udāna verses by way of gāthās.
Như vậy, trong số tám vạn bốn ngàn pháp uẩn mà vị Thủ kho Dhamma (Dhammabhaṇḍāgārika) đã tuyên bố, Udāna này bao gồm một số ít pháp uẩn. Về các phẩm (vagga), có tám phẩm: Bodhivagga, Mucalindavagga, Nandavagga, Meghiyavagga, Soṇavagga, Jaccandhavagga, Cūḷavagga, Pāṭaligāmiyavagga; về các bài kinh (sutta), có tám mươi bài kinh; về các kệ ngôn (gāthā), có chín mươi lăm kệ ngôn Udāna.
Bhāṇavārato aḍḍhūnanavamattā bhāṇavārā.
By way of recitation sections (bhāṇavāra), it is nearly nine bhāṇavāras.
Về các Bhāṇavāra, có khoảng tám rưỡi Bhāṇavāra.
Anusandhito bodhisutte pucchānusandhivasena ekānusandhi, suppavāsāsutte pucchānusandhiyathānusandhivasena dve anusandhī, sesesu yathānusandhivasena ekekova anusandhi, ajjhāsayānusandhi panettha natthi.
By way of connection (anusandhi), there is one connection in the Bodhi Sutta by way of question-connection; in the Suppavāsā Sutta, there are two connections by way of question-connection and as-it-is-connection; in the remaining suttas, there is only one connection by way of as-it-is-connection; there is no intention-connection (ajjhāsayānusandhi) here.
Về cách kết nối (anusandhi): trong kinh Bodhi, có một cách kết nối theo cách kết nối câu hỏi (pucchānusandhi); trong kinh Suppavāsā, có hai cách kết nối theo cách kết nối câu hỏi và cách kết nối thông thường (yathānusandhi); trong các kinh còn lại, chỉ có một cách kết nối theo cách thông thường. Ở đây, không có cách kết nối theo ý định (ajjhāsayānusandhi).
Evaṃ sabbathāpi ekāsītianusandhisaṅgahaṃ.
Thus, in all respects, it is a collection of eighty-one connections.
Như vậy, tổng cộng có tám mươi mốt cách kết nối.
Padato satādhikāni ekavīsa padasahassāni, gāthāpādato tevīsati catussatādhikāni aṭṭha sahassāni, akkharato sattasahassādhikāni saṭṭhi sahassāni tīṇi ca satāni dvāsīti ca akkharāni.
By way of words (pada), twenty-one thousand one hundred words; by way of verse-feet (gāthāpāda), eight thousand four hundred and twenty-three; by way of letters (akkhara), sixty-seven thousand three hundred and eighty-two letters.
Về từ ngữ (pada), có hai mươi mốt ngàn một trăm từ; về kệ cú (gāthāpāda), có tám ngàn bốn trăm hai mươi ba kệ cú; về chữ cái (akkhara), có sáu mươi bảy ngàn ba trăm tám mươi hai chữ cái.
Tenetaṃ vuccati –
Therefore, it is said:
Vì vậy, điều này được nói:
Atthato pana evaṃsaddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāra- nidassanāvadhāraṇapucchāidamatthaparimāṇādi anekatthappabhedo.
In terms of meaning, the word evaṃ first has many distinctions of meaning, such as simile, instruction, commendation, censure, acceptance of a statement, manner, indication, ascertainment, inquiry, meaning of 'this', and measure.
Về nghĩa, từ “evaṃ” có nhiều nghĩa khác nhau như so sánh, chỉ dẫn, tán thán, quở trách, chấp nhận lời nói, cách thức, minh họa, xác định, câu hỏi, ý nghĩa này, số lượng, v.v.
Tathā hesa ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti evamādīsu (dha. pa. 53) upamāyaṃ āgato.
Thus, it appears in the sense of simile in passages like "One born thus, a mortal, should do much good," and so forth.
Chẳng hạn, từ này xuất hiện với nghĩa so sánh trong các câu như “Con người đã sinh ra như thế này, nên làm nhiều điều thiện.”
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In instruction, in passages like "Thus should you go forward, thus should you retreat," and so forth.
Với nghĩa chỉ dẫn trong các câu như “Ngươi phải tiến lên như thế này, ngươi phải lùi lại như thế này.”
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In commendation, in passages like "So it is, Blessed One, so it is, Sugata," and so forth.
Với nghĩa tán thán trong các câu như “Bạch Thế Tôn, đúng là như vậy! Bạch Thiện Thệ, đúng là như vậy!”
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In censure, in passages like "Just so, this low-caste woman praises that shaven-headed ascetic in whatever way," and so forth.
Với nghĩa quở trách trong các câu như “Thật vậy, người phụ nữ thấp kém này cứ nói tốt về vị sa-môn đầu trọc đó bất kể là ai.”
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (dī. ni. 2.3; ma. ni. 1.1) vacanasampaṭiggahe.
In acceptance of a statement, in passages like "‘Yes, venerable sir,’ those bhikkhus replied to the Blessed One," and so forth.
Với nghĩa chấp nhận lời nói trong các câu như “Bạch Thế Tôn, các Tỳ-khưu đó đã đáp lời Thế Tôn rằng ‘Vâng, bạch Thế Tôn’.”
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In manner, in passages like "Thus, venerable sir, do I understand the Dhamma taught by the Blessed One," and so forth.
Với nghĩa cách thức trong các câu như “Bạch Thế Tôn, tôi hiểu Pháp do Thế Tôn thuyết giảng theo cách này.”
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’ti, evañca vadehi ‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’ti’’ādīsu (dī. ni. 1.445) nidassane.
In indication, in passages like "Come, young man, approach the ascetic Ānanda, and having approached, inquire in my name about the ascetic Ānanda’s health, freedom from affliction, lightness of bodily functions, strength, and comfortable abiding, saying, ‘The young man Subha, son of Todeyya, inquires about Venerable Ānanda’s health, freedom from affliction, lightness of bodily functions, strength, and comfortable abiding.’ And also say this: ‘May Venerable Ānanda kindly approach the dwelling of the young man Subha, son of Todeyya, out of compassion’," and so forth.
Với nghĩa minh họa trong các câu như “Này thanh niên, ngươi hãy đi đến chỗ Sa-môn Ānanda, sau khi đến, hãy hỏi Sa-môn Ānanda thay lời ta rằng ‘Thanh niên Subha, con của Todeyya, hỏi thăm Tôn giả Ānanda có được khỏe mạnh không, có bệnh tật gì không, có dễ chịu không, có đủ sức khỏe không, có an ổn không’, và hãy nói như vầy: ‘Kính mong Tôn giả Ānanda vì lòng từ bi, hãy đến nhà của thanh niên Subha, con của Todeyya’.”
‘‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vā’ti?
"‘What do you think, Kālāmā, are these qualities wholesome or unwholesome?’
“Các ông nghĩ sao, hỡi Kālāmā, những pháp này là thiện hay bất thiện?”
‘Akusalā, bhante’.
‘Unwholesome, venerable sir.’
“Bất thiện, bạch Thế Tôn.”
‘Sāvajjā vā anavajjā vā’ti?
‘Blamable or blameless?’
“Có lỗi hay không có lỗi?”
‘Sāvajjā, bhante’.
‘Blamable, venerable sir.’
“Có lỗi, bạch Thế Tôn.”
‘Viññūgarahitā vā viññuppasatthā vā’ti?
‘Censured by the wise or praised by the wise?’
“Bị người trí quở trách hay được người trí tán thán?”
‘Viññūgarahitā, bhante’.
‘Censured by the wise, venerable sir.’
“Bị người trí quở trách, bạch Thế Tôn.”
‘Samattā samādinnā ahitāya dukkhāya saṃvattanti, no’vā?
‘When undertaken and practiced, do they lead to harm and suffering, or not?’
“Khi được thực hành và chấp nhận, chúng dẫn đến bất lợi, đau khổ, hay không?”
‘Kathaṃ vo ettha hotī’ti?
‘How does it seem to you in this matter?’
“Các ông nghĩ thế nào về điều này?”
‘Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotīti’’’ādīsu (a. ni. 3.66) avadhāraṇe.
‘When undertaken and practiced, venerable sir, they lead to harm and suffering; so it seems to us in this matter,’" and so forth, in ascertainment.
“Bạch Thế Tôn, khi được thực hành và chấp nhận, chúng dẫn đến bất lợi, đau khổ. Chúng tôi nghĩ như vậy về điều này.” – Với nghĩa xác định trong các câu như thế.
‘‘Evamete sunhātā suvilittā kappitakesamassū āmuttamālābharaṇā’’tiādīsu (dī. ni. 1.286) pucchāyaṃ.
In inquiry, in passages like "Are these well-bathed, well-anointed, with hair and beard trimmed, adorned with garlands and ornaments, thus?" and so forth.
Với nghĩa câu hỏi trong các câu như “Những người này đã tắm rửa sạch sẽ, thoa dầu thơm, tóc và râu được cắt tỉa, đeo vòng hoa và trang sức như thế này sao?”
‘‘Evaṃgatāni puthusippāyatanāni (dī. ni. 1.182), evaṃvidho evamākāro’’tiādīsu idaṃsaddassa atthe.
In the sense of the word idaṃ (this), in passages like "such various professions," "such a kind, such a manner," and so forth.
Với nghĩa của từ “idaṃ” (này) trong các câu như “Nhiều nghề nghiệp như thế này, loại này, cách thức này.”
Gatasaddo hi pakārapariyāyo, tathā vidhākārasaddā.
Indeed, the word gata is a synonym for pakāra (kind, manner), as are the words vidha and ākāra.
Thật vậy, từ “gata” là một từ đồng nghĩa với “pakāra” (cách thức), cũng như các từ “vidha” và “ākāra”.
Tathā hi vidhayuttagatasadde lokiyā pakāratthe vadanti.
Thus, in common usage, the words vidha, yutta, and gata are used in the sense of pakāra.
Thật vậy, trong đời thường, người ta dùng các từ “vidha”, “yutta”, “gata” với nghĩa “cách thức”.
‘‘Evaṃ lahuparivattaṃ evamāyupariyanto’’tiādīsu (a. ni. 1.48) parimāṇe.
In measure, in passages like "such a swift change," "such a limit of life," and so forth.
Với nghĩa số lượng trong các câu như “Sự thay đổi nhanh chóng như thế này, tuổi thọ kết thúc như thế này.”
Ettha puppharāsiṭṭhānīyato manussuppatti sappurisūpanissayasaddhammassavanayonisomanasikārabhogasampattiādito dānādipuññakiriyāhetusamudāyato sobhāsugandhatādiguṇavisesayogato mālāguṇasadisiyo bahukā puññakiriyā maritabbasabhāvatāya maccena kattabbāti abhedatāya puppharāsi mālāguṇā ca upamā, tesaṃ upamānākāro yathāsaddena aniyamato vutto.
Here, from the position of a heap of flowers—namely, from the attainment of human birth, association with good people, hearing the Dhamma, proper attention (yonisomanasikāra), and material prosperity, etc., as the collection of causes for meritorious deeds (dānādipuññakiriyāhetusamudāya), and due to the possession of special qualities like beauty and fragrance—many meritorious deeds, similar to garlands, are to be done by a mortal, due to the nature of being subject to death. Thus, the heap of flowers and the garlands are similes due to their non-distinction, and the manner of their comparison is expressed indeterminately by the word yathā.
Ở đây, việc sinh ra làm người, nương tựa vào bậc thiện trí, nghe chánh pháp, tác ý đúng đắn, tài sản đầy đủ, v.v., là nơi chốn của đống hoa. Từ tổng hợp các nguyên nhân của các hành động thiện như bố thí, v.v., và nhờ vào các đặc tính tốt đẹp như vẻ đẹp, hương thơm, v.v., nhiều hành động thiện giống như vòng hoa cần được con người thực hiện vì bản chất phải chết. Do sự không khác biệt, đống hoa và vòng hoa là ví dụ so sánh. Cách thức so sánh của chúng đã được nói một cách không xác định bằng từ “yathā”.
Puna evaṃsaddena niyamanavasena vutto.
Again, it is expressed determinately by the word evaṃ.
Sau đó, nó được nói một cách xác định bằng từ “evaṃ”.
So pana upamākāro niyamiyamāno atthato upamā eva hotīti vuttaṃ ‘‘upamāyaṃ āgato’’ti.
And that manner of comparison, being determined, is indeed a simile in meaning, hence it is said, "It has come in the form of a simile."
Và cách thức so sánh đó, khi được xác định, về nghĩa, chính là sự so sánh. Vì vậy, đã nói “xuất hiện với nghĩa so sánh”.
Evamākāravisesavācīnampi etesaṃ evaṃsaddānaṃ upamādivisesatthavuttitāya upamādiatthatā vuttā.
Thus, the meaning of simile and other specific meanings are stated for these words evaṃ, which indicate specific modes, due to their being uttered with the meaning of simile and other distinctions.
Đối với những từ ‘evaṃ’ này, vốn là từ chỉ các cách thức đặc biệt, ý nghĩa của chúng được nói là ý nghĩa của sự so sánh, v.v., do chúng mang ý nghĩa đặc biệt của sự so sánh, v.v.
‘‘Evaṃ, bhante’’ti pana dhammassa sādhukaṃ savanamanasikāre niyojitehi bhikkhūhi tattha patiṭṭhitabhāvassa paṭijānanavasena vuttattā tattha evaṃsaddo vacanasampaṭiggahattho.
However, in "evaṃ, bhante," since it is spoken by bhikkhus who have been enjoined to listen and pay attention to the Dhamma properly, in acknowledgment of their firm establishment therein, the word evaṃ there has the meaning of accepting a statement.
Tuy nhiên, trong câu ‘‘Evaṃ, bhante’’ (Vâng, bạch Thế Tôn), từ ‘evaṃ’ có nghĩa là sự chấp nhận lời nói, vì các Tỳ-khưu đã được khuyến khích lắng nghe và chú tâm vào Pháp một cách cẩn thận đã tuyên bố sự kiên định của mình trong đó.
Tena evaṃ, bhanteti sādhu, bhante, suṭṭhu, bhanteti vuttaṃ hoti.
Therefore, "evaṃ, bhante" means "Sādhu, bhante" (It is good, venerable sir) and "Suṭṭhu, bhante" (It is very good, venerable sir).
Do đó, ‘‘Evaṃ, bhante’’ có nghĩa là “Tốt lắm, bạch Thế Tôn,” hoặc “Rất tốt, bạch Thế Tôn.”
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
And this (meaning of evaṃ) should be seen here in the sense of mode, indication, and affirmation.
Ở đây, từ này được hiểu theo nghĩa cách thức, chỉ thị và quyết định.
Ettha ca ekattanānattaabyāpāraevaṃdhammatāsaṅkhātā nandiyāvattatipukkhalasīhavikkīḷitadisālocanaaṅkusasaṅkhātā ca assādādivisayādibhedena nānāvidhā nayā nānānayā.
And here, the various approaches are of diverse kinds, such as the modes of unity, diversity, non-activity, and inherent nature (evaṃdhammatā), and the modes of nandiyāvaṭṭa, tipukkala, sīhavikkīḷita, disālocana, and aṅkusa, distinguished by subjects like gratification and so forth.
Trong ngữ cảnh này, nānānayā (nhiều phương pháp) là các phương pháp đa dạng như nhất thể, dị thể, bất tác ý, và như vậy là pháp tính (evam-dhammatā), cũng như các phương pháp được gọi là nandiyāvaṭṭa (xoay tròn hoan hỷ), tipukkala (ba loại người), sīhavikkīḷita (sư tử vờn), disālocana (nhìn quanh), và aṅkusa (cái móc), với sự phân biệt theo các đối tượng như sự hoan hỷ, v.v.
Nayā vā pāḷigatiyo, tā ca paññattianupaññattādivasena saṃkilesabhāgiyādilokiyāditadubhayavomissakādivasena kusalādivasena khandhādivasena, saṅgahādivasena, samayavimuttādivasena, ṭhapanādivasena, kusalamūlādivasena, tikapaṭṭhānādivasena ca nānappakārāti nānānayā, tehi nipuṇaṃ saṇhaṃ sukhumanti nānānayanipuṇaṃ.
Alternatively, the approaches are the ways of the Pāḷi texts, and these are of various kinds, such as by way of designations (paññatti) and secondary designations (anupaññatti), by way of corrupting factors (saṃkilesabhāgiyā) and mundane (lokiya) states, or mixtures of both, by way of wholesome (kusala) states, by way of aggregates (khandhā), by way of comprehensions (saṅgahā), by way of temporary or permanent liberation (samayavimuttā), by way of placements (ṭhapanā), by way of roots of wholesome actions (kusalamūlā), and by way of the Triplet-Paṭṭhāna (tikapaṭṭhānā). Therefore, they are nānānayā (various approaches). And by these, it is subtle, refined, and profound; thus, it is nānānayanipuṇa (subtle in various approaches).
Hoặc nānānayā là những cách thức diễn đạt (Pāḷi gatiyo) đa dạng, và những cách thức ấy rất đa dạng theo sự phân biệt thành paññatti (khái niệm) và anupaññatti (khái niệm phụ), theo sự phân biệt thành saṃkilesabhāgiya (thuộc về ô nhiễm), lokiya (thế gian) và sự pha trộn của cả hai, theo sự phân biệt thành kusala (thiện), v.v., theo sự phân biệt thành khandha (uẩn), v.v., theo sự phân biệt thành saṅgaha (tập hợp), v.v., theo sự phân biệt thành samayavimutta (giải thoát theo thời) và asamayavimutta (giải thoát phi thời), theo sự phân biệt thành ṭhapanā (thiết lập), v.v., theo sự phân biệt thành kusalamūla (gốc thiện), v.v., và theo sự phân biệt thành Tikapaṭṭhāna (Tam đề tương duyên), v.v. Và tinh vi (nipuṇaṃ) có nghĩa là khéo léo, vi tế.
Iddhiādesanānusāsanībhedena tesu ca ekekassa visayādibhedena vividhaṃ bahuvidhaṃ vā pāṭihāriyaṃ etassāti vividhapāṭihāriyaṃ.
It is vividhapāṭihāriyaṃ (endowed with diverse psychic powers) because it possesses diverse or many kinds of psychic power, distinguished by the three types: psychic power (iddhi), power of manifestation (ādesanā), and power of instruction (anusāsanī), and in each of these, by distinctions of their respective domains.
Vividhapāṭihāriyaṃ (nhiều phép thần thông) là vì nó có nhiều loại hay đa dạng các phép thần thông theo sự phân biệt thành thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī), và trong mỗi loại đó, theo sự phân biệt về đối tượng, v.v.
Tattha paṭipakkhaharaṇato rāgādikilesāpanayanato pāṭihāriyanti atthe sati bhagavato na paṭipakkhā rāgādayo santi ye haritabbā, puthujjanānampi vigatūpakkilese aṭṭhaguṇasamannāgate citte hatapaṭipakkhe iddhividhaṃ pavattati, tasmā tattha pavattavohārena ca na sakkā idha pāṭihāriyanti vattuṃ.
If pāṭihāriya means the removal of opponents (defilements) or the dispelling of defilements like lust, then the Bhagavā has no opponents or defilements like lust to be removed. Even for ordinary individuals, psychic power operates in a mind free from defilements and endowed with eight qualities, when opponents have been overcome. Therefore, it is not possible to call it pāṭihāriya here in the sense of the conventional usage in that context.
Trong đó, nếu nói rằng pāṭihāriya là do loại bỏ đối thủ, do loại bỏ các phiền não như tham ái, thì Thế Tôn không có các đối thủ là tham ái, v.v., để phải loại bỏ; ngay cả đối với phàm phu, phép thần thông cũng phát sinh trong tâm đã loại bỏ các phiền não phụ, đầy đủ tám phẩm chất, đã tiêu diệt đối thủ. Do đó, không thể nói ở đây là pāṭihāriya theo cách dùng từ phổ biến trong trường hợp đó.
Sace pana mahākāruṇikassa bhagavato veneyyagatā ca kilesā paṭipakkhā, tesaṃ haraṇato pāṭihāriyanti vuttaṃ, evaṃ sati yuttametaṃ.
However, if it is said that the defilements of the trainable individuals are the opponents of the Greatly Compassionate Bhagavā, and pāṭihāriya refers to the removal of these, then this is indeed fitting.
Tuy nhiên, nếu nói rằng các phiền não trong tâm của những người có thể được giáo hóa là đối thủ của Thế Tôn đại bi, và pāṭihāriya là do loại bỏ chúng, thì điều này là hợp lý.
Atha vā bhagavato ceva sāsanassa ca paṭipakkhā titthiyā, tesaṃ haraṇato pāṭihāriyaṃ.
Alternatively, the Tīrthikas (sectarians) are the opponents of the Bhagavā and the Sāsana. Pāṭihāriya refers to the removal of them.
Hoặc, các tirthika (ngoại đạo) là đối thủ của Thế Tôn và của giáo pháp. Pāṭihāriya là do loại bỏ họ.
Te hi diṭṭhiharaṇavasena diṭṭhippakāsane asamatthabhāvena ca iddhiādesanānusāsanīhi haritā apanītā honti.
Indeed, they are removed or dispelled by the psychic power, the power of manifestation, and the power of instruction, by way of removing their wrong views and by their inability to express their wrong views.
Thật vậy, họ bị loại bỏ, bị loại trừ bởi thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) theo cách loại bỏ tà kiến và do không có khả năng hiển thị tà kiến.
Paṭīti vā ayaṃ saddo pacchāti etassa atthaṃ bodheti ‘‘tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo’’tiādīsu (cūḷani. pārāyanavagga, vatthugāthā 4) viya.
Or this word paṭi conveys the meaning of paccha (after, behind), as in "When he entered, another brahmin came after" and so forth.
Hoặc từ ‘paṭi’ này biểu thị ý nghĩa “sau”, như trong các câu như ‘‘tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo’’ (khi người đó đã vào, một Bà-la-môn khác đến).
Tasmā samāhite citte vigatūpakkilese katakiccena pacchā haritabbaṃ pavattetabbanti paṭihāriyaṃ.
Therefore, paṭihāriya means that which should be carried out afterwards, that which should be made to occur after the mind is concentrated, after defilements are removed, and after the task is accomplished.
Do đó, pāṭihāriya là điều cần được thực hiện sau khi tâm đã định tĩnh, các phiền não đã được loại bỏ, và công việc đã hoàn thành.
Attano vā upakkilesesu catutthajjhānamaggehi haritesu pacchā haraṇaṃ paṭihāriyaṃ.
Alternatively, the removal of one's own defilements by the paths of the fourth jhāna, and the subsequent carrying out (of benefits for others) is paṭihāriya.
Hoặc, sau khi các phiền não phụ của mình đã được loại bỏ bằng Tứ thiền và các đạo lộ, sự loại bỏ sau đó là pāṭihāriya.
Iddhiādesanānusāsaniyo vigatūpakkilesena katakiccena sattahitatthaṃ puna pavattetabbā, haritesu ca attano upakkilesesu parasattānaṃ upakkilesaharaṇāni hontīti paṭihāriyāni bhavanti.
The psychic power, the power of manifestation, and the power of instruction should be cultivated again for the welfare of beings by one who is free from defilements and has accomplished the task. And when one's own defilements have been removed, the removal of the defilements of other beings occurs. Therefore, they become paṭihāriyā.
Thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) cần được thực hiện lại vì lợi ích của chúng sinh, sau khi các phiền não phụ đã được loại bỏ và công việc đã hoàn thành; và khi các phiền não phụ của mình đã được loại bỏ, thì việc loại bỏ các phiền não phụ của chúng sinh khác cũng xảy ra. Do đó, chúng trở thành pāṭihāriya.
Paṭihāriyameva pāṭihāriyaṃ, paṭihāriye vā iddhiādesanānusāsanīsamudāye bhavaṃ ekekaṃ pāṭihāriyanti vuccati.
Paṭihāriya itself is pāṭihāriya, or each individual psychic power, power of manifestation, and power of instruction, being part of the paṭihāriya (collection), is called pāṭihāriya.
Pāṭihāriya chính là paṭihāriya; hoặc, mỗi một điều xảy ra trong tập hợp thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) được gọi là pāṭihāriya.
Paṭihāriyaṃ vā catutthajjhānaṃ maggo ca paṭipakkhaharaṇato.
Alternatively, the fourth jhāna and the path are paṭihāriya because they remove opponents.
Hoặc, Tứ thiền và đạo lộ là pāṭihāriya, do chúng loại bỏ đối thủ.
Tattha jātaṃ nimittabhūtato tato vā āgatanti pāṭihāriyanti attho veditabbo.
Thus, the meaning to be understood is that pāṭihāriya refers to that which arises there, or that which originates from there as a sign (nimitta).
Trong đó, ý nghĩa pāṭihāriya là điều phát sinh ở đó, hoặc đến từ đó như một dấu hiệu, cần được hiểu.
Avadhāraṇatthena ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.219-223) evaṃ bhagavatā, ‘‘āyasmā ānando atthakusalo, dhammakusalo, byañjanakusalo, niruttikusalo, pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti.
By way of ascertainment, the Blessed One praised him thus: “Bhikkhus, among my bhikkhu disciples who are widely learned, Ananda is the foremost; among those who are capable, mindful, resolute, and attendants, Ananda is the foremost.” And the Dhamma Senāpati praised him thus: “Venerable Ananda is skilled in purpose, skilled in Dhamma, skilled in expression, skilled in language, skilled in sequence.” In accordance with this praised status, he demonstrates his power of retention, thus generating the desire to listen among beings.
Với nghĩa quyết định, Ngài Ānanda đã thể hiện sức mạnh ghi nhớ của mình phù hợp với lời tán thán của Thế Tôn: ‘‘Này các Tỳ-khưu, trong số các đệ tử Tỳ-khưu của Ta, những người đa văn, Ānanda là bậc tối thượng; trong số những người có trí tuệ, có niệm, có dũng lực, có người hầu hạ, Ānanda là bậc tối thượng’’ và của Pháp tướng quân (Sāriputta): ‘‘Tôn giả Ānanda thiện xảo về ý nghĩa, thiện xảo về giáo pháp, thiện xảo về văn tự, thiện xảo về ngữ nguyên, thiện xảo về quá khứ và tương lai’’, qua đó khơi dậy ý muốn lắng nghe của chúng sinh.
‘‘Evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
“Thus have I heard, and that, whether in meaning or in expression, is neither deficient nor excessive; it should be seen as exactly so and not otherwise.”
‘‘Evaṃ me sutaṃ (Tôi đã nghe như vậy), và điều đó không thiếu cũng không thừa về ý nghĩa hay văn tự; nó phải được xem xét đúng như vậy, không khác.’’
Aññathāti bhagavato sammukhā sutākārato aññathā na pana bhagavatā desitākārato.
Otherwise refers to an alteration from the manner of having heard it directly from the Blessed One, but not from the manner in which it was taught by the Blessed One.
Aññathā (khác) có nghĩa là không khác với cách đã nghe trực tiếp từ Thế Tôn, chứ không phải khác với cách Thế Tôn đã thuyết giảng.
Acinteyyānubhāvā hi bhagavato desanā, sā neva sabbākārena sakkā viññātunti vuttovāyamattho.
For the Blessed One’s teachings possess inconceivable power, and it has been stated that they cannot be fully understood in every respect.
Thật vậy, giáo pháp của Thế Tôn có năng lực không thể nghĩ bàn, không thể hiểu được theo mọi khía cạnh. Ý nghĩa này đã được nói đến.
Sutākārāvirujjhanameva hi dhāraṇabalaṃ.
Indeed, non-deviation from the heard form is the power of retention.
Thật vậy, không mâu thuẫn với cách đã nghe chính là sức mạnh ghi nhớ.
Mesaddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me xuất hiện với ba ý nghĩa.
Tathā hissa ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (saṃ. ni. 1.194; su. ni. 81) mayāti attho.
For example, in phrases like “What is obtained by chanting verse is not for me to eat,” its meaning is by me.
Thật vậy, trong các câu như ‘‘gāthābhigītaṃ me abhojaneyya’’ (món ăn được ca tụng bằng kệ không phải là của tôi), nó có nghĩa là ‘mayā’ (bởi tôi).
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88; 5.382; a. ni. 4.257) mayhanti attho.
In phrases like “Good, Venerable Sir, may the Blessed One teach me the Dhamma in brief,” its meaning is for me.
Trong các câu như ‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’ (Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp tóm tắt cho con), nó có nghĩa là ‘mayhaṃ’ (cho tôi).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like “Bhikkhus, be heirs of the Dhamma for me,” its meaning is my.
Trong các câu như ‘‘Dhammadāyādā me, bhikkhave, bhavathā’’ (Này các Tỳ-khưu, hãy là những người thừa kế Pháp của Ta), nó có nghĩa là ‘mama’ (của tôi).
Idha pana ‘‘mayā sutaṃ, mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in both meanings: “heard by me” and “my hearing.”
Ở đây, nó được dùng với hai ý nghĩa: ‘‘mayā sutaṃ’’ (tôi đã nghe) và ‘‘mama sutaṃ’’ (điều tôi đã nghe).
Tattha ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
There, in phrases like “went with the army,” the meaning is going.
Trong các trường hợp như "senāya pasuto" (đi cùng quân đội), nghĩa là "đang đi".
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like “to one of renowned Dhamma who sees,” the meaning is of renowned Dhamma.
Trong các trường hợp như "sutadhammassa passato" (người đã nghe Pháp và đã thấy), nghĩa là "người có Pháp nổi tiếng".
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilesena kilinnā kilinnassāti attho.
In phrases like “the defiled to the undefiled,” the meaning is defiled by defilement to the undefiled.
Trong các trường hợp như "avassutā avassutassā" (người nữ tỳ kheo bị ô nhiễm đối với người nam tỳ kheo không bị ô nhiễm), nghĩa là "bị dơ bẩn bởi phiền não, đối với người không bị dơ bẩn".
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like “You have accumulated much merit,” the meaning is accumulated.
Trong các trường hợp như "tumhehi puññaṃ pasutaṃ anappaka" (các ông đã tích lũy công đức không ít), nghĩa là "đã tích lũy".
‘‘Ye jhānappasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like “those wise ones who are diligent in jhāna,” the meaning is engaged in jhāna.
Trong các trường hợp như "ye jhānappasutā dhīrā" (những bậc trí giả chuyên tâm vào thiền định), nghĩa là "những người chuyên tâm vào thiền định".
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like “seen, heard, sensed,” the meaning is cognizable by ear-consciousness.
Trong các trường hợp như "diṭṭhaṃ sutaṃ mutaṃ" (cái đã thấy, đã nghe, đã biết), nghĩa là "có thể nhận biết bằng thính giác".
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like “one who retains what he has heard, one who accumulates what he has heard,” the meaning is one who retains what is known through following the ear-door.
Trong các trường hợp như "sutadharo sutasannicayo" (người ghi nhớ những gì đã nghe, người tích lũy những gì đã nghe), nghĩa là "người ghi nhớ những gì đã biết theo dòng thính giác".
Idha panassa ‘‘sotadvārānusārena upadhārita’’nti vā ‘‘upadhāraṇa’’nti vā attho.
Here, however, its meaning is either “retained through following the ear-door” or “retention.”
Tuy nhiên, ở đây, nghĩa của nó là "đã ghi nhớ theo dòng thính giác" hoặc "sự ghi nhớ".
Me-saddassa hi mayāti atthe sati ‘‘evaṃ mayā sutaṃ sotadvārānusārena upadhārita’’nti yujjati.
For when the word me has the meaning by me, then it is appropriate to say, “Thus was heard by me, retained through following the ear-door.”
Thật vậy, nếu từ me có nghĩa là "mayā" (bởi tôi), thì "evaṃ mayā sutaṃ sotadvārānusārena upadhāritaṃ" (như vậy tôi đã nghe, đã ghi nhớ theo dòng thính giác) là hợp lý.
Mamāti atthe sati ‘‘evaṃ mama sutaṃ sotadvārānusārena upadhāraṇa’’nti yujjati.
When it has the meaning my, then it is appropriate to say, “Thus is my hearing, retention through following the ear-door.”
Nếu từ me có nghĩa là "mama" (của tôi), thì "evaṃ mama sutaṃ sotadvārānusārena upadhāraṇaṃ" (như vậy sự nghe của tôi là sự ghi nhớ theo dòng thính giác) là hợp lý.
Evametesu tīsu padesu yasmā sutasaddasannidhāne payuttena evaṃsaddena savanakiriyājotakena bhavitabbaṃ, tasmā evanti sotaviññāṇasampaṭicchanādisotadvārikaviññāṇānantaraṃ uppannamanodvārikaviññāṇakiccanidassanaṃ.
In these three positions, since the word evaṃ, used in proximity to the word suta and indicating the act of hearing, must be present, therefore evaṃ indicates the function of mind-door consciousness that arises immediately after ear-door consciousness, such as receiving ear-consciousness.
Trong ba từ này, vì từ evaṃ được sử dụng gần với từ suta phải làm sáng tỏ hành động nghe, nên evaṃ là sự trình bày hành động của thức ý môn (manodvārikaviññāṇa) phát sinh ngay sau thức nhĩ môn (sotaviññāṇa) tiếp nhận, v.v.
Meti vuttaviññāṇasamaṅgīpuggalanidassanaṃ.
Me indicates the person endowed with the aforesaid consciousness.
Me là sự trình bày về cá nhân có đầy đủ thức đã nói.
Sabbāni hi vākyāni evakāratthasahitāniyeva avadhāraṇaphalattā tesaṃ.
For all sentences are indeed accompanied by the meaning of evaṃ because it is their fruit of ascertainment.
Tất cả các câu đều đi kèm với nghĩa của từ "eva" (chính là), vì chúng có kết quả là sự xác định.
Sutanti assavanabhāvappaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Suta indicates a non-deficient, non-excessive, and non-distorted apprehension, by negating the state of not having heard.
Sutaṃ là sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Yathā hi sutaṃ sutamevāti vattabbataṃ arahati tathā taṃ sammā sutaṃ anūnaggahaṇaṃ anadhikaggahaṇaṃ aviparītaggahaṇañca hotīti.
For just as what is heard is worthy of being called "just heard," so too is it correctly heard, without deficiency, without excess, and without distortion.
Thật vậy, những gì đã nghe đáng được nói là "chính là đã nghe", và như vậy, sự nghe đúng đắn đó là sự nắm bắt không thiếu, không thừa và không sai lệch.
Atha vā saddantaratthāpohanavasena saddo atthaṃ vadatīti etasmiṃ pakkhe yasmā sutanti etassa asutaṃ na hotīti ayamattho vutto, tasmā sutanti assavanabhāvappaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Alternatively, if it is held that a word expresses its meaning by excluding the meaning of another word, then since the meaning of sutaṃ is "it is not unheard," therefore sutaṃ indicates a non-deficient, non-excessive, and non-distorted apprehension by negating the state of not having heard.
Hoặc, theo quan điểm rằng một từ nói lên nghĩa bằng cách loại bỏ nghĩa của các từ khác, vì nghĩa của "sutaṃ" đã được nói là "không phải là chưa nghe", nên "sutaṃ" là sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Idaṃ vuttaṃ hoti – evaṃ me sutaṃ, na mayā idaṃ diṭṭhaṃ, na sayambhūñāṇena sacchikataṃ, na aññathā vā upaladdhaṃ.
This is what is meant: "Thus have I heard, this was not seen by me, not directly realized by self-existent knowledge, nor obtained in any other way.
Điều này có nghĩa là: "Như vậy tôi đã nghe, điều này tôi không tự mình thấy, không tự mình chứng ngộ bằng Tuệ tự sinh, cũng không đạt được bằng cách nào khác.
Api ca sutaṃva, tañca kho sammadevāti.
Moreover, it was indeed heard, and that too, correctly."
Hơn nữa, nó chỉ là điều đã nghe, và điều đó đã được nghe một cách đúng đắn."
Avadhāraṇatthe vā evaṃsadde ayamatthayojanā, tadapekkhassa sutasaddassa niyamattho sambhavatīti tadapekkhassa sutasaddassa assavanabhāvappaṭikkhepo anūnānadhikāviparītaggahaṇanidassanatā ca veditabbā.
Or, if the word evaṃ is in the sense of ascertainment, this construction of meaning applies, and thus the specific meaning of the word suta is possible, so the negation of the state of not having heard, and the indication of non-deficient, non-excessive, and non-distorted apprehension of the word suta dependent on that, should be understood.
Hoặc, nếu từ "evaṃ" có nghĩa là xác định, thì sự giải thích nghĩa này là hợp lý, và khi đó, nghĩa xác định của từ "suta" liên quan đến nó có thể xảy ra, và do đó, sự phủ nhận trạng thái không nghe, sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch của từ "suta" liên quan đến nó cần được hiểu.
Iti savanahetusavanavisesavasenapi sutasaddassa atthayojanā katāti daṭṭhabbaṃ.
Thus, it should be understood that the meaning of the word suta is explained by way of the cause of hearing and the distinction of hearing.
Như vậy, cần hiểu rằng sự giải thích nghĩa của từ "suta" đã được thực hiện theo cách là nguyên nhân của sự nghe và sự đặc biệt của sự nghe.
Tathā evanti nidassitabbappakāsanaṃ nidassanattho evaṃsaddoti katvā nidassetabbassa niddisitabbabhāvato.
Likewise, evaṃ expresses what is to be demonstrated, taking the word evaṃ as having the meaning of exemplification, because what is to be demonstrated is indeed to be indicated.
Tương tự, evaṃ là sự trình bày về điều cần được chỉ ra, giả định rằng từ evaṃ có nghĩa là sự chỉ ra, vì điều cần được chỉ ra là điều cần được trình bày.
Tasmā evaṃsaddena sakalampi suttaṃ paccāmaṭṭhanti veditabbaṃ.
Therefore, it should be understood that the entire Sutta is referred to by the word evaṃ.
Do đó, cần hiểu rằng toàn bộ bài kinh đã được hồi tưởng bằng từ evaṃ.
Meti puggalappakāsanaṃ.
Me is the expression of the person.
Me là sự trình bày về cá nhân.
Sutanti puggalakiccappakāsanaṃ.
Suta is the expression of the person's function.
Sutaṃ là sự trình bày về hành động của cá nhân.
Sutasaddena hi labbhamānā savanakiriyā savanaviññāṇappabandhappaṭibaddhā, tattha ca puggalavohāro, na ca puggalavohārarahite dhammappabandhe savanakiriyā labbhati.
For the act of hearing obtained through the word suta is connected with the continuity of hearing-consciousness, and there is the convention of "person" in that context, and the act of hearing is not found in a continuity of Dhamma devoid of the convention of "person."
Thật vậy, hành động nghe được hiểu từ từ "suta" gắn liền với chuỗi thức nghe, và ở đó có sự quy ước về cá nhân, và hành động nghe không thể được tìm thấy trong chuỗi Pháp không có quy ước về cá nhân.
Tassāyaṃ saṅkhepattho – yaṃ suttaṃ niddisissāmi, taṃ mayā evaṃ sutanti.
Its brief meaning is: "The Sutta which I will indicate, was thus heard by me."
Nghĩa tóm tắt của điều này là: "Bài kinh tôi sẽ trình bày, tôi đã nghe như vậy."
Atha vā evanti puggalakiccaniddeso, sutānañhi dhammānaṃ gahitākārassa nidassanassa avadhāraṇassa vā pakāsanasabhāvena evaṃsaddena tadākārādidhāraṇassa puggalavohārupādānadhammabyāpārabhāvato puggalakiccaṃnāma niddiṭṭhaṃ hotīti.
Alternatively, Evaṃ is a designation of the individual's function, for by the word 'evaṃ' as manifesting the nature of indicating or ascertaining the understood mode of the heard Dhammas, the function of the individual is designated through the activity of referring to the individual's conventional usage of retaining that mode and so forth.
Hoặc, evaṃ là sự trình bày về hành động của cá nhân, vì bằng từ evaṃ với tính chất làm sáng tỏ sự chỉ ra hoặc sự xác định về cách thức đã được nắm bắt của các Pháp đã được nghe, hành động của cá nhân được chỉ ra là do sự diễn ra của Pháp, là sự quy ước về cá nhân dựa trên sự ghi nhớ cách thức đó, v.v.
Sutanti viññāṇakiccaniddeso, puggalavādinopi hi savanakiriyā viññāṇanirapekkhā na hotīti.
Sutaṃ is a designation of the function of consciousness, for even for those who assert an individual, the act of hearing is not independent of consciousness.
Sutaṃ là sự trình bày về hành động của thức, vì ngay cả đối với người nói về cá nhân, hành động nghe cũng không thể không có thức.
Meti ubhayakiccayuttapuggalaniddeso.
Me is a designation of the individual endowed with both functions.
Me là sự trình bày về cá nhân có cả hai hành động.
Meti hi saddappavatti ekanteneva sattavisesavisayā viññāṇakiccañca tattheva samodahitabbanti.
Indeed, the occurrence of the word 'me' refers exclusively to a specific living being, and the function of consciousness must also be included therein.
Thật vậy, sự xuất hiện của từ me hoàn toàn liên quan đến một loại hữu tình, và hành động của thức cũng phải được bao gồm trong đó.
Ayaṃ panettha saṅkhepo – mayā savanakiccaviññāṇasamaṅginā puggalena viññāṇavasena laddhasavanakiccavohārena sutanti.
Here is the summary: "It was heard by me, the individual endowed with the consciousness of the act of hearing, by way of consciousness, by whom the conventional usage of the act of hearing was obtained."
Đây là tóm tắt ở đây: "Tôi, cá nhân có đầy đủ hành động nghe và thức, với quy ước về hành động nghe đạt được nhờ thức, đã nghe."
Tathā evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
Likewise, both Evaṃ and Me are designations of what is non-existent according to the absolute ultimate reality.
Tương tự, evaṃ và me là những quy ước không tồn tại theo nghĩa chân đế tuyệt đối.
Sabbassa hi saddādhigamanīyassa atthassa paññattimukheneva paṭipajjitabbattā sabbapaññattīnañca vijjamānādīsu chasu paññattīsu avarodho, tasmā yo māyāmarīciādayo viya abhūtattho anussavādīhi gahetabbo viya anuttamatthopi na hoti.
For every meaning that is to be understood through words must be approached through designations, and all designations are subsumed under the six types of designations, such as existent and so forth. Therefore, that meaning which is not real, like illusions and mirages, and which is not an ultimate truth to be grasped by tradition and so forth, is not ultimately real.
Vì tất cả các nghĩa có thể đạt được bằng lời nói đều phải được thực hành thông qua quy ước, và tất cả các quy ước đều được bao gồm trong sáu loại quy ước như tồn tại, v.v., do đó, cái gì không phải là nghĩa không tồn tại như ảo ảnh, ảo giác, v.v., cũng không phải là nghĩa tối thượng cần được nắm bắt bằng sự truyền khẩu, v.v.
So rūpasaddādiko ruppanānubhavanādiko ca paramatthasabhāvo saccikaṭṭhaparamatthavasena vijjati.
That ultimate reality, such as material sound, suffering, experience, and so forth, exists in terms of absolute ultimate reality.
Cái đó, tức là bản chất tối thượng của sắc, thanh, v.v., của sự bị phá hoại, sự trải nghiệm, v.v., tồn tại theo nghĩa chân đế tuyệt đối.
Yo pana evanti ca meti ca vuccamāno ākārattho, so aparamatthasabhāvo saccikaṭṭhaparamatthavasena anupalabbhamāno avijjamānapaññatti nāma.
But the meaning of the mode, which is spoken of as Evaṃ and Me, is not an ultimate reality; being unperceivable in terms of absolute ultimate reality, it is called a designation of what is non-existent.
Còn cái nghĩa cách thức được gọi là "evaṃ" và "me", bản chất không phải tối thượng, không thể tìm thấy theo nghĩa chân đế tuyệt đối, được gọi là quy ước không tồn tại.
Tasmā kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha?
Therefore, what in this (designation) truly exists in ultimate reality, that it might obtain the designation of Evaṃ or Me?
Do đó, ở đây, cái gì tồn tại theo nghĩa tối thượng mà có thể được gọi là "evaṃ" hoặc "me"?
Sutanti vijjamānapaññatti, yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
Sutaṃ is an existent designation, for what is apprehended by the ear here truly exists in ultimate reality.
Sutaṃ là quy ước tồn tại, vì cái đã được nhận biết bằng tai ở đây là cái tồn tại theo nghĩa tối thượng.
Tathā evanti sotapathamāgate dhamme upādāya tesaṃ upadhāritākārādīnaṃ paccāmasanavasena.
Similarly, Evaṃ is a designation by referring to the ascertained modes and so forth of the Dhammas that have come to the path of hearing.
Tương tự, evaṃ là theo cách hồi tưởng lại các cách thức đã được ghi nhớ, v.v., của các Pháp đã đến đường tai.
Meti sasantatipariyāpanne khandhe karaṇādivisesavisiṭṭhe upādāya vattabbato upādāpaññatti.
Me is a designation by referring to the aggregates included within one's own continuum, distinguished by characteristics such as instrumentality, hence it is a designation by way of clinging (upādāya paññatti).
Me là quy ước dựa trên (upādāya paññatti), vì nó được nói dựa trên các uẩn thuộc dòng tâm thức của chính mình, được đặc trưng bởi các trường hợp đặc biệt như công cụ, v.v.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a designation by comparison (upanidhāpaññatti), as it is to be spoken of by comparing it with what has been seen and so forth.
Sutaṃ là quy ước so sánh (upanidhāpaññatti), vì nó được nói dựa trên các điều đã thấy, v.v.
Diṭṭhādisabhāvarahite saddāyatane pavattamānopi sutavohāro dutiyaṃ tatiyantiādiko viya paṭhamādīni, diṭṭhamutaviññāte apekkhitvā sutanti viññeyyattā diṭṭhādīni upanidhāya vattabbo hoti.
Even though the designation of "heard" occurs with respect to the sound-ayatana, which is devoid of the nature of "seen" and so forth, just as "second" and "third" depend on "first" and so forth, similarly, the word "heard" must be spoken of by comparison to "seen," "perceived," and "discerned," because it is to be understood as "heard" in relation to them.
Mặc dù thuật ngữ "suta" (đã nghe) được sử dụng trong lĩnh vực âm thanh, vốn không có bản chất của "diṭṭha" (đã thấy) và các giác quan khác, nhưng nó phải được nói bằng cách dựa vào "diṭṭha" và các giác quan khác, vì nó được hiểu là "suta" khi so sánh với "diṭṭha", "muta" (đã cảm thọ) và "viññāta" (đã nhận biết), như cách các thuật ngữ "thứ hai", "thứ ba" và các thuật ngữ tương tự dựa vào "thứ nhất" và các thuật ngữ tương tự.
Asutaṃ na hotīti hi sutanti pakāsitoyamatthoti.
For this meaning is declared as "heard" because it is not unheard.
Vì đây là ý nghĩa được tuyên bố là "suta" (đã nghe) bởi vì "asuta" (chưa nghe) không tồn tại.
Ettha ca evantivacanena asammohaṃ dīpeti.
Here, by the word Evaṃ, non-confusion is indicated.
Ở đây, với từ evaṃ, Ngài A-nanda biểu thị sự không lầm lẫn.
Paṭividdhā hi attanā sutassa pakāravisesā evanti idha āyasmatā ānandena paccāmaṭṭhā, tenassa asammoho dīpito hoti.
For the venerable Ānanda here recollected the specific modes of what he himself had penetrated and heard as 'thus' (evaṃ); by this, his non-confusion is indicated.
Thật vậy, ở đây, Tôn giả A-nanda đã suy xét lại những đặc điểm chi tiết của những gì mình đã nghe, do đó, sự không lầm lẫn của Ngài được biểu thị.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti, paccayākāravasena nānappakārā duppaṭividdhā ca suttantāti dīpitanti.
Indeed, one who is confused is not capable of penetrating various modes; thus, it is shown that the Suttantas, with their various modes by way of conditions and aspects, are difficult to penetrate.
Thật vậy, một người lầm lẫn không thể thấu hiểu nhiều loại, và được biểu thị rằng các ý nghĩa của kinh điển là đa dạng về mặt nhân duyên và khó thấu hiểu.
Sutantivacanena sutassa asammosaṃ dīpeti, sutākārassa yāthāvato dassiyamānattā.
By the word Sutaṃ, non-forgetfulness of what was heard is indicated, due to the faithful showing of the mode of what was heard.
Với từ sutaṃ, Ngài biểu thị sự không quên những gì đã nghe, vì cách thức đã nghe được trình bày một cách chân thực.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantare mayā sutanti paṭijānāti.
For if one's hearing is forgotten, one does not acknowledge in a later time that "I heard this."
Thật vậy, một người đã quên những gì mình đã nghe sẽ không thừa nhận rằng "tôi đã nghe điều này" vào một thời điểm sau đó.
Iccassa asammohena paññāsiddhi, sammohābhāvena paññāya eva vā savanakālasambhūtāya taduttarikālapaññāsiddhi, tathā asammosena satisiddhi.
Thus, by his non-confusion, the attainment of wisdom is perfected, or by the absence of confusion, the attainment of wisdom in the subsequent period, based on the wisdom arisen at the time of hearing; similarly, by non-forgetfulness, the attainment of mindfulness is perfected.
Vì thế, sự thành tựu trí tuệ của Ngài là do không lầm lẫn, hoặc sự thành tựu trí tuệ sau này là do trí tuệ phát sinh vào lúc nghe, do không lầm lẫn; và sự thành tựu chánh niệm là do không quên.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā.
Among these, mindfulness preceded by wisdom is capable of comprehending the mere words.
Trong đó, khả năng ghi nhớ các từ ngữ là nhờ chánh niệm đi trước trí tuệ.
Byañjanānañhi paṭivijjhitabbo ākāro nātigambhīro, yathāsutaṃ dhāraṇameva tattha karaṇīyanti satiyā byāpāro adhiko, paññā tattha guṇībhūtā hoti paññāya pubbaṅgamāti katvā.
For the mode of the words to be penetrated is not overly profound; merely retaining what was heard is to be done there. Thus, the activity of mindfulness is primary, and wisdom is secondary there, because it is preceded by wisdom.
Thật vậy, khía cạnh cần được thấu hiểu của các từ ngữ không quá sâu sắc; ở đây, việc ghi nhớ đúng như đã nghe là điều cần làm. Vì vậy, vai trò của chánh niệm là lớn hơn, trí tuệ ở đây trở thành phụ thuộc, vì chánh niệm đi trước trí tuệ.
Satipubbaṅgamāya paññāya atthappaṭivedhasamatthatā.
Wisdom preceded by mindfulness is capable of penetrating the meaning.
Khả năng thấu hiểu ý nghĩa là nhờ trí tuệ đi trước chánh niệm.
Atthassa hi paṭivijjhitabbo ākāro gambhīroti paññāya byāpāro adhiko, sati tattha guṇībhūtāyevāti satiyā pubbaṅgamāyāti katvā.
For the mode of the meaning to be penetrated is profound. Thus, the activity of wisdom is primary, and mindfulness is secondary there, because it is preceded by mindfulness.
Thật vậy, khía cạnh cần được thấu hiểu của ý nghĩa là sâu sắc, vì vậy vai trò của trí tuệ là lớn hơn, chánh niệm ở đây chỉ là phụ thuộc, vì trí tuệ đi trước chánh niệm.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthatāya dhammabhaṇḍāgārikattasiddhi.
By virtue of being endowed with the ability of both, the attainment of being the Keeper of the Dhamma Treasury is perfected, through the ability to preserve the Dhamma-treasury complete with both meaning and words.
Do khả năng kép này, sự thành tựu của Ngài là người giữ kho Pháp (Dhammabhaṇḍāgārika) là nhờ khả năng bảo vệ kho tàng Pháp đầy đủ cả ý nghĩa và từ ngữ.
Aparo nayo – evantivacanena yonisomanasikāraṃ dīpeti, tena ca vuccamānānaṃ ākāranidassanāvadhāraṇatthānaṃ upari vakkhamānānaṃ nānappakārappaṭivedhajotakānaṃ aviparītasiddhi dhammavisayattā.
Another method: By the word Evaṃ, appropriate attention (yonisomanasikāra) is indicated, and by that, the unerring perfection of the meanings of mode, indication, and ascertainment, which will be explained later and which illuminate various kinds of penetration, is indicated, because they pertain to Dhamma.
Một cách giải thích khác – với từ evaṃ, Ngài biểu thị sự tác ý đúng đắn (yonisomanasikāra), và nhờ đó, sự thành tựu không sai lệch của các ý nghĩa về khía cạnh, ví dụ và sự xác định, sẽ được nói đến ở trên, vốn biểu thị sự thấu hiểu đa dạng, là do chúng thuộc về Pháp.
Na hi ayoniso manasikaroto nānappakārappaṭivedho sambhavati.
Indeed, for one who attends inappropriately, various kinds of penetration do not arise.
Thật vậy, sự thấu hiểu đa dạng không thể xảy ra đối với người tác ý không đúng đắn.
Sutantivacanena avikkhepaṃ dīpeti, ‘‘paṭhamabodhisuttaṃ kattha bhāsita’’ntiādipucchāvasena pakaraṇapattassa vakkhamānassa suttassa savanaṃ samādhānamantarena na sambhavati vikkhittacittassa savanābhāvato.
By the word Sutaṃ, non-distraction is indicated, for the hearing of the Sutta, which will be explained later and which pertains to the context, as in questions like "Where was the first Bodhi Sutta delivered?", cannot occur without mental concentration, due to the absence of hearing for one with a distracted mind.
Với từ sutaṃ, Ngài biểu thị sự không tán loạn, vì việc nghe bài kinh sẽ được nói đến, vốn thuộc về phần chính của kinh điển thông qua các câu hỏi như "Bài kinh Bồ-đề đầu tiên được thuyết ở đâu?", không thể xảy ra nếu không có sự tập trung, bởi vì người có tâm tán loạn không thể nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Thus, a distracted person, even when spoken to with a complete exposition, says, "I did not hear; please say it again."
Thật vậy, một người có tâm tán loạn, dù được nói tất cả những điều tốt đẹp, vẫn nói: "Tôi chưa nghe, xin hãy nói lại."
Yonisomanasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by appropriate attention, one accomplishes self-resolution and past meritorious deeds, for these are absent for one whose self is not rightly resolved or who has not performed meritorious deeds in the past.
Ở đây, với sự tác ý đúng đắn (yonisomanasikāra), Ngài chứng minh sự tự định hướng đúng đắn và công đức đã tạo trong quá khứ, vì những điều đó không tồn tại đối với người không tự định hướng đúng đắn hoặc người chưa tạo công đức trong quá khứ.
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti assutavato sappurisūpanissayavirahitassa ca tadabhāvato.
By non-distraction, one accomplishes hearing the True Dhamma and associating with good people, for these are absent for one who has not heard or who is devoid of association with good people.
Với sự không tán loạn, Ngài chứng minh việc nghe Chánh Pháp và nương tựa vào bậc thiện trí (sappurisūpanissaya), vì những điều đó không tồn tại đối với người chưa từng nghe hoặc người không có sự nương tựa vào bậc thiện trí.
Na hi vikkhitto sotuṃ sakkoti, na ca sappurise anupanissayamānassa savanaṃ atthīti.
Indeed, a distracted person cannot hear, nor is there hearing for one who does not associate with good people.
Thật vậy, người tán loạn không thể nghe, và người không nương tựa vào bậc thiện trí thì không có sự nghe.
Aparo nayo – ‘‘yassa cittasantānassa nānappakārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ.
Another method: "The indication of various modes belongs to the mind-continuum of which there is comprehension of various meanings and words due to its various occurrences," it was said.
Một cách giải thích khác – "sự chỉ rõ các khía cạnh khác nhau là dành cho dòng tâm thức nào mà có sự nắm bắt các ý nghĩa và từ ngữ khác nhau do sự vận hành đa dạng của nó" đã được nói.
Yasmā ca so bhagavato vacanassa atthabyañjanappabhedaparicchedavasena sakalasāsanasampattiogāhanena niravasesaṃ parahitapāripūrīkaraṇabhūto evaṃ bhaddako ākāro na sammā appaṇihitattassa pubbe akatapuññassa vā hoti.
And because such an excellent mode—being the cause for the complete fulfillment of the welfare of others by pervading the entirety of the Dispensation through the analysis of the meanings and words of the Buddha's discourse—does not belong to one whose self is not rightly resolved or who has not performed meritorious deeds in the past.
Và bởi vì khía cạnh tốt đẹp như vậy, vốn là nguyên nhân hoàn thành lợi ích của người khác một cách trọn vẹn bằng cách thâm nhập vào toàn bộ sự giàu có của giáo pháp thông qua việc phân tích các loại ý nghĩa và từ ngữ trong lời dạy của Đức Phật, không thể có được đối với người không tự định hướng đúng đắn hoặc người chưa tạo công đức trong quá khứ.
Tasmā evanti iminā bhaddakena ākārena pacchimacakkadvayasampattimattano dīpeti, sutanti savanayogena purimacakkadvayasampattiṃ.
Therefore, by this excellent mode, Evaṃ, he indicates his own attainment of the latter two wheels (of prosperity), and by the word Sutaṃ, through the act of hearing, he indicates his attainment of the former two wheels.
Vì vậy, với khía cạnh tốt đẹp này, tức là evaṃ, Ngài biểu thị sự thành tựu của hai bánh xe cuối cùng của mình, và với từ sutaṃ, Ngài biểu thị sự thành tựu của hai bánh xe đầu tiên thông qua việc nghe.
Na hi appatirūpe dese vasato sappurisūpanissayavirahitassa ca savanaṃ atthi.
For there is no hearing for one who dwells in an unsuitable place or who is devoid of association with good people.
Thật vậy, không có sự nghe đối với người sống ở nơi không phù hợp và không có sự nương tựa vào bậc thiện trí.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti.
Thus, by his attainment of the latter two wheels, the purity of his disposition is perfected.
Vì thế, với sự thành tựu của hai bánh xe cuối cùng, sự thanh tịnh về ý định của Ngài đã được chứng minh.
Sammā paṇihitacitto pubbe ca katapuñño visuddhāsayo hoti tadasuddhihetūnaṃ kilesānaṃ dūrībhāvato.
One whose mind is rightly resolved and who has performed meritorious deeds in the past has a pure disposition, due to the removal of defilements, which are the causes of impurity.
Một người có tâm định hướng đúng đắn và đã tạo công đức trong quá khứ thì có ý định thanh tịnh, vì các phiền não là nguyên nhân của sự không thanh tịnh đã bị loại bỏ.
Tathā hi vuttaṃ ‘‘sammā paṇihitaṃ cittaṃ, seyyaso naṃ tato kare’’ti (dha. pa. 43) ‘‘katapuññosi tvaṃ, ānanda, padhānamanuyuñja, khippaṃ hohisi anāsavo’’ti (dī. ni. 2.207) ca.
Thus it is said: "A well-directed mind makes one better than that" (Dhp. 43) and "You are one who has done merit, Ānanda; devote yourself to exertion, and you will quickly become taintless" (Dī. Ni. 2.207).
Thật vậy, đã được nói: "Tâm được định hướng đúng đắn sẽ làm cho người đó trở nên tốt đẹp hơn" và "Này A-nanda, con đã tạo công đức, hãy tinh tấn tu tập, con sẽ nhanh chóng trở thành vô lậu".
Purimacakkadvayasiddhiyā payogasuddhi.
The purity of practice is achieved by the success of the first two wheels.
Với sự thành tựu của hai bánh xe đầu tiên, sự thanh tịnh trong thực hành đã được chứng minh.
Patirūpadesavāsena hi sappurisūpanissayena ca sādhūnaṃ diṭṭhānugatiāpajjanena parisuddhappayogo hoti.
Indeed, by dwelling in a suitable region and by associating with good people, and by following the example of the virtuous, one's practice becomes purified.
Thật vậy, với việc sống ở nơi phù hợp và nương tựa vào bậc thiện trí, và noi theo gương của các bậc thiện trí, người đó có sự thực hành thanh tịnh.
Tāya ca āsayasuddhiyā adhigamabyattisiddhi, pubbeyeva taṇhādiṭṭhisaṃkilesānaṃ visodhitattā payogasuddhiyā āgamabyattisiddhi.
And by that purity of aspiration, the success of realization is achieved, because defilements like craving and wrong view were already cleansed; by the purity of practice, the success of scriptural knowledge is achieved.
Và với sự thanh tịnh về ý định đó, sự thành tựu trong việc chứng đắc đã được chứng minh, vì các phiền não như tham ái và tà kiến đã được thanh lọc từ trước; với sự thanh tịnh trong thực hành, sự thành tựu trong việc học hỏi đã được chứng minh.
Suparisuddhakāyavacīpayogo hi vippaṭisārābhāvato avikkhittacitto pariyattiyaṃ visārado hoti.
For one whose bodily and verbal practice is perfectly pure, being free from remorse, has an unscattered mind and is confident in the Pariyatti.
Thật vậy, một người có sự thực hành thân và khẩu hoàn toàn thanh tịnh, do không có sự hối hận, có tâm không tán loạn và tinh thông trong việc học hỏi.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggamanaṃ viya sūriyassa udayato yonisomanasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the words of one whose practice and aspiration are pure, and who is accomplished in both scriptural knowledge and realization, are worthy to be a forerunner of the Buddha's words, just as the dawn is a forerunner of the sun's rising, and proper attention (yonisomanasikāra) is a forerunner of wholesome action. Therefore, placing the cause in its proper place, he said, "Thus have I heard" (evaṃ me sutaṃ).
Vì vậy, lời nói của một người có sự thanh tịnh trong thực hành và ý định, và đầy đủ cả việc học hỏi và chứng đắc, xứng đáng là phần mở đầu cho lời dạy của Đức Phật, giống như ánh bình minh là phần mở đầu cho sự mọc của mặt trời, và sự tác ý đúng đắn là phần mở đầu cho hành động thiện lành. Do đó, khi đặt nền tảng cho điều này, Ngài nói: "Evaṃ me sutaṃ" (Như vầy tôi nghe).
Aparo nayo – evanti iminā pubbe vuttanayeneva nānappakārappaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: By this word evaṃ, in the manner already stated, Venerable Ānanda reveals the existence of his attainment of paṭisambhidā (analytical knowledge) concerning meaning and perspicuity, by means of words that elucidate various kinds of penetration.
Một cách giải thích khác – với từ evaṃ, vốn biểu thị sự thấu hiểu đa dạng theo cách đã nói ở trên, Ngài biểu thị sự tồn tại của sự thành tựu về các phân tích về ý nghĩa và biện tài của mình.
Sutanti iminā evaṃsaddasannidhānato vakkhamānāpekkhāya vā sotabbabhedappaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ dīpeti.
By this word sutaṃ, due to its proximity to the word evaṃ, or with reference to what is to be said, he reveals the existence of his attainment of paṭisambhidā concerning Dhamma and language, by means of words that elucidate the penetration of various kinds of things to be heard.
Với từ sutaṃ, do sự gần gũi của từ evaṃ, hoặc do sự mong đợi những gì sẽ được nói đến sau, Ngài biểu thị sự tồn tại của sự thành tựu về các phân tích về Pháp và ngôn ngữ, vốn biểu thị sự thấu hiểu các loại điều cần nghe.
Evanti ca idaṃ vuttanayeneva yonisomanasikāradīpakavacanaṃ bhāsamāno ‘‘ete dhammā mayā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And by uttering this word evaṃ, which, in the manner already stated, elucidates proper attention (yonisomanasikāra), he reveals, "These Dhammas have been reflected upon by me mentally and thoroughly penetrated by insight."
Và khi nói từ evaṃ, vốn biểu thị sự tác ý đúng đắn theo cách đã nói ở trên, Ngài biểu thị: "Những pháp này đã được tôi suy xét bằng tâm và đã được thấu hiểu rõ ràng bằng tuệ tri (diṭṭhi)."
Pariyattidhammo hi ‘‘idha sīlaṃ kathitaṃ, idha samādhi, idha paññā, ettakā ettha anusandhiyo’’tiādinā nayena manasā anupekkhito anussavākāraparivitakkasahitāya dhammanijjhānakkhantibhūtāya ñātapariññāsaṅkhātāya vā diṭṭhiyā tattha tattha vuttarūpārūpadhamme ‘‘iti rūpaṃ, ettakaṃ rūpa’’ntiādinā nayena suṭṭhu vavatthapetvā paṭividdho attano ca paresañca hitasukhāvaho hotīti.
For the Pariyatti Dhamma, when mentally reflected upon in ways such as "Here morality is taught, here concentration, here wisdom, and such are the connections here," and thoroughly penetrated by insight (diṭṭhi) which is accompanied by the mode of recollection and deep reflection, or which is called 'knowledge of the known' (ñātapariññā), by clearly discerning the material and immaterial phenomena taught therein, such as "This is form, this much is form," becomes conducive to one's own welfare and happiness, as well as that of others.
Thật vậy, Pháp học, khi được suy xét bằng tâm theo cách như "ở đây giới được nói đến, ở đây định, ở đây tuệ, có bấy nhiêu sự liên kết ở đây", v.v., và được thấu hiểu rõ ràng bằng tuệ tri, vốn bao gồm sự suy tư về cách thức đã nghe và sự chấp nhận về sự quán sát Pháp, hay còn gọi là sự hiểu biết về sự hiểu biết (ñātapariññā), sau khi đã phân định rõ ràng các pháp sắc và vô sắc được nói đến ở từng nơi theo cách như "đây là sắc, sắc có bấy nhiêu", v.v., thì sẽ mang lại lợi ích và hạnh phúc cho bản thân và cho người khác.
Sutanti idaṃ savanayogadīpakavacanaṃ bhāsamāno ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering this word sutaṃ, which elucidates the faculty of hearing, he reveals, "Many Dhammas have been heard by me, retained, and familiarized verbally."
Khi nói từ sutaṃ, vốn biểu thị sự nghe, Ngài biểu thị: "Tôi đã nghe nhiều pháp, đã ghi nhớ chúng và đã quen thuộc với chúng bằng lời nói."
Sotāvadhānappaṭibaddhā hi pariyattidhammassa savanadhāraṇaparicayā.
Indeed, the hearing, retention, and familiarization of the Pariyatti Dhamma are bound up with the faculty of hearing.
Thật vậy, việc nghe, ghi nhớ và quen thuộc với Pháp học đều phụ thuộc vào sự chú tâm khi nghe.
Tadubhayenapi dhammassa svākkhātabhāvena, atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, he generates reverence for hearing, by demonstrating the Dhamma's well-proclaimed nature and its completeness in meaning and letter.
Với cả hai điều đó, Ngài biểu thị sự đầy đủ về ý nghĩa và từ ngữ của Pháp là được thuyết giảng hoàn hảo, và Ngài khơi dậy sự chú tâm vào việc nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabbo.
For one who does not listen respectfully to the Dhamma, which is complete in meaning and letter, is deprived of great benefit. Therefore, generating reverence, the Dhamma should be listened to respectfully.
Thật vậy, một người không lắng nghe Pháp đầy đủ ý nghĩa và từ ngữ một cách kính trọng sẽ bị thiếu hụt lợi ích lớn lao. Vì vậy, cần phải khơi dậy sự kính trọng và lắng nghe Pháp một cách cẩn thận.
Ekanti gaṇanaparicchedaniddeso.
Ekaṃ is an indication of numerical classification.
Ekaṃ (một) là sự chỉ định giới hạn về số lượng.
Ayañhi ekasaddo aññaseṭṭhāsahāyasaṅkhyādīsu dissati.
Indeed, this word eka is seen in the senses of 'another', 'best', 'alone', 'number', and so on.
Thật vậy, từ eka này được thấy trong các nghĩa như: khác, tối thượng, không có bạn đồng hành, số lượng, v.v.
Tathā hi ayaṃ ‘‘sassato attā ca loko ca, idameva saccaṃ moghamaññanti ittheke abhivadantī’’tiādīsu (ma. ni. 3.27; udā. 55) aññe dissati.
Thus, it is seen in the sense of 'another' in phrases like ‘‘the self and the world are eternal; this alone is true, all else is delusive’—thus some declare’’.
Ví dụ, trong các câu như “linh hồn và thế giới là thường còn, chỉ điều này là chân lý, những điều khác là vô nghĩa, một số người nói như vậy” (Ma. Ni. 3.27; Udā. 55), nó được thấy trong nghĩa khác.
‘‘Cetaso ekodibhāva’’ntiādīsu (pārā. 11; dī. ni. 1.228) seṭṭhe.
In the sense of 'best' in phrases like ‘‘the singleness of mind’’.
Trong các câu như “sự an định nhất tâm” (Pārā. 11; Dī. Ni. 1.228), nó được thấy trong nghĩa tối thượng.
‘‘Eko vūpakaṭṭho’’tiādīsu (cūḷava. 445; dī. ni. 1.405) asahāye.
In the sense of 'alone' in phrases like ‘‘one who is secluded’’.
Trong các câu như “một mình ẩn cư” (Cūḷava. 445; Dī. Ni. 1.405), nó được thấy trong nghĩa không có bạn đồng hành.
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) saṅkhyāyaṃ, idhāpi saṅkhyāyameva daṭṭhabbo.
In the sense of 'number' in phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ and here too, it should be understood in the sense of number.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc, một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nó được thấy trong nghĩa số lượng, và ở đây cũng nên hiểu là số lượng.
Tena vuttaṃ – ‘‘ekanti gaṇanaparicchedaniddeso’’ti.
Therefore, it is said: ‘‘ekaṃ is an indication of numerical classification.’’
Vì vậy, đã nói: “ Ekaṃ là sự chỉ định giới hạn về số lượng.”
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho, yuttakālañca paccayasāmaggiñca labhitvāti hi adhippāyo, tasmā paccayasamavāyoti veditabbo.
Thus, in phrases like ‘‘We might perhaps approach tomorrow, depending on the suitable time and the conjunction of circumstances,’’ the meaning is 'conjunction of circumstances'; the intention is to obtain a suitable time and a conjunction of conditions, therefore it should be understood as a conjunction of conditions. In phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ the meaning is 'moment', that is, 'opportunity'. The arising of a Tathāgata, and so on, is indeed an opportunity for the path and the holy life, because it is the cause for the attainment of those conditions; a moment is indeed an opportunity, that which is called a moment and an opportunity, that is one. In phrases like ‘‘the hot season, the sweltering season,’’ the meaning is 'time'. In phrases like ‘‘the great assembly in the forest,’’ the meaning is 'collection'. The meaning of Mahāsamaya is indeed a great gathering of bhikkhus and devas. In phrases like ‘‘Indeed, Bhaddāli, your opportunity was not penetrated; the Blessed One dwells in Sāvatthī; the Blessed One will know me: ‘The bhikkhu named Bhaddāli is not one who fulfills the training in the Teacher’s Dispensation.’ Indeed, Bhaddāli, this opportunity of yours was not penetrated,’’ the meaning is 'cause'. The cause of the training rule is intended here as samaya. In phrases like ‘‘At that time, the wanderer Uggāhamāna, the son of Samaṇamuṇḍikā, was dwelling in the Mallikā’s park at Tindukācīra, in a single hall where doctrines were expounded,’’ the meaning is 'view'. There, the sectarians, sitting there, expound their respective views, which are called samaya, and so that wanderers’ park is called ‘‘Samayappavādaka’’.
Ví dụ, trong các câu như “Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ của các duyên” (Dī. Ni. 1.447), nghĩa là sự hội tụ (samavāya), ý muốn nói là đạt được thời điểm thích hợp và sự đầy đủ của các duyên; do đó, nên hiểu là sự hội tụ của các duyên (paccayasamavāya).
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo, okāsoti attho.
In phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ the meaning is 'moment', that is, 'opportunity'.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc, một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nghĩa là khoảnh khắc (khaṇa), tức là cơ hội.
Tathāgatuppādādiko hi maggabrahmacariyassa okāso tappaccayappaṭilābhahetuttā, khaṇo eva ca samayo, yo khaṇoti ca samayoti ca vuccati, so eko yevāti hi attho.
The arising of a Tathāgata, and so on, is indeed an opportunity for the path and the holy life, because it is the cause for the attainment of those conditions; a moment is indeed an opportunity, that which is called a moment and an opportunity, that is one. This is the intended meaning.
Thật vậy, sự xuất hiện của Đức Như Lai là cơ hội cho đời sống Phạm hạnh của con đường (đạo lộ), vì nó là nguyên nhân để đạt được các duyên đó. Khoảnh khắc đó chính là thời điểm (samaya), điều được gọi là khoảnh khắc và thời điểm, chỉ là một. Ý nghĩa là như vậy.
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In phrases like ‘‘the hot season, the sweltering season,’’ the meaning is 'time'.
Trong các câu như “thời tiết nóng bức, thời tiết oi ả” (Pāci. 358), nghĩa là thời gian (kāla).
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In phrases like ‘‘the great assembly in the forest,’’ the meaning is 'collection'.
Trong các câu như “đại hội trong rừng” (Dī. Ni. 2.332), nghĩa là sự tập hợp (samūha).
Mahāsamayoti hi bhikkhūnaṃ devatānañca mahāsannipātoti attho.
The meaning of Mahāsamaya is indeed a great gathering of bhikkhus and devas.
Thật vậy, đại hội (mahāsamaya) có nghĩa là sự tập hợp lớn của các tỳ khưu và chư thiên.
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati ‘bhaddāli nāma bhikkhu satthusāsane sikkhāya na paripūrakārī’ti, ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
In phrases like ‘‘Indeed, Bhaddāli, your opportunity was not penetrated; the Blessed One dwells in Sāvatthī; the Blessed One will know me: ‘The bhikkhu named Bhaddāli is not one who fulfills the training in the Teacher’s Dispensation.’ Indeed, Bhaddāli, this opportunity of yours was not penetrated,’’ the meaning is 'cause'.
Trong các câu như “Này Bhaddāli, nguyên nhân (samaya) đó ông đã không thâm nhập. Đức Thế Tôn đang trú tại Sāvatthī. Đức Thế Tôn sẽ biết về tôi rằng ‘Tỳ khưu tên Bhaddāli không hoàn thành việc học trong Giáo Pháp của Bậc Đạo Sư’. Này Bhaddāli, nguyên nhân (samaya) này ông cũng đã không thâm nhập” (Ma. Ni. 2.135), nghĩa là nguyên nhân (hetu).
Sikkhāpadassa kāraṇañhi idha samayoti adhippetaṃ.
The cause of the training rule is intended here as samaya.
Ở đây, nguyên nhân của giới luật được hiểu là samaya.
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In phrases like ‘‘At that time, the wanderer Uggāhamāna, the son of Samaṇamuṇḍikā, was dwelling in the Mallikā’s park at Tindukācīra, in a single hall where doctrines were expounded,’’ the meaning is 'view'.
Trong các câu như “Vào thời điểm đó, du sĩ Uggāhamāna, con trai của Samaṇamuṇḍikā, đang trú tại khu vườn Mallikā, trong một hội trường duy nhất tại Tindukācīra, nơi các học thuyết (samayappavādaka) được trình bày” (Ma. Ni. 2.260), nghĩa là tà kiến (diṭṭhi).
Tattha hi nisinnā titthiyā attano attano diṭṭhisaṅkhātaṃ samayaṃ pavadantīti so paribbājakārāmo ‘‘samayappavādako’’ti vuccati.
There, the sectarians, sitting there, expound their respective views, which are called samaya, and so that wanderers’ park is called ‘‘Samayappavādaka’’.
Thật vậy, ở đó, các ngoại đạo ngồi và trình bày các học thuyết (samaya) được gọi là diṭṭhi của riêng họ; vì vậy, khu vườn của các du sĩ đó được gọi là “samayappavādaka” (nơi trình bày các học thuyết).
Ādīsu paṭilābho.
In phrases like these, the meaning is 'attainment'.
Trong các câu trên, nghĩa là sự thành tựu (paṭilābha).
Atthābhisamayāti hi atthassa adhigamāti attho.
Atthābhisamayāti means the attainment of benefit.
Thật vậy, Atthābhisamayā có nghĩa là sự đạt được ý nghĩa.
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.28) pahānaṃ.
In phrases like ‘‘By fully comprehending conceit, one has made an end of suffering,’’ it means abandoning.
Trong các câu như “Do đoạn trừ kiêu mạn một cách đúng đắn, đã chấm dứt khổ đau” (Ma. Ni. 1.28), nghĩa là sự đoạn trừ (pahāna).
Adhikaraṇaṃ samayaṃ vūpasamanaṃ apagamoti abhisamayo pahānaṃ.
Abhisamaya is cessation, appeasement, and departure; it is abandonment.
Sự đoạn trừ (pahāna) là sự giải quyết (adhikaraṇaṃ), sự chấm dứt (samayaṃ), sự làm dịu (vūpasamanaṃ), sự biến mất (apagamo), đó là abhisamaya.
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 2.8) paṭivedho.
In phrases like ‘‘The meaning of suffering is to be afflicted, to be conditioned, to be tormented, to be subject to change, to be comprehended,’’ it is penetration.
Trong các câu như “Dukkha có nghĩa là sự áp bức, sự hữu vi, sự thiêu đốt, sự biến đổi, sự thâm nhập” (Paṭi. Ma. 2.8), nghĩa là sự thâm nhập (paṭivedha).
Paṭivedhoti hi abhisametabbato abhisamayo, abhisamayova attho abhisamayaṭṭhoti pīḷanādīni abhisametabbabhāvena ekībhāvaṃ upanetvā vuttāni, abhisamayassa vā paṭivedhassa visayabhūto attho abhisamayaṭṭhoti tāneva tathā ekantena vuttāni.
Indeed, penetration is abhisamaya because it is to be thoroughly understood. The meaning of abhisamaya, or rather, abhisamayaṭṭha, is stated by bringing affliction and so on into unity as aspects to be thoroughly understood. Or, abhisamayaṭṭha is the meaning that is the object of abhisamaya or paṭivedha, and thus these very things are stated decisively.
Thật vậy, Paṭivedha là abhisamaya vì nó cần được thâm nhập. Abhisamaya có nghĩa là abhisamayaṭṭha. Sự áp bức, v.v., được nói đến bằng cách đưa chúng vào sự đồng nhất với trạng thái cần được thâm nhập. Hoặc, abhisamayaṭṭha là ý nghĩa là đối tượng của abhisamaya, tức là sự thâm nhập; do đó, chúng được nói đến một cách tuyệt đối như vậy.
Tattha pīḷanaṃ dukkhasaccassa taṃsamaṅgino hiṃsanaṃ avipphārikatākaraṇaṃ.
Therein, affliction for the Noble Truth of suffering is the tormenting of one who possesses it, making it unexpansible.
Trong đó, sự áp bức (pīḷanaṃ) là sự làm hại, sự không cho lan rộng của dukkha-sacca (Khổ Đế) đối với người có nó.
Santāpo dukkhadukkhatādivasena santappanaṃ paridahanaṃ.
Torment is the burning and consuming in the sense of suffering-as-suffering and so on.
Santāpa là sự thiêu đốt, sự nung nấu theo nghĩa khổ khổ (dukkha-dukkhata) v.v.
Ettha ca sahakārīkāraṇasannijjhaṃ sameti samavetīti samavāyo samayo.
Here, samaya means convergence, because it brings about the harmonious coming together of co-operative causes.
Ở đây, samavāya (sự hội tụ) là samaya vì nó hội tụ, tụ họp (sameti samaveti) các nguyên nhân hỗ trợ.
Sameti samāgacchati ettha maggabrahmacariyaṃ tadādhārapuggalehīti khaṇo samayo.
Samaya means moment, because at this moment the noble practice of the path comes together through the individuals who are its foundation.
Khaṇa (khoảnh khắc) là samaya vì đời sống Phạm hạnh của con đường (maggabrahmacariyaṃ) hội tụ, đến (sameti samāgacchati) ở đây với những người là nền tảng của nó.
Sameti ettha etena vā saṃgacchati satto sabhāvadhammo vā uppādādīhi sahajātādīhi vāti kālo samayo.
Samaya means time, because at this time or by this time, a being or a natural phenomenon comes into being through origination, co-arising, and so on.
Kāla (thời gian) là samaya vì chúng sanh hoặc pháp tự tánh hội tụ, tương ứng (sameti saṃgacchati) ở đây hoặc bởi thời gian này với sự sinh khởi, v.v., hoặc với sự đồng sinh, v.v.
Dhammappavattimattatāya atthato abhūtopi hi kālo dhammappavattiyā adhikaraṇaṃ karaṇaṃ viya ca kappanāmattasiddhenānurūpena voharīyatīti.
Indeed, time, though unreal in ultimate truth as merely the occurrence of phenomena, is conventionally spoken of as an appropriate basis or instrument for the occurrence of phenomena, merely by conceptualization.
Mặc dù thời gian không thực sự tồn tại theo nghĩa của sự vận hành của các pháp, nhưng nó được gọi theo một cách thích hợp, được tạo ra bởi sự giả định, như thể nó là một nền tảng hoặc một công cụ cho sự vận hành của các pháp.
Samaṃ, saha vā avayavānaṃ ayanaṃ pavatti avaṭṭhānanti samūho samayo yathā samudāyoti.
Samaya means collection, as in samudaya, because it is the equal or combined coming together, the occurrence, the establishment of parts.
Samūha (sự tập hợp) là samaya, giống như samudāya (tập hợp), vì nó là sự vận hành (ayanaṃ pavatti) hay sự tồn tại (avaṭṭhānaṃ) của các bộ phận một cách hài hòa (samaṃ) hoặc cùng nhau (saha).
Avayavasahāvaṭṭhānameva hi samūho.
Indeed, a collection is nothing but the concurrent establishment of its parts.
Thật vậy, samūha là sự tồn tại cùng nhau của các bộ phận.
Avasesapaccayānaṃ samāgame sati eti phalametasmā uppajjati pavattatīti samayo hetu yathā samudayoti.
Samaya means cause, as in samudaya, because when there is a coming together of other conditions, the result proceeds from it, arises, and occurs.
Hetu (nguyên nhân) là samaya, giống như samudaya (nguyên nhân), vì khi các duyên còn lại hội tụ (samāgame sati), kết quả sinh khởi, vận hành từ đó (eti phalametasmā uppajjati pavattati).
Sameti saṃyojanabhāvato sambandho eti attano visaye pavattati, daḷhaggahaṇabhāvato vā saṃyuttā ayanti pavattanti sattā yathābhinivesaṃ etenāti samayo diṭṭhi.
Samaya means wrong view, because it connects as a fetter and proceeds within its own domain, or because beings, bound by firm grasping, proceed according to their inclination through it.
Diṭṭhi (tà kiến) là samaya, vì nó là sự ràng buộc (saṃyojanabhāvato sambandho) và vận hành trong lãnh vực của nó (eti attano visaye pavattati), hoặc vì chúng sanh bị ràng buộc (saṃyuttā ayanti pavattanti sattā) và vận hành theo sự chấp trước của họ bởi nó (etenāti) do sự nắm giữ vững chắc (daḷhaggahaṇabhāvato).
Diṭṭhisaṃyojanena hi sattā ativiya bajjhantīti.
Indeed, beings are excessively bound by the fetter of wrong view.
Thật vậy, chúng sanh bị trói buộc rất chặt bởi sự ràng buộc của tà kiến.
Samiti saṅgati samodhānanti samayo paṭilābho.
Samaya means acquisition, because it is conjunction and aggregation.
Paṭilābha (sự thành tựu) là samaya vì nó là sự đạt được (samiti saṅgati), sự hội tụ (samodhānaṃ).
Samayanaṃ upasamayanaṃ apagamoti samayo pahānaṃ.
Samaya means abandonment, because it is appeasement, calming, and departure.
Pahāna (sự đoạn trừ) là samaya vì nó là sự làm dịu (samayanaṃ upasamayanaṃ), sự biến mất (apagamo).
Samucchedappahānabhāvato pana adhiko samayoti abhisamayo yathā abhidhammoti.
However, because it is abandonment by cutting off, it is a superior samaya, thus abhisamaya, just as in abhidhamma.
Tuy nhiên, abhisamaya là samaya vượt trội hơn (adhiko samayo) vì nó là sự đoạn trừ tận gốc (samucchedappahānabhāvato), giống như Abhidhamma.
Abhimukhaṃ ñāṇena sammā etabbo abhisametabboti abhisamayo, dhammānaṃ aviparītasabhāvo.
Abhisamaya is that which is to be thoroughly understood, to be truly attained by knowledge directly, meaning the unperverted nature of phenomena.
Abhisamaya là sự thật không sai lệch của các pháp, vì nó phải được nhận thức (etabbo abhisametabbo) một cách đúng đắn bằng trí tuệ (ñāṇena sammā) đối diện (abhimukhaṃ).
Abhimukhabhāvena sammā eti gacchati bujjhatīti abhisamayo, dhammānaṃ yathābhūtasabhāvāvabodho.
Abhisamaya is that which truly comprehends, understands by knowledge in a direct manner, meaning the comprehension of the true nature of phenomena.
Abhisamaya là sự thấu hiểu bản chất thực sự của các pháp, vì nó đi đến (eti gacchati), hiểu biết (bujjhati) một cách đúng đắn (sammā) bằng cách đối diện (abhimukhabhāvena).
Evaṃ tasmiṃ tasmiṃ atthe samayasaddassa pavatti veditabbā.
Thus, the various applications of the word ‘samaya’ in these different meanings should be understood.
Như vậy, sự vận dụng của từ samaya trong từng ý nghĩa đó cần được hiểu.
Samayasaddassa atthuddhāre abhisamayasaddassa gahaṇe kāraṇaṃ vuttanayeneva veditabbaṃ.
The reason for including the word ‘abhisamaya’ in the explanation of the meaning of ‘samaya’ should be understood in the manner already stated.
Lý do để dùng từ abhisamaya khi giải thích ý nghĩa của từ samaya cần được hiểu theo cách đã nói.
Idha panassa kālo attho samavāyādīnaṃ asambhavato.
But here, its meaning is time, because co-existence and the like are not possible.
Tuy nhiên, ở đây, nghĩa của nó là thời gian (kāla) vì các nghĩa như sự hội tụ (samavāya) không thể xảy ra.
Desadesakaparisā viya hi desanāya nidānabhāve kālo eva icchitabboti.
For here, it is desired that the meaning be time, due to the sermon serving as an introduction, just like a local audience.
Thật vậy, thời gian là điều mong muốn như là khởi điểm của bài giảng, giống như hội chúng của người thuyết giảng.
Yasmā panettha samayoti kālo adhippeto, tasmā saṃvaccharautumāsaddhamāsarattidivasapubbaṇhamajjhanhikasāyanhapaṭhamayāma- majjhimayāmapacchimayāmamuhuttādīsu kālabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Since ‘samaya’ here is intended to mean time, it indicates one time among the various divisions of time, such as years, seasons, months, fortnights, nights, days, forenoons, noons, afternoons, first watches, middle watches, last watches, and muhuttas.
Vì ở đây, samaya được hiểu là thời gian, nên nó chỉ ra một thời điểm (ekaṃ samayaṃ) trong số các loại thời gian khác nhau như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, giữa trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Kasmā panettha aniyamitavaseneva kālo niddiṭṭho, na utusaṃvaccharādivasena niyametvā niddiṭṭhoti ce?
If it is asked why time is indicated here in an unspecified manner, and not specified in terms of seasons, years, and so on?
Nếu hỏi tại sao ở đây thời gian được chỉ định một cách không xác định, mà không xác định rõ ràng theo mùa, năm, v.v.?
Kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbampi taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Although the Elder knew and had thoroughly established through wisdom all the suttas—which sutta was uttered in which year, season, month, fortnight, night part, or day part among these times like years and so on—
Mặc dù tất cả các bài kinh được thuyết giảng vào năm nào, mùa nào, tháng nào, nửa tháng nào, phần đêm nào hay phần ngày nào trong các thời điểm như năm, v.v., đều được vị Trưởng lão biết rõ và sắp xếp rõ ràng bằng trí tuệ.
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
yet, if it were stated as ‘‘Thus have I heard, in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a night part, or in such and such a day part,’’ it would not be easy to remember, recite, or cause to be recited, and much would have to be said; therefore, combining that meaning into a single word, it is said, ‘‘Ekaṃ samayaṃ’’ (at one time).
Tuy nhiên, vì nếu nói rằng: “Tôi đã nghe điều này vào năm này, mùa này, tháng này, tuần trăng này, phần đêm này, hoặc phần ngày này,” thì không thể dễ dàng ghi nhớ, hoặc giảng dạy, hoặc khiến người khác giảng dạy, và sẽ có nhiều điều phải nói; do đó, sau khi gom ý nghĩa đó vào một từ duy nhất, Ngài đã nói: “Một thời” (ekaṃ samayaṃ).
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya pakāsā anekakālappabhedā eva samayā, tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Or, among the many divisions of time that were extremely prominent for the Blessed One among gods and humans—such as the time of conception, the time of birth, the time of profound emotion, the time of renunciation, the time of arduous practice, the time of Māra’s defeat, the time of full enlightenment, the time of dwelling in the bliss of this very life, the time of teaching, and the time of parinibbāna—it indicates one time, that is, the time of teaching.
Hoặc, trong số những thời điểm như thời điểm nhập thai, thời điểm đản sinh, thời điểm khởi phát sự giác ngộ (saṃvega), thời điểm xuất gia, thời điểm thực hành khổ hạnh, thời điểm chiến thắng Ma vương, thời điểm chứng đắc Chánh Đẳng Giác, thời điểm an trú trong lạc trú hiện tại, thời điểm thuyết pháp, thời điểm nhập Niết Bàn Vô Dư, v.v., những thời điểm nổi bật đặc biệt của Đức Thế Tôn đối với chư thiên và loài người, là những phân loại thời gian đa dạng, Ngài chỉ ra rằng “một thời” là thời điểm thuyết pháp.
Yo vāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitappaṭipattisamayesu parahitappaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammakathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesu samayesu aññatarasamayaṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
Or, regarding the time of the task of compassion among the times of the tasks of knowledge and compassion; regarding the time of practice for others’ welfare among the times of practice for one’s own welfare and others’ welfare; regarding the time of Dhamma talk among the times of two duties for those assembled; regarding the time of teaching among the times of teaching and practice—referring to one of these times, it is said, ‘‘Ekaṃ samayaṃ’’ (at one time).
Hoặc, trong số các thời điểm thực hiện trí tuệ và lòng bi mẫn, đó là thời điểm thực hiện lòng bi mẫn; trong số các thời điểm thực hành lợi ích cho bản thân và lợi ích cho người khác, đó là thời điểm thực hành lợi ích cho người khác; trong số hai thời điểm cần thiết cho những người đã tụ hội, đó là thời điểm thuyết pháp; trong số các thời điểm thuyết pháp và thực hành, đó là thời điểm thuyết pháp. Ngài nói “một thời” để chỉ một trong những thời điểm đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hotī’’ti (dha. sa. 1) ca ito aññesu suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehi vivicca akusalehi dhammehī’’ti (a. ni. 4.200) ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti (pārā. 1) karaṇavacanena niddeso kato, tathā akatvā ‘‘ekaṃ samaya’’nti accantasaṃyogatthe upayogavacanena niddeso katoti?
Why is it that here, in contrast to the Abhidhamma where it is stated in the locative case, ‘‘At which time a kāmāvacara wholesome consciousness arises’’ and in other suttas, ‘‘At which time, monks, a bhikkhu is detached from sensual pleasures, detached from unwholesome states,’’ and in the Vinaya where it is stated in the instrumental case, ‘‘At that time the Buddha, the Blessed One,’’ it is not done likewise, but rather stated in the accusative case, ‘‘ekaṃ samayaṃ,’’ indicating unbroken connection?
Tại sao ở đây, không giống như trong Abhidhamma, nơi có sự trình bày bằng cách sử dụng cách thức định vị (bhumma-vacana) như “Vào thời điểm nào, một tâm thiện dục giới sinh khởi?” và trong các đoạn kinh khác như “Này các Tỳ-khưu, vào thời điểm nào, một Tỳ-khưu hoàn toàn ly dục, ly ác pháp?”, và trong Luật tạng, nơi có sự trình bày bằng cách sử dụng cách thức công cụ (karaṇa-vacana) như “Vào thời điểm đó, Đức Phật, Thế Tôn,” mà lại trình bày bằng cách sử dụng cách thức đối cách (upayoga-vacana) “một thời” (ekaṃ samayaṃ) với ý nghĩa liên tục tuyệt đối?
Tattha tathā, idha ca aññathā atthasambhavato.
Because the meaning is possible in that way there, and in a different way here.
Ở đó là như vậy, còn ở đây là khác, vì ý nghĩa có thể xảy ra khác nhau.
Tattha hi abhidhamme ito aññesu ca suttantesu ādhāravisayasaṅkhāto adhikaraṇattho kiriyāya kiriyantaralakkhaṇasaṅkhāto bhāvenabhāvalakkhaṇattho ca sambhavatīti.
For in the Abhidhamma and other suttas, the locative meaning, which refers to the basis or sphere, and the meaning of indicating one action by another action (bhāvena bhāvalakkhaṇa), are possible.
Trong Abhidhamma và các kinh điển khác, ý nghĩa vị trí (adhikaraṇa-attha) dưới dạng đối tượng nền tảng và ý nghĩa biểu thị sự kiện (bhāvenabhāvalakkhaṇa-attha) dưới dạng sự kiện này biểu thị sự kiện khác đều có thể xảy ra.
Adhikaraṇañhi kālattho samūhattho ca samayo tattha vuttānaṃ phassādidhammānaṃ, tathā kālo sabhāvadhammappavattimattatāya paramatthato avijjamānopi ādhārabhāvena paññāto taṅkhaṇappavattānaṃ tato pubbe parato ca abhāvato yathā ‘‘pubbaṇhe jāto sāyanhe jāto’’tiādīsu.
For samaya, in the sense of time and in the sense of collection, is the basis of the phenomena like contact mentioned there. Similarly, time, though not ultimately existing as merely the occurrence of natural phenomena, is designated as a basis for phenomena occurring at that very moment, as they do not exist before or after that moment, just as in phrases like ‘‘born in the forenoon, born in the afternoon.’’
Thời gian (kāla) và tập hợp (samūha) là đối tượng nền tảng (adhikaraṇa) cho các pháp xúc (phassa) v.v. được đề cập ở đó. Tương tự, thời gian, mặc dù không tồn tại trên thực tế như một bản chất tự thân của các pháp, nhưng được nhận thức như một nền tảng cho sự tồn tại của các pháp trong khoảnh khắc đó, vì chúng không tồn tại trước hoặc sau khoảnh khắc đó, như trong các câu “sinh vào buổi sáng, sinh vào buổi tối,” v.v.
Samūhotipi avayavavinimutto paramatthato avijjamānopi kappanāmattasiddhena rūpena avayavānaṃ ādhārabhāvena paññāpīyati, yathā ‘‘rukkhe sākhā, yavo yavarāsimhi samuṭṭhito’’tiādīsu.
A collection, too, though not ultimately existing apart from its parts, is designated as a basis for the parts through a form that is established merely by conceptualization, just as in phrases like ‘‘branches on a tree,’’ ‘‘barley sprung from a heap of barley.’’
Tập hợp, mặc dù không tồn tại trên thực tế tách rời khỏi các thành phần, nhưng được nhận thức như một nền tảng cho các thành phần thông qua một hình thức chỉ tồn tại trong khái niệm, như trong các câu “cành cây trên cây, lúa mạch mọc từ đống lúa mạch,” v.v.
Yasmiṃ kāle dhammapuñje ca kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃyeva kāle dhammapuñje ca phassādayopi hontīti ayañhi tattha attho.
For the meaning here is that at the time and in the collection of phenomena when a kāmāvacara wholesome consciousness arises, at that very time and in that very collection of phenomena, contact and other states also exist.
Vì vậy, ý nghĩa ở đây là: vào thời điểm và trong tập hợp các pháp mà một tâm thiện dục giới sinh khởi, thì các pháp xúc v.v. cũng tồn tại vào chính thời điểm và trong chính tập hợp các pháp đó.
Tathā khaṇasamavāyahetusaṅkhātassa samayassa bhāvena tattha vuttānaṃ phassādidhammānaṃ bhāvo lakkhīyati.
Similarly, the existence of phenomena like contact mentioned there is indicated by the existence of samaya as a moment, conjunction (samavāya), and cause.
Tương tự, sự tồn tại của các pháp xúc v.v. được đề cập ở đó được biểu thị bằng sự tồn tại của thời điểm (samaya) dưới dạng khoảnh khắc, sự kết hợp (samavāya) và nguyên nhân (hetu).
Yathā hi ‘‘gāvīsu duyhamānāsu gato, duddhāsu āgato’’ti ettha gāvīnaṃ dohanakiriyāya gamanakiriyā lakkhīyati, evaṃ idhāpi yasmiṃ samayeti vutte ca padatthassa sattāvirahābhāvato satīti ayamattho viññāyamāno eva hotīti samayassa sattākiriyāya cittassa uppādakiriyā phassādīnaṃ bhavanakiriyā ca lakkhīyati.
Just as in the example, ‘‘He went while the cows were being milked; he came when they had been milked,’’ the act of going is indicated by the act of milking the cows, so too here, when ‘‘yasmiṃ samaye’’ is said, and since there is no absence of the existence of the meaning of the word, this meaning, ‘‘sati’’ (being present), is indeed understood. Thus, the arising of consciousness and the occurrence of contact (phassa) and so forth are indicated by the existence of the occasion (samaya).
Giống như trong câu “đi khi bò đang vắt sữa, đến khi bò đã vắt sữa,” hành động đi được biểu thị bằng hành động vắt sữa của bò, thì ở đây cũng vậy, khi nói “vào thời điểm nào” (yasmiṃ samaye), ý nghĩa rằng “có” (sati) là hiển nhiên, vì không có sự vắng mặt của thực thể của từ đó. Do đó, hành động sinh khởi của tâm và hành động tồn tại của xúc v.v. được biểu thị bằng hành động tồn tại của thời điểm.
Tathā yasmiṃ samaye yasmiṃ navame khaṇe yasmiṃ yonisomanasikārādihetumhi paccayasamavāye vā sati kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃ samaye khaṇe hetumhi paccayasamavāye ca phassādayopi hontīti.
Similarly, at whichever occasion, at whichever ninth moment, due to whichever cause such as proper attention (yonisomanasikāra), or when there is a concurrence of conditions, a kāmāvacara wholesome consciousness arises, at that very occasion, moment, cause, and concurrence of conditions, contact (phassa) and so forth also exist.
Tương tự, vào thời điểm nào, vào khoảnh khắc thứ chín nào, khi có nguyên nhân như tác ý đúng đắn (yonisomanasikāra) hoặc sự kết hợp các duyên nào, một tâm thiện dục giới sinh khởi, thì các pháp xúc v.v. cũng tồn tại vào chính thời điểm, khoảnh khắc, nguyên nhân và sự kết hợp các duyên đó.
Tasmā tadatthajotanatthaṃ bhummavacanena niddeso kato.
Therefore, to illuminate that meaning, the designation is made with the locative case.
Do đó, để làm rõ ý nghĩa đó, sự trình bày được thực hiện bằng cách thức định vị.
Vinaye ca ‘‘annena vasati, ajjhenena vasatī’’tiādīsu viya hetuattho, ‘‘pharasunā chindati, kudālena khaṇatī’’tiādīsu viya karaṇattho ca sambhavati.
In the Vinaya, the meaning of cause, as in ‘‘He dwells by food, he dwells by study,’’ and the meaning of instrument, as in ‘‘He cuts with an axe, he digs with a spade,’’ are both possible.
Trong Luật tạng, ý nghĩa nguyên nhân (hetu-attha) có thể xảy ra, như trong “sống nhờ thức ăn, sống nhờ sự học hỏi,” v.v., và ý nghĩa công cụ (karaṇa-attha) có thể xảy ra, như trong “chặt bằng rìu, đào bằng cuốc,” v.v.
Yo hi sikkhāpadapaññattisamayo dhammasenāpatiādīhipi dubbiññeyyo, tena samayena karaṇabhūtena hetubhūtena ca vītikkamaṃ sutvā bhikkhusaṅghaṃ sannipātāpetvā otiṇṇavatthukaṃ puggalaṃ paṭipucchitvā vigarahitvā ca taṃ taṃ vatthuṃ otiṇṇasamayasaṅkhātaṃ kālaṃ anatikkamitvā sikkhāpadāni paññāpento tatiyapārājikādīnaṃ viya sikkhāpadapaññattiyā hetuṃ apekkhamāno tattha tattha vihāsi, tasmā tadatthajotanatthaṃ vinaye karaṇavacanena niddeso kato.
Indeed, the occasion of the promulgation of a training rule (sikkhāpada) was difficult to understand even for the Dhamma-Commander (Dhammasenāpati) and others. At that time, acting as both instrument and cause, having heard of a transgression, having convened the Saṅgha of bhikkhus, having questioned the individual who had committed the offense, and having rebuked him, the Blessed One, without exceeding the time designated as the occasion of the offense, promulgated the training rules, looking to the cause for the promulgation of the training rules, as in the case of the third pārājika and so forth, and thus resided there. Therefore, to illuminate that meaning, the designation in the Vinaya is made with the instrumental case.
Thật vậy, thời điểm chế định giới luật, dù khó hiểu ngay cả đối với các vị như Pháp Tướng Quân (Dhammasenāpati), vào thời điểm đó, Đức Thế Tôn đã nghe về sự vi phạm, triệu tập Tăng đoàn, hỏi lại người đã phạm giới, quở trách họ, và không bỏ qua thời điểm phạm giới đó, Ngài đã chế định các giới luật, mong muốn nguyên nhân chế định giới luật như đối với các giới Pārājika thứ ba, v.v., và Ngài đã an trú ở đó. Do đó, để làm rõ ý nghĩa đó, trong Luật tạng, sự trình bày được thực hiện bằng cách thức công cụ.
Tattha seṭṭhavācakavacanaṃ seṭṭhanti vuttaṃ seṭṭhaguṇasahacaraṇato.
There, ‘‘seṭṭhaṃ’’ (supreme) is said to be a word denoting supremacy because it is associated with supreme qualities.
Ở đây, “seṭṭhaṃ” (tối thượng) được nói là “seṭṭha-vācaka-vacanaṃ” (từ chỉ sự tối thượng) vì nó đi kèm với các phẩm chất tối thượng.
Atha vā vuccatīti vacanaṃ, attho.
Alternatively, that which is spoken (vuccati) is a word (vacanaṃ), meaning a concept.
Hoặc, “vuccati” (được nói) là “vacanaṃ” (lời nói), tức là ý nghĩa.
Bhagavāti vacanaṃ seṭṭhanti bhagavāti iminā vacanena vacanīyo yo attho, so seṭṭhoti attho.
‘‘Bhagavāti vacanaṃ seṭṭhaṃ’’ means that the meaning denoted by this word Bhagavā is supreme.
Bhagavāti vacanaṃ seṭṭhaṃ (Lời Bhagavā là tối thượng) có nghĩa là ý nghĩa được chỉ ra bởi từ Bhagavā là tối thượng.
Bhagavāti vacanamuttamanti etthāpi vuttanayeneva attho veditabbo.
The meaning of ‘‘Bhagavāti vacanamuttamaṃ’’ should also be understood in the same way as explained.
Ở đây, ý nghĩa của Bhagavāti vacanamuttamaṃ (Lời Bhagavā là cao quý nhất) cũng phải được hiểu theo cách đã nói.
Gāravayuttoti garubhāvayutto garuguṇayogato visesagarukaraṇārahatāya vā gāravayutto.
Gāravayutto means endowed with reverence, due to being endowed with qualities worthy of respect, or due to being worthy of special veneration.
Gāravayutto (đầy lòng tôn kính) có nghĩa là đầy phẩm chất đáng kính do sự kết hợp của các phẩm chất đáng kính, hoặc đầy lòng tôn kính vì xứng đáng được tôn kính đặc biệt.
Evaṃ guṇavisiṭṭhasattuttamagarugāravādhivacanaṃ bhagavāti idaṃ vacananti veditabbaṃ.
Thus, the word Bhagavā is to be understood as a designation for one who is preeminent among beings in virtues, worthy of respect, and endowed with reverence.
Do đó, phải hiểu rằng từ Bhagavā này là một danh hiệu chỉ một chúng sinh có phẩm chất siêu việt, tối thượng, đáng kính và đầy lòng tôn kính.
Apica –
Furthermore:
Hơn nữa,
Apica bhāge vani, bhage vā vamīti bhagavā.
Furthermore, he who cultivated (vani) excellences (bhage), or he who vomited forth (vamī) excellences (bhage), is Bhagavā.
Hơn nữa, Bhagavā là người đã thực hành các phước đức (bhāge vani) hoặc đã từ bỏ các phước đức (bhage vā vamī).
Tathāgato hi dānasīlādipāramidhamme jhānavimokkhādiuttarimanussadhamme vani bhaji sevi bahulamakāsi, tasmā bhagavā.
Indeed, the Tathāgata practiced and cultivated the pāramī qualities such as generosity and morality, and the supramundane qualities (uttarimanussadhamma) such as jhāna and vimokkha, doing so extensively. Therefore, he is Bhagavā.
Thật vậy, Đức Như Lai đã thực hành, đã tu dưỡng, đã thực hiện nhiều lần các pháp Ba-la-mật như bố thí, trì giới, v.v., và các pháp siêu nhân (uttarimanussadhamma) như thiền định, giải thoát, v.v. Do đó, Ngài là Bhagavā.
Atha vā teyeva ‘‘veneyyasattasantānesu kathaṃ nu kho uppajjeyyu’’nti vani abhipatthayīti bhagavā.
Or else, he desired (abhīpatthayī) that these very qualities should arise in the minds of beings capable of being trained (veneyyasatta). Thus, he is Bhagavā.
Hoặc, Ngài là Bhagavā vì Ngài đã mong muốn rằng những pháp đó sẽ sinh khởi trong tâm của các chúng sinh cần được giáo hóa (veneyyasattasantāna).
Atha vā bhagasaṅkhātaṃ issariyaṃ yasañca vami uggiri kheḷapiṇḍaṃ viya anapekkho chaḍḍayīti bhagavā.
Or else, he vomited forth (vamī uggiri) sovereignty (issariya) and fame (yasa), which are called bhaga, abandoning them without attachment, like a lump of spittle. Thus, he is Bhagavā.
Hoặc, Ngài là Bhagavā vì Ngài đã từ bỏ quyền uy (issariya) và danh tiếng (yasa) được gọi là phước đức (bhaga), như nhổ bỏ một cục đờm mà không chút tiếc nuối.
Tathā hi tathāgato hatthagataṃ cakkavattisiriṃ devalokādhipaccasadisaṃ cātuddīpissariyaṃ, cakkavattisampattisannissayañca sattaratanasamujjalaṃ yasaṃ tiṇāyapi amaññamāno nirapekkho pahāya abhinikkhamitvā sammāsambodhiṃ abhisambuddho, tasmā ime siriādike bhage vamīti bhagavā.
For instance, the Tathāgata, not considering the glory of a universal monarch (cakkavattisiri) that had come into his hands—sovereignty over the four continents, comparable to dominion in the deva realms, and the fame resplendent with the seven jewels, which is the foundation of a universal monarch's prosperity—as even a blade of grass, abandoned it without attachment, went forth, and attained Perfect Self-Awakening. Therefore, he vomited forth these bhaga such as glory, and thus he is Bhagavā.
Như vậy, Đức Như Lai đã từ bỏ vô tư lự sự vinh quang của Chuyển Luân Vương đã nằm trong tay Ngài, sự thống trị bốn châu lục giống như quyền cai trị cõi trời, cùng với danh tiếng rực rỡ nhờ bảy báu, vốn là nền tảng của sự phú quý Chuyển Luân Vương, coi chúng như cỏ rác, rồi xuất gia và chứng đắc Chánh Đẳng Giác. Do đó, Ngài đã từ bỏ những phúc báu như vinh quang ấy, nên Ngài là Bhagavā (Thế Tôn).
Atha vā bhāni nāma nakkhattāni, tehi samaṃ gacchanti pavattantīti bhagā.
Or else, bhāni are called constellations (nakkhattāni); they proceed (gacchanti) or occur (pavattanti) in conjunction with these. Therefore, they are bhagā.
Hoặc nữa, "Bhāni" là các vì sao (nakkhattāni). Chúng vận hành đồng bộ với nhau, nên gọi là "Bhagā".
Sineruyugandharauttarakuruhimavantādibhājanalokavisesasannissayasobhā kappaṭṭhitibhāvato, tepi bhage vami, tannivāsisattāvāsasamatikkamanato tappaṭibaddhachandarāgappahānena pajahīti.
The splendor of the special receptacle-worlds (bhājanaloka) such as Sineru, Yugandhara, Uttarakuru, and Himavanta, due to their enduring for an eon (kappaṭṭhiti), and these bhaga he also vomited forth; he abandoned them by transcending the abodes of the beings dwelling therein and by relinquishing the desire and lust associated with them.
Núi Sineru, Yugandhara, châu Bắc Cưu Lư, dãy Himalaya và các thế giới vật chất đặc biệt khác có vẻ đẹp dựa trên sự tồn tại lâu dài theo kiếp, Ngài cũng đã từ bỏ những "Bhaga" ấy, vượt qua sự trú ngụ của chúng sinh trong đó và đoạn trừ tham ái chấp trước vào chúng.
Evampi bhage vamīti bhagavāti evamādinā nayena bhagavāti padassa attho veditabbo.
In this way, the meaning of the word Bhagavā, as one who vomited forth bhaga, and so on, should be understood.
Theo cách này, ý nghĩa của từ Bhagavā – tức là Ngài đã từ bỏ các "Bhaga" – cần được hiểu.
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ savanavasena bhāsanto bhagavato dhammasarīraṃ paccakkhaṃ karoti, tena ‘‘nayidaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
By the statement "Thus have I heard" (Evaṃ me sutaṃ) in this context, the venerable Ānanda, by speaking the Dhamma as he heard it, makes the Dhamma-body of the Bhagavā manifest. Thereby, he reassures those who are distressed by the absence of the Teacher, saying, "This teaching is not without a Teacher who has passed away; this is your Teacher."
Cho đến đây, với lời nói “ Evaṃ me sutaṃ” (Như vầy tôi nghe), Tôn giả Ānanda, người thuyết giảng Pháp như đã nghe, đã làm cho Pháp thân của Đức Thế Tôn hiển hiện. Nhờ đó, Ngài an ủi những người đang buồn rầu vì không thấy Đức Bổn Sư, rằng: “Pháp này không phải là một giáo pháp không có Bổn Sư đã qua đời; đây là Bổn Sư của quý vị”.
Vuttañhetaṃ bhagavatā ‘‘yo kho, ānanda, mayā dhammo ca vinayo ca desito paññatto, so vo mamaccayena satthā’’ti (dī. ni. 2.216; mi. pa. 4.1.1).
For it was said by the Bhagavā: "The Dhamma and Vinaya, Ānanda, that I have taught and laid down, that shall be your Teacher after my passing."
Quả thật, Đức Thế Tôn đã dạy: “Này Ānanda, Pháp và Luật do Ta đã thuyết giảng và chế định, sau khi Ta diệt độ, Pháp và Luật ấy sẽ là Bổn Sư của các con”.
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti, tena ‘‘evaṃvidhassa nāma dhammassa desetā dasabaladharo vajirasaṅghātasamānakāyo sopi bhagavā parinibbuto, kenaññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
By the statement "At one time the Bhagavā" (Ekaṃ samayaṃ Bhagavā), by showing the Bhagavā's non-existence at that time, he establishes the parinibbāna of the rūpakāya. Thereby, he inspires a sense of urgency in those who are intoxicated by the conceit of life, making them reflect: "Even such a teacher of the Dhamma, endowed with the ten powers, whose body was like a vajira-mass, that Bhagavā too attained parinibbāna; by whom else should hope for life be generated?" And he generates enthusiasm for the Saddhamma in them.
Với lời nói “ Ekaṃ samayaṃ Bhagavā” (Một thời nọ, Đức Thế Tôn), Tôn giả Ānanda đã làm hiển lộ sự diệt độ của sắc thân, cho thấy sự không tồn tại của Đức Thế Tôn vào thời điểm đó. Nhờ đó, Ngài đánh thức những người say đắm vào sự sống, rằng: “Một vị Bổn Sư như vậy, người thuyết giảng Pháp như vậy, người mang mười lực, với thân thể vững chắc như kim cương, Ngài cũng đã nhập Niết Bàn; ai khác có thể hy vọng vào sự sống nữa?” Và Ngài cũng khơi dậy sự tinh tấn trong Chánh Pháp nơi họ.
Evanti ca bhaṇanto desanāsampattiṃ niddisati, vakkhamānassa sakalasuttassa evanti nidassanato.
And by saying "Thus" (Evaṃ), he indicates the perfection of the teaching, because the entire Sutta to be expounded is indicated by "Thus."
Và khi nói “ Evaṃ” (Như vầy), Tôn giả Ānanda chỉ ra sự viên mãn của lời dạy, bởi vì toàn bộ bài kinh sắp được nói đều được chỉ dẫn bằng từ “Evaṃ”.
Me sutanti sāvakasampattiṃ savanasampattiñca niddisati, paṭisambhidāpattena pañcasu ṭhānesu bhagavatā etadagge ṭhapitena dhammabhaṇḍāgārikena sutabhāvadīpanato ‘‘tañca kho mayāva sutaṃ, na anussutikaṃ, na paramparābhata’’nti imassa catthassa dīpanato.
By "I have heard" (Me sutaṃ), he indicates the perfection of the disciple and the perfection of hearing, because it shows that it was heard by the treasurer of the Dhamma, who had attained the paṭisambhidā and was declared by the Bhagavā as foremost in five respects, and because it demonstrates the meaning that "this was heard by me myself, not by hearsay, nor transmitted through a lineage."
Khi nói “ Me sutaṃ” (tôi nghe), Tôn giả Ānanda chỉ ra sự viên mãn của thính chúng và sự viên mãn của việc nghe, bởi vì Tôn giả Ānanda, người đã đạt được Tứ Tuệ Phân Tích (paṭisambhidā) và được Đức Thế Tôn đặt vào vị trí đệ nhất trong năm phương diện, người nắm giữ kho tàng Pháp (Dhammabhaṇḍāgārika), đã xác nhận rằng mình đã nghe Pháp, và để làm rõ ý nghĩa rằng: “Pháp ấy tôi đã tự mình nghe, không phải nghe lại từ người khác, cũng không phải được truyền thừa từ đời này sang đời khác”.
Ekaṃ samayanti kālasampattiṃ niddisati bhagavato uruvelāyaṃ viharaṇasamayabhāvena buddhuppādappaṭimaṇḍitabhāvadīpanato.
The term “at one time” indicates the fulfillment of time, as it reveals the adornment of the time of the Buddha's arising, which was when the Blessed One was dwelling in Uruvelā.
Khi nói “ Ekaṃ samayaṃ” (Một thời nọ), Tôn giả Ānanda chỉ ra sự viên mãn của thời gian, bởi vì nó làm hiển lộ thời gian Đức Thế Tôn trú ngụ tại Uruvelā, được tô điểm bằng sự xuất hiện của một vị Phật.
Buddhuppādaparamā hi kālasampadā.
Indeed, the supreme fulfillment of time is the arising of the Buddha.
Quả thật, sự xuất hiện của một vị Phật là sự viên mãn tối thượng của thời gian.
Bhagavāti desakasampattiṃ niddisati guṇavisiṭṭhasattuttamagarubhāvadīpanato.
The term “the Blessed One” indicates the fulfillment of the teacher, as it reveals his supreme and venerable status among beings, distinguished by virtue.
Khi nói “ Bhagavā” (Đức Thế Tôn), Tôn giả Ānanda chỉ ra sự viên mãn của người thuyết giảng, bởi vì nó làm hiển lộ vị Thầy tối thượng, cao quý nhất trong các chúng sinh, với những phẩm chất siêu việt.
Atīte kira anuppanne buddhe dasasahassatāpasā tasmiṃ padese viharantā ‘‘kāyakammavacīkammāni paresampi pākaṭāni honti, manokammaṃ pana apākaṭaṃ.
It is said that in the past, before the Buddha arose, ten thousand ascetics dwelt in that region, and they made an agreement: ‘‘Bodily and verbal actions are evident to others, but mental actions are not evident.
Xưa kia, khi chưa có Phật xuất hiện, mười ngàn vị đạo sĩ trú ngụ tại nơi đó đã lập lời thề ước rằng: “Hành động thân và hành động lời của người khác thì hiển lộ, nhưng hành động ý thì không hiển lộ.
Tasmā yo micchāvitakkaṃ vitakketi, so attanāva attānaṃ codetvā pattapuṭena vālukaṃ āharitvā imasmiṃ ṭhāne ākiratu, idamassa daṇḍakamma’’nti katikavattaṃ katvā tato paṭṭhāya yo tādisaṃ vitakkaṃ vitakketi, so tattha pattapuṭena vālukaṃ āharitvā ākirati.
Therefore, whoever entertains a wrong thought should, by himself, censure himself and bring sand in a leaf-cup to scatter it in this place; this shall be his punishment.’’ From that time onward, whoever entertained such a thought would bring sand in a leaf-cup and scatter it there.
Do đó, ai có tà tư duy thì tự mình khiển trách mình, rồi dùng lá cây làm chén mang cát đến rải ở chỗ này; đây là hình phạt cho người đó”. Kể từ đó, ai có tà tư duy như vậy thì mang cát đến rải ở đó bằng chén lá.
Evaṃ tattha anukkamena mahāvālukārāsi jāto, tato naṃ pacchimā janatā parikkhipitvā cetiyaṭṭhānamakāsi.
Thus, in due course, a great heap of sand formed there, and later generations surrounded it and made it a shrine.
Cứ thế, dần dần một đống cát lớn hình thành ở đó, và sau này người dân đã vây quanh nó, biến nó thành một nơi thờ cúng.
Taṃ sandhāya vuttaṃ – ‘‘uruvelāyanti mahāvelāyaṃ, mahante vālukārāsimhīti attho daṭṭhabbo’’ti.
It is with reference to this that it was said, ‘‘‘Uruvelā’ means a great sand-bank; that is, in a large heap of sand, this meaning should be understood.’’
Liên quan đến điều đó, người ta đã nói: “Uruvelāyaṃ có nghĩa là ở Mahāvelā, tức là ở một đống cát lớn, ý nghĩa cần được hiểu như vậy”.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgitāparidīpanaṃ.
The term “dwells” generally indicates being endowed with one of the postures (
“ Viharatī” (trú ngụ) là sự chỉ rõ sự đầy đủ của một trong các tư thế oai nghi, các trú xứ Phạm thiên, hoặc các trú xứ Thánh, một cách không phân biệt.
Idha pana ṭhānanisajjāgamanasayanappabhedesu iriyāpathesu āsanasaṅkhātairiyāpathasamāyogaparidīpanaṃ ariyavihārasamaṅgitāparidīpanañcāti veditabbaṃ.
However, here it should be understood as indicating being endowed with the posture called sitting among the postures of standing, sitting, walking, and lying down, and also indicating being endowed with the noble abodes.
Tuy nhiên, ở đây cần hiểu rằng nó chỉ sự kết hợp với tư thế ngồi trong số các tư thế oai nghi như đứng, ngồi, đi, nằm, và cũng chỉ sự đầy đủ của trú xứ Thánh.
Tattha yasmā ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā viharatīti padassa iriyāpathavihāravasenettha attho veditabbo.
Among these, since one overcomes the discomfort of one posture with another posture, thereby sustaining and maintaining one’s existence without collapsing, the meaning of the word
Trong đó, bởi vì Đức Thế Tôn đã chấm dứt sự khó chịu của một tư thế oai nghi bằng một tư thế oai nghi khác, và duy trì thân thể không bị suy sụp, nên ý nghĩa của từ “viharatī” ở đây cần được hiểu theo nghĩa trú xứ oai nghi.
Yasmā pana bhagavā dibbavihārādīhi sattānaṃ vividhaṃ hitaṃ harati upaharati upaneti uppādeti, tasmā tesampi vasena vividhaṃ haratīti evamattho veditabbo.
And since the Blessed One brings, offers, bestows, and produces various benefits for beings through divine abodes and so forth, the meaning should also be understood as bringing forth various benefits through these (divine abodes, etc.).
Và bởi vì Đức Thế Tôn mang lại, cung cấp, dẫn dắt, và tạo ra nhiều lợi ích khác nhau cho chúng sinh bằng các trú xứ thiên thượng (dibbavihāra) và các trú xứ khác, nên ý nghĩa cũng cần được hiểu là Ngài mang lại nhiều lợi ích khác nhau theo các trú xứ đó.
Najjāti nadati sandatīti nadī, tassā najjā, nadiyā ninnagāyāti attho.
Of the river:
“ Najjā” có nghĩa là con sông, tức là con sông chảy xiết, con sông có dòng nước.
Nerañjarāyāti nelaṃ jalamassāti ‘‘nelañjalāyā’’ti vattabbe lakārassa rakāraṃ katvā ‘‘nerañjarāyā’’ti vuttaṃ, kaddamasevālapaṇakādidosarahitasalilāyāti attho.
Nerañjarā: It should be said as
“ Nerañjarāyā” được nói là “Nerañjarāyā” thay vì “Nelañjalāyā” bằng cách đổi âm “l” thành “r”. Có nghĩa là con sông có dòng nước trong sạch, không có bùn, rong rêu, tảo và các tạp chất khác.
Keci ‘‘nīlajalāyāti vattabbe nerañjarāyāti vutta’’nti vadanti.
Some say that it is called Nerañjarā where it should be called Nīlajalā (having blue water).
Một số người nói rằng “Nerañjarāyā” được nói thay vì “Nīlajalāyā” (có nước xanh).
Nāmameva vā etaṃ etissā nadiyāti veditabbaṃ.
Or it should be understood that this is merely the name of that river.
Hoặc nữa, cần hiểu rằng đây chỉ là tên của con sông này.
Tassā nadiyā tīre yattha bhagavā vihāsi, taṃ dassetuṃ ‘‘bodhirukkhamūle’’ti vuttaṃ.
To show the bank of that river where the Blessed One dwelt, it is said, “at the foot of the Bodhi tree.”
Để chỉ nơi Đức Thế Tôn trú ngụ bên bờ sông ấy, người ta đã nói “ bodhirukkhamūle” (dưới cội cây Bồ đề).
Tattha ‘‘bodhi vuccati catūsu maggesu ñāṇa’’nti ettha (cūḷani. khaggavisāṇasuttaniddesa 121) maggañāṇaṃ bodhīti vuttaṃ.
There, the path-knowledge (
Trong đó, “Bodhi” được gọi là trí tuệ trong Tứ Đạo (catūsu maggesu ñāṇaṃ) – ở đây, trí tuệ Đạo (maggañāṇaṃ) được gọi là Bodhi.
‘‘Pappoti bodhiṃ varabhūrimedhaso’’ti ettha (dī. ni. 3.217) sabbaññutaññāṇaṃ.
And here, ‘‘He attains Bodhi, the supreme knowledge of great wisdom,’’ refers to omniscience (
Trong câu “Pappoti bodhiṃ varabhūrimedhaso” (Vị đại trí tuệ ấy đạt được Bodhi), nó được gọi là Nhất Thiết Trí (sabbaññutaññāṇaṃ).
Tadubhayampi bodhiṃ bhagavā ettha pattoti rukkhopi bodhirukkhotveva nāmaṃ labhi.
Since the Blessed One attained both these Bodhis here, the tree also received the name Bodhi tree.
Đức Thế Tôn đã đạt được cả hai loại Bodhi ấy tại nơi này, nên cây đó cũng được gọi là cây Bồ đề.
Atha vā satta bojjhaṅge bujjhīti bhagavā bodhi, tena bujjhantena sannissitattā so rukkhopi bodhirukkhoti nāmaṃ labhi, tassa bodhirukkhassa.
Alternatively, since the Blessed One comprehended the seven factors of enlightenment (
Hoặc nữa, Đức Thế Tôn được gọi là Bodhi (Đấng Giác Ngộ) vì Ngài đã giác ngộ Bảy Chi Giác (satta bojjhaṅge). Vì cây đó là nơi nương tựa của Ngài, nên cây đó cũng được gọi là cây Bồ đề. Của cội cây Bồ đề ấy.
Mūleti samīpe.
at the root means nearby.
“ Mūle” có nghĩa là gần bên.
Ayañhi mūlasaddo ‘‘mūlāni uddhareyya antamaso usīranāḷamattānipī’’tiādīsu (a. ni. 4.195) mūlamūle dissati.
This word
Từ “mūla” này được thấy trong nghĩa gốc rễ như trong câu “Mūlāni uddhareyya antamaso usīranāḷamattānipī” (Hãy nhổ bỏ tận gốc rễ, dù chỉ là một sợi cỏ vetiver).
‘‘Lobho akusalamūla’’ntiādīsu (dī. ni. 3.305) asādhāraṇahetumhi.
It refers to an uncommon cause, as in ‘‘Greed is a root of unwholesomeness.’’
Trong nghĩa nguyên nhân không phổ biến như trong câu “Lobho akusalamūlaṃ” (Tham là gốc rễ của bất thiện).
‘‘Yāvatā majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā rukkhamūla’’ntiādīsu samīpe.
It means proximity, as in ‘‘As far as the shadow extends at noon, or as far as the leaves fall in a windless place, that far is the foot of the tree.’’
Và trong nghĩa gần bên như trong câu “Yāvatā majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā rukkhamūlaṃ” (Vào giữa trưa, bóng mát lan tỏa bao nhiêu, khi không gió, lá rụng bao nhiêu, chừng đó là gốc cây).
Idhāpi samīpe adhippeto, tasmā bodhirukkhassa mūle samīpeti evamettha attho daṭṭhabbo.
Here, too, proximity is intended. Therefore, the meaning here should be understood as: at the foot, nearby the Bodhi tree.
Ở đây cũng có ý nghĩa là gần bên, do đó, ý nghĩa cần được hiểu là gần cội cây Bồ đề.
Etthāha ‘‘kasmā dhammavinayasaṅgahe kayiramāne nidānavacanaṃ vuttaṃ, nanu bhagavatā bhāsitavacanasseva saṅgaho kātabbo’’ti?
Here it is asked, ‘‘Why was the introductory statement mentioned when the compilation of the Dhamma and Vinaya was being made? Should not only the words spoken by the Blessed One be compiled?’’
Ở đây, có người hỏi: “Tại sao khi kết tập Pháp và Luật lại nói lời dẫn nhập? Chẳng phải chỉ nên kết tập những lời Đức Thế Tôn đã thuyết giảng thôi sao?”
Vuccate – desanāya ciraṭṭhitiasammosasaddheyyabhāvasampādanatthaṃ.
It is said: To ensure the discourse’s longevity, absence of confusion, and credibility.
Xin được giải thích: Để lời dạy được tồn tại lâu dài, không bị lầm lẫn và đáng tin cậy.
Kāladesadesakavatthuādīhi upanibandhitvā ṭhapitā hi desanā ciraṭṭhitikā hoti asammosā saddheyyā ca desakālakattuhetunimittehi upanibaddho viya vohāravinicchayo.
Indeed, a discourse that is compiled and set down with reference to the time, place, teacher, and other circumstances becomes long-lasting, free from confusion, and credible, like a legal judgment bound by the circumstances of the speaker, time, agent, and cause.
Quả thật, lời dạy được thiết lập bằng cách liên kết với thời gian, địa điểm, người thuyết giảng, và các yếu tố khác sẽ tồn tại lâu dài, không bị lầm lẫn và đáng tin cậy, giống như một phán quyết pháp lý được thiết lập bằng cách liên kết với người thuyết giảng, thời gian, người thực hiện, nguyên nhân và dấu hiệu.
Teneva ca āyasmatā mahākassapena ‘‘paṭhamaṃ, āvuso ānanda, udānaṃ kattha bhāsita’’ntiādinā desādīsu pucchāya katāya vissajjanaṃ karontena dhammabhaṇḍāgārikena ‘‘evaṃ me suta’’ntiādinā udānassa nidānaṃ bhāsitanti.
And it is for this reason that when Venerable Mahākassapa questioned Venerable Ānanda, saying, ‘‘Friends Ānanda, where was the first Udāna spoken?’’ and so forth, the Treasurer of the Dhamma, in answering, recited the introduction to the Udāna, beginning with ‘‘Thus have I heard.’’
Chính vì thế, khi Tôn giả Mahākassapa hỏi: “Này hiền giả Ānanda, bài Udāna đầu tiên được thuyết giảng ở đâu?”, và các câu hỏi về địa điểm v.v., Tôn giả Ānanda, người nắm giữ kho tàng Pháp, đã trả lời bằng cách nói lời dẫn nhập của bài Udāna, bắt đầu bằng “Evaṃ me sutaṃ” (Như vầy tôi nghe).
Apica satthu sampattipakāsanatthaṃ nidānavacanaṃ.
Furthermore, the introductory statement is for revealing the perfections of the Teacher.
Hơn nữa, lời dẫn nhập còn có mục đích công bố sự viên mãn của Bổn Sư.
Tathāgatassa hi bhagavato pubbaracanānumānāgamatakkābhāvato sambuddhattasiddhi.
Indeed, the Tathāgata’s attainment of Buddhahood is established by the absence of prior composition, inference, tradition, and speculation.
Thật vậy, sự thành tựu của Đức Chánh Đẳng Giác nơi Đức Thế Tôn là do không có sự chuẩn bị trước, suy luận, truyền thống hay lý luận.
Na hi sammāsambuddhassa pubbaracanādīhi attho atthi sabbattha appaṭihatañāṇacāratāya ekappamāṇattā ñeyyadhammesu.
For a Perfectly Self-Enlightened One has no need of prior composition, etc., due to the unobstructed operation of his knowledge everywhere and the oneness of his measure regarding knowable phenomena.
Quả thật, đối với một bậc Chánh Đẳng Giác, không cần đến sự chuẩn bị trước và những điều tương tự, vì Ngài có trí tuệ không bị chướng ngại ở mọi nơi và có cùng một thước đo trong các pháp cần được biết.
Tathā ācariyamuṭṭhidhammamacchariyasāsanasāvakānurāgābhāvato khīṇāsavattasiddhi.
Likewise, the attainment of being one whose defilements are destroyed is established by the absence of the teacher’s closed-fist, stinginess regarding the Dhamma, and attachment to his disciples in the Dispensation.
Cũng vậy, do không có sự nắm giữ của bậc Đạo sư (ācariyamuṭṭhi), sự keo kiệt về pháp (dhammamacchariya), sự keo kiệt về giáo pháp (sāsanamacchariya) và sự keo kiệt đối với các đệ tử (sāvakānurāga), nên thành tựu quả vị A-la-hán (khīṇāsava).
Na hi sabbaso parikkhīṇāsavassa katthacipi ācariyamuṭṭhiādīnaṃ sambhavoti suvisuddhassa parānuggahappavatti.
Indeed, for one whose defilements are completely destroyed, there is no possibility of a teacher’s closed-fist, etc., anywhere, and thus his extremely pure actions proceed for the benefit of others.
Quả thật, đối với bậc đã hoàn toàn đoạn tận các lậu hoặc (āsava), sự nắm giữ của bậc Đạo sư (ācariyamuṭṭhi) và những điều tương tự không thể xảy ra ở bất cứ nơi nào; do đó, sự thuyết pháp của bậc hoàn toàn thanh tịnh là vì lợi ích của người khác.
Iti desakadosabhūtānaṃ diṭṭhisīlasampattidūsakānaṃ accantaṃ avijjātaṇhānaṃ abhāvasaṃsūcakehi ñāṇasampadāpahānasampadābhibyañjakehi ca sambuddhavisuddhabhāvehi purimavesārajjadvayasiddhi, tato ca antarāyikaniyyānikadhammesu sammohābhāvasiddhito pacchimavesārajjadvayasiddhīti bhagavato catuvesārajjasamannāgamo attahitaparahitappaṭipatti ca nidānavacanena pakāsitā honti, tattha tattha sampattaparisāya ajjhāsayānurūpaṃ ṭhānuppattikappaṭibhānena dhammadesanādīpanato.
Thus, the two former qualities of fearlessness are established by the purified states of the Buddha, which signify the absolute absence of ignorance and craving—which are the faults of the teacher, corrupting the perfections of right view and conduct—and which manifest the perfections of knowledge and abandonment; from that, the two latter qualities of fearlessness are established due to the cessation of delusion regarding obstructive and emancipating doctrines. In this way, the Blessed One’s possession of the four qualities of fearlessness and his practice for his own and others’ welfare are revealed by the introductory statement, because it illuminates the discourse on Dhamma in accordance with the disposition of the assembled audience at each particular place, with an immediate, opportune wisdom.
Như vậy, do sự không có mặt hoàn toàn của vô minh (avijjā) và ái (taṇhā) – vốn là những lỗi lầm của người thuyết pháp, làm ô nhiễm sự thành tựu của chánh kiến (diṭṭhi) và giới (sīla) – và do những phẩm chất thanh tịnh của bậc Chánh Đẳng Giác biểu lộ sự thành tựu của trí tuệ (ñāṇasampadā) và sự thành tựu của sự đoạn tận (pahānasampadā), nên hai sự tự tin (vesārajja) đầu tiên được thành tựu. Từ đó, do không có sự mê lầm đối với những pháp gây chướng ngại (antarāyika) và những pháp dẫn đến giải thoát (niyyānika), nên hai sự tự tin cuối cùng được thành tựu. Như vậy, sự thành tựu bốn sự tự tin (catuvesārajja) của Thế Tôn và sự thực hành vì lợi ích của bản thân (attahita) và lợi ích của người khác (parahita) được tuyên bố qua lời mở đầu, do Ngài đã thuyết pháp một cách ứng biến (paṭibhāna) phù hợp với xu hướng (ajjhāsaya) của hội chúng tụ tập tại mỗi nơi.
Idha pana vimuttisukhappaṭisaṃvedanapaṭiccasamuppādamanasikārapakāsanenāti yojetabbaṃ.
Here, however, it should be connected with the manifestation of the experience of the bliss of liberation and attention to dependent origination.
Ở đây, phải hiểu rằng điều này được kết hợp với sự tuyên bố về sự cảm nhận niềm an lạc giải thoát (vimuttisukha) và sự tác ý về Duyên khởi (paṭiccasamuppāda).
Tena vuttaṃ – ‘‘satthu sampattipakāsanatthaṃ nidānavacana’’nti.
Therefore it was said, ‘‘the introductory statement is for revealing the perfections of the Teacher.’’
Vì vậy, đã nói rằng: “Lời mở đầu là để tuyên bố sự thành tựu của Bậc Đạo sư.”
Tathā sāsanasampattipakāsanatthaṃ nidānavacanaṃ.
Likewise, the introductory statement is for revealing the perfections of the Dispensation.
Cũng vậy, lời mở đầu là để tuyên bố sự thành tựu của Giáo pháp (sāsana).
Ñāṇakaruṇāpariggahitasabbakiriyassa hi bhagavato natthi niratthakā paṭipatti attahitā vā.
Indeed, for the Blessed One, whose every action is guided by knowledge and compassion, there is no purposeless practice, nor any practice solely for his own benefit.
Quả thật, đối với Thế Tôn, người mà mọi hành động đều được bao hàm bởi trí tuệ (ñāṇa) và lòng bi mẫn (karuṇā), không có hành động nào vô ích hoặc chỉ vì lợi ích của bản thân.
Tasmā paresaṃyeva atthāya pavattasabbakiriyassa sammāsambuddhassa sakalampi kāyavacīmanokammaṃ yathāpavattaṃ vuccamānaṃ diṭṭhadhammikasamparāyikaparamatthehi yathārahaṃ sattānaṃ anusāsanaṭṭhena sāsanaṃ, na kabbaracanā.
Therefore, the entirety of the Perfectly Self-Enlightened One’s bodily, verbal, and mental actions, which proceed solely for the benefit of others, when spoken of as they occurred, constitute the Dispensation—not merely a literary composition—because they instruct beings appropriately with regard to immediate benefits, future benefits, and ultimate truths.
Do đó, đối với Đức Chánh Đẳng Giác, người mà mọi hành động đều vì lợi ích của người khác, tất cả các hành động thân, khẩu, ý của Ngài, khi được trình bày đúng như chúng đã xảy ra, được gọi là Giáo pháp (sāsana) theo nghĩa là sự giáo huấn chúng sinh một cách thích đáng về các lợi ích hiện tại (diṭṭhadhammika), lợi ích đời sau (samparāyika) và lợi ích tối thượng (paramattha), chứ không phải là sự sắp đặt câu chữ.
Tayidaṃ satthu caritaṃ kāladesadesakaparisāpadesādīhi saddhiṃ tattha tattha nidānavacanena yathārahaṃ pakāsīyati, idha pana abhisambodhivimuttisukhappaṭisaṃvedanapaṭiccasamuppādamanasikārenāti yojetabbaṃ.
That course of the Teacher is revealed appropriately in various texts by means of introductory discourses, together with* time, place, assembly, locale, and so forth. But here, it should be understood as by means of the full Enlightenment, the experience of the bliss of liberation, and the contemplation of Paṭiccasamuppāda.
Hành trạng này của Bậc Đạo sư được tuyên bố một cách thích đáng bằng lời mở đầu ở mỗi nơi, cùng với thời gian, địa điểm, người thuyết pháp và hội chúng, v.v. Ở đây, phải hiểu rằng điều này được kết hợp với sự chứng đắc Chánh Đẳng Giác (abhisambodhi), sự cảm nhận niềm an lạc giải thoát (vimuttisukha) và sự tác ý về Duyên khởi (paṭiccasamuppāda).
Tena vuttaṃ – ‘‘sāsanasampattipakāsanatthaṃ nidānavacana’’nti.
Therefore, it was said: "The introductory discourse is for revealing the accomplishment of the Sāsana."
Vì vậy, đã nói rằng: “Lời mở đầu là để tuyên bố sự thành tựu của Giáo pháp.”
Ettha ca attajjhāsayo parajjhāsayo pucchāvasiko aṭṭhuppattikoti cattāro suttanikkhepā veditabbā.
Here, four ways of presenting suttas should be understood: based on one's own inclination (attajjhāsaya), based on others' inclination (parajjhāsaya), based on a question (pucchāvasika), and based on an originating circumstance (aṭṭhuppattika).
Ở đây, phải hiểu có bốn cách trình bày kinh (suttanikkhepa): do ý muốn của bản thân (attajjhāsaya), do ý muốn của người khác (parajjhāsaya), do câu hỏi (pucchāvasika) và do sự kiện phát sinh (aṭṭhuppattika).
Yathā hi anekasataanekasahassabhedānipi suttāni saṃkilesabhāgiyādipaṭṭhānanayena soḷasavidhataṃ nātivattanti, evaṃ tāni sabbānipi attajjhāsayādisuttanikkhepavasena catubbidhabhāvaṃ nātivattanti.
Just as suttas, though of many hundreds and many thousands of kinds, do not exceed the sixteen types according to the classification of saṃkilesabhāgiya and so forth, so too, all of them do not exceed the four types according to the ways of presenting suttas such as attajjhāsaya.
Cũng như các kinh, dù có hàng trăm, hàng ngàn biến thể, không vượt quá mười sáu loại theo phương pháp khởi nguyên như các pháp thuộc về ô nhiễm (saṃkilesabhāgiya), v.v., thì tất cả chúng cũng không vượt quá bốn loại theo cách trình bày kinh như ý muốn của bản thân (attajjhāsaya), v.v.
Kāmañcettha attajjhāsayassa aṭṭhuppattiyā ca parajjhāsayapucchāvasikehi saddhiṃ saṃsaggabhedo sambhavati ajjhāsayānusandhipucchānusandhisambhavato, attajjhāsayaaṭṭhuppattīnaṃ aññamaññaṃ saṃsaggo natthīti niravaseso paṭṭhānanayo na sambhavati.
Although a difference of intermingling between attajjhāsaya and aṭṭhuppatti with parajjhāsaya and pucchāvasika is possible here due to the possibility of sequence of inclinations and sequence of questions, there is no intermingling between attajjhāsaya and aṭṭhuppatti with each other, so the complete method of classification is not possible.
Mặc dù ở đây, có thể có sự pha trộn giữa ý muốn của bản thân (attajjhāsaya) và sự kiện phát sinh (aṭṭhuppatti) với ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika), do có sự liên kết của ý muốn (ajjhāsayānusandhi) và sự liên kết của câu hỏi (pucchānusandhi); nhưng không có sự pha trộn lẫn nhau giữa ý muốn của bản thân (attajjhāsaya) và sự kiện phát sinh (aṭṭhuppatti), nên phương pháp khởi nguyên hoàn toàn không thể xảy ra.
Tadantogadhattā vā sambhavantānaṃ sesanikkhepānaṃ mūlanikkhepavasena cattāro suttanikkhepāti vuttaṃ.
Or, because the other possible ways of presenting suttas are included within these, it is said that there are four principal ways of presenting suttas.
Hoặc, đã nói rằng có bốn cách trình bày kinh (suttanikkhepa) theo cách trình bày gốc (mūlanikkhepa), vì các cách trình bày còn lại có thể xảy ra đều nằm trong đó.
Tatrāyaṃ vacanattho – nikkhipanaṃ nikkhepo, suttassa nikkhepo suttanikkhepo, suttadesanāti attho.
Among these, the meaning of the word is: 'laying down' is nikkhepa; 'laying down of a sutta' is suttanikkhepa; the meaning is 'exposition of a sutta'.
Ở đây, ý nghĩa của từ là: sự trình bày (nikkhipanaṃ) là sự trình bày (nikkhepo). Sự trình bày của kinh (suttassa nikkhepo) là sự trình bày kinh (suttanikkhepo), tức là sự thuyết giảng kinh.
Nikkhipīyatīti vā nikkhepo, suttaṃ eva nikkhepo suttanikkhepo.
Or, it is laid down, therefore it is nikkhepa. The sutta itself is nikkhepa, hence suttanikkhepa.
Hoặc, cái được trình bày (nikkhipīyati) là sự trình bày (nikkhepo). Chính kinh là sự trình bày kinh (suttanikkhepo).
Attano ajjhāsayo attajjhāsayo, so assa atthi kāraṇabhūtoti attajjhāsayo, attano ajjhāsayo etassāti vā attajjhāsayo.
One's own inclination is attajjhāsaya. This inclination is a cause for it, hence attajjhāsaya. Or, it has its own inclination, hence attajjhāsaya.
Ý muốn của bản thân (attano ajjhāsayo) là ý muốn của bản thân (attajjhāsayo). Ý muốn đó là nguyên nhân, nên là ý muốn của bản thân (attajjhāsayo). Hoặc, cái có ý muốn của bản thân là ý muốn của bản thân (attajjhāsayo).
Parajjhāsayepi eseva nayo.
The same method applies to parajjhāsaya.
Đối với ý muốn của người khác (parajjhāsaya) cũng theo cách tương tự.
Pucchāya vaso pucchāvaso, so etassa atthīti pucchāvasiko.
The power of a question is pucchāvasa. It has this, hence pucchāvasika.
Sự chi phối của câu hỏi (pucchāya vaso) là sự chi phối của câu hỏi (pucchāvaso). Cái có sự chi phối đó là do câu hỏi (pucchāvasiko).
Suttadesanāya vatthubhūtassa atthassa uppatti atthuppatti, atthuppatti eva aṭṭhuppatti, sā etassa atthīti aṭṭhuppattiko.
The arising of the circumstance that forms the basis for the exposition of a sutta is atthuppatti; atthuppatti itself is aṭṭhuppatti. It has this, hence aṭṭhuppattika.
Sự phát sinh của điều kiện (atthassa uppatti) là sự kiện phát sinh (aṭṭhuppatti), vốn là đối tượng của sự thuyết giảng kinh. Chính sự kiện phát sinh là sự kiện phát sinh (aṭṭhuppatti). Cái có sự kiện phát sinh đó là sự kiện phát sinh (aṭṭhuppattiko).
Atha vā nikkhipīyati suttaṃ etenāti nikkhepo, attajjhāsayādi eva.
Alternatively, that by which a sutta is laid down is nikkhepa, such as attajjhāsaya and so forth.
Hoặc, cái mà kinh được trình bày bởi nó là sự trình bày (nikkhepo), tức là ý muốn của bản thân (attajjhāsaya), v.v.
Etasmiṃ pana atthavikappe attano ajjhāsayo attajjhāsayo.
In this alternative interpretation of the meaning, one's own inclination is attajjhāsaya.
Tuy nhiên, trong cách giải thích ý nghĩa này, ý muốn của bản thân là ý muốn của bản thân (attajjhāsayo).
Paresaṃ ajjhāsayo parajjhāsayo.
Others' inclination is parajjhāsaya.
Ý muốn của người khác là ý muốn của người khác (parajjhāsayo).
Pucchīyatīti pucchā, pucchitabbo attho.
That which is questioned is pucchā, the meaning to be questioned.
Cái được hỏi là câu hỏi (pucchā), tức là ý nghĩa cần được hỏi.
Pucchanavasena pavattaṃ dhammappaṭiggāhakānaṃ vacanaṃ pucchāvasaṃ, tadeva nikkhepasaddāpekkhāya pucchāvasikoti pulliṅgavasena vuttaṃ.
The speech of those who receive the Dhamma, which proceeds by way of questioning, is pucchāvasa. That very* is referred to as pucchāvasika in the masculine gender, in reference to the word nikkhepa.
Lời nói của những người tiếp nhận pháp (dhammappaṭiggāhaka) diễn ra theo cách hỏi là sự chi phối của câu hỏi (pucchāvasaṃ). Chính điều đó, khi xem xét từ “nikkhepa”, được gọi là “pucchāvasiko” theo giống đực.
Tathā atthuppattiyeva aṭṭhuppattikoti evamettha attho veditabbo.
Similarly, that which is aṭṭhuppatti itself is aṭṭhuppattika. Thus, the meaning here should be understood.
Cũng vậy, chính sự kiện phát sinh là sự kiện phát sinh (aṭṭhuppattiko). Ý nghĩa ở đây phải được hiểu như vậy.
Ettha ca paresaṃ indriyaparipākādikāraṇanirapekkhattā attajjhāsayassa visuṃ suttanikkhepabhāvo yutto kevalaṃ attano ajjhāsayeneva dhammatantiṭhapanatthaṃ pavattitadesanattā, parajjhāsayapucchāvasikānaṃ pana paresaṃ ajjhāsayapucchānaṃ desanāpavattihetubhūtānaṃ uppattiyaṃ pavattitānaṃ kathamaṭṭhuppattiyā anavarodho, pucchāvasikaaṭṭhuppattipubbakānaṃ vā parajjhāsayānurodhena pavattitānaṃ kathaṃ parajjhāsaye anavarodhoti?
And here, it is fitting that attajjhāsaya is a distinct way of presenting suttas because it does not depend on factors such as the maturity of others' faculties, being an exposition that proceeds solely from one's own inclination for establishing the Dhamma tradition. But how is there no contradiction with aṭṭhuppatti for parajjhāsaya and pucchāvasika, which arise from the inclination and questions of others and proceed as causes for the exposition of Dhamma? Or how is there no contradiction with parajjhāsaya for pucchāvasika and aṭṭhuppattika, which proceed in accordance with others' inclinations?
Ở đây, việc cách trình bày kinh do ý muốn của bản thân (attajjhāsaya) được tách biệt là hợp lý, vì nó không phụ thuộc vào các nguyên nhân như sự chín muồi của căn (indriyaparipāka) của người khác, mà chỉ là sự thuyết giảng được thực hiện để thiết lập giáo lý (dhammatanti) chỉ dựa trên ý muốn của bản thân. Nhưng đối với cách trình bày do ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika), vốn phát sinh khi có sự phát sinh của ý muốn và câu hỏi của người khác làm nguyên nhân cho sự thuyết giảng, thì làm sao không mâu thuẫn với sự kiện phát sinh (aṭṭhuppatti)? Hoặc, đối với những cách trình bày do câu hỏi (pucchāvasika) và sự kiện phát sinh (aṭṭhuppattika) được thực hiện theo ý muốn của người khác (parajjhāsayānurodhena), thì làm sao không mâu thuẫn với ý muốn của người khác (parajjhāsaya)?
Na codetabbametaṃ.
This should not be criticized.
Không nên chất vấn điều này.
Paresañhi abhinīhāraparipucchādivinicchayādivinimuttasseva suttantadesanākāraṇuppādassa aṭṭhuppattibhāvena gahitattā parajjhāsayapucchāvasikānaṃ visuṃ gahaṇaṃ.
For the separate classification of parajjhāsaya and pucchāvasika arises from the fact that aṭṭhuppatti is taken as the originating circumstance of a sutta exposition that is free from others' aspirations, questions, and similar determinations.
Vì sự phát sinh của nguyên nhân thuyết giảng kinh (suttantadesanākāraṇuppāda) của người khác, vốn không liên quan đến sự phát nguyện (abhinīhāra), câu hỏi (paripucchā), v.v., được coi là sự kiện phát sinh (aṭṭhuppatti), nên cách trình bày do ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika) được tách riêng.
Tathā hi brahmajāladhammadāyādasuttādīnaṃ vaṇṇāvaṇṇaāmisuppādādidesanānimittaṃ aṭṭhuppatti vuccati, paresaṃ pucchāya vinā ajjhāsayameva nimittaṃ katvā desito parajjhāsayo, pucchāvasena desito pucchāvasikoti pākaṭoyamatthoti.
Thus, the originating circumstance (aṭṭhuppatti) for the Brahmajjāla Sutta, Dhammadāyāda Sutta, and so forth is said to be the cause of the teaching, such as praise, censure, or the provision of material gifts. Parajjhāsaya is when the teaching is given by making only one's own inclination the cause, without a question from others. Pucchāvasika is when it is taught by way of a question. This meaning is clear.
Cũng vậy, sự kiện phát sinh (aṭṭhuppatti) được nói đến là nguyên nhân của sự thuyết giảng về sự khen ngợi (vaṇṇa), sự khiển trách (avaṇṇa), sự phát sinh vật chất (āmisuppāda), v.v., trong các kinh như Brahmajalasutta, Dhammadāyādasutta, v.v. Ý muốn của người khác (parajjhāsaya) là kinh được thuyết giảng chỉ dựa trên ý muốn mà không có câu hỏi của người khác. Kinh được thuyết giảng do câu hỏi là do câu hỏi (pucchāvasika). Ý nghĩa này là rõ ràng.
Tattha paṭhamādīni tīṇi bodhisuttāni mucalindasuttaṃ, āyusaṅkhārossajjanasuttaṃ, paccavekkhaṇasuttaṃ, papañcasaññāsuttanti imesaṃ udānānaṃ attajjhāsayo nikkhepo.
Among these, the first three Bodhi suttas, namely the Mucalinda Sutta, the Āyusaṅkhārossajjana Sutta, the Paccavekkhaṇa Sutta, and the Papañcasaññā Sutta—these Udānas have attajjhāsaya as their mode of presentation.
Trong số đó, ba kinh Bồ-đề đầu tiên, kinh Mucalinda, kinh Ayusaṅkhārossajjana, kinh Paccavekkhaṇa và kinh Papañcasaññā, là những bài Udāna thuộc loại ý muốn của bản thân (attajjhāsaya).
Huhuṅkasuttaṃ, brāhmaṇajātikasuttaṃ, bāhiyasuttanti imesaṃ udānānaṃ pucchāvasiko nikkhepo.
The Hu-huṅka Sutta, the Brāhmaṇajātika Sutta, and the Bāhiya Sutta—these Udānas have pucchāvasika as their mode of presentation.
Các kinh Huhuṅka, Brāhmaṇajātika và Bāhiya là những bài Udāna thuộc loại do câu hỏi (pucchāvasika).
Rājasuttaṃ, sakkārasuttaṃ, ucchādanasuttaṃ, piṇḍapātikasuttaṃ, sippasuttaṃ, gopālasuttaṃ, sundarikasuttaṃ, mātusuttaṃ, saṅghabhedakasuttaṃ, udapānasuttaṃ, tathāgatuppādasuttaṃ, moneyyasuttaṃ, pāṭaligāmiyasuttaṃ, dvepi dabbasuttānīti etesaṃ udānānaṃ aṭṭhuppattiko nikkhepo.
The Rāja Sutta, the Sakkāra Sutta, the Ucchādana Sutta, the Piṇḍapātika Sutta, the Sippa Sutta, the Gopāla Sutta, the Sundarika Sutta, the Mātu Sutta, the Saṅghabhedaka Sutta, the Udapāna Sutta, the Tathāgatuppāda Sutta, the Moneyya Sutta, the Pāṭaligāmiya Sutta, and the two Dabba Suttas—these Udānas have aṭṭhuppattika as their mode of presentation.
Các kinh Rājasutta, Sakkārasutta, Ucchādanasutta, Piṇḍapātikasutta, Sippasutta, Gopālasutta, Sundarikasutta, Mātusutta, Saṅghabhedakasutta, Udapānasutta, Tathāgatuppādasutta, Moneyyasutta, Pāṭaligāmiyasutta, và hai kinh Dabbasutta này là sự trình bày theo nguyên nhân (aṭṭhuppattiko nikkhepo) của các bài Udāna đó.
Pālileyyasuttaṃ, piyasuttaṃ, nāgasamālasuttaṃ, visākhāsuttañcāti imesaṃ udānānaṃ attajjhāsayo parajjhāsayo ca nikkhepo.
The Pālileyya Sutta, the Piya Sutta, the Nāgasamāla Sutta, and the Visākhā Sutta—these Udānas have both attajjhāsaya and parajjhāsaya as their mode of presentation.
Các kinh Pālileyyasutta, Piyasutta, Nāgasamālasutta và Visākhāsutta này là sự trình bày theo ý nguyện của chính mình và ý nguyện của người khác (attajjhāsayo parajjhāsayo ca nikkhepo) của các bài Udāna đó.
Sesānaṃ ekapaññāsāya suttānaṃ parajjhāsayo nikkhepo.
The remaining fifty-three suttas have parajjhāsaya as their mode of presentation.
Sự trình bày theo ý nguyện của người khác (parajjhāsayo nikkhepo) là của năm mươi mốt kinh còn lại.
Evametesaṃ udānānaṃ attajjhāsayādivasena nikkhepaviseso veditabbo.
Thus, the specific mode of presentation of these Udānas, such as attajjhāsaya and so forth, should be understood.
Như vậy, cần phải hiểu sự trình bày đặc biệt của các bài Udāna này theo ý nguyện của chính mình, v.v.
Tena kho pana samayenātiādīsu tena samayenāti ca bhummatthe karaṇavacanaṃ, kho panāti nipāto, tasmiṃ samayeti attho.
In passages such as ‘ Tena kho pana samayena’ (At that time), ‘ tena samayena’ is an instrumental case word used in a locative sense, and ‘ kho pana’ is a particle. The meaning is ‘at that time’.
Trong các câu như “ Tena kho pana samayena” (Vào lúc bấy giờ), từ “ tena samayena” là cách dùng từ thuộc sở cách (bhummattha) trong ý nghĩa công cụ (karaṇavacana), và “ kho pana” là một từ ngữ phụ (nipāta). Ý nghĩa là “vào lúc đó”.
Kasmiṃ pana samaye?
But at what time?
Vậy, vào lúc nào?
Yaṃ samayaṃ bhagavā uruvelāyaṃ viharati najjā nerañjarāya tīre bodhirukkhamūle paṭhamābhisambuddho.
At the time when the Blessed One was dwelling in Uruvelā, on the bank of the Nerañjarā River, at the foot of the Bodhi tree, having just attained full enlightenment.
Vào lúc Đức Thế Tôn đang an trú tại Uruvelā, bên bờ sông Nerañjarā, dưới cội Bồ-đề, vừa mới thành tựu chánh đẳng chánh giác.
Tasmiṃ samaye.
At that time.
Vào lúc đó.
Sattāhanti satta ahāni sattāhaṃ, accantasaṃyogatthe etaṃ upayogavacanaṃ.
‘ Sattāhaṃ’ means seven days; this is a word of use in the sense of continuous connection.
“ Sattāhaṃ” có nghĩa là bảy ngày. Đây là cách dùng từ thuộc nghiệp cách (upayogavacana) trong ý nghĩa liên tục tuyệt đối (accantasaṃyoga).
Yasmā bhagavā taṃ sattāhaṃ nirantaratāya accantameva phalasamāpattisukhena vihāsi, tasmā sattāhanti accantasaṃyogavasena upayogavacanaṃ vuttaṃ.
Because the Blessed One dwelled continuously throughout those seven days, fully experiencing the bliss of fruition-attainment, therefore the word ‘sattāhaṃ’ is spoken in the sense of continuous connection.
Vì Đức Thế Tôn đã an trú liên tục trong bảy ngày đó với niềm an lạc của quả vị nhập định (phalasamāpattisukha), nên từ “sattāhaṃ” được nói theo nghĩa liên tục tuyệt đối.
Ekapallaṅkenāti visākhāpuṇṇamāya anatthaṅgateyeva sūriye aparājitapallaṅkavare vajirāsane nisinnakālato paṭṭhāya sakimpi anuṭṭhahitvā yathāābhujitena ekeneva pallaṅkena.
‘ Ekapallaṅkena’ means with a single cross-legged posture, without rising even once, in the same posture assumed from the time he sat on the supreme Vajirāsana, the unassailable seat, before the sun had set on the Visākhā full moon day.
“ Ekapallaṅkena” có nghĩa là ngồi kiết già một lần duy nhất, không đứng dậy dù chỉ một lần, kể từ lúc Đức Thế Tôn ngồi trên tòa kim cương (vajirāsana) cao quý, bất khả chiến bại, vào ngày trăng tròn Visākhā, trước khi mặt trời lặn.
Vimuttisukhapaṭisaṃvedīti vimuttisukhaṃ phalasamāpattisukhaṃ paṭisaṃvediyamāno nisinno hotīti attho.
‘ Vimuttisukhapaṭisaṃvedī’ means experiencing the bliss of liberation, which is the bliss of fruition-attainment, thus he sat experiencing it.
“ Vimuttisukhapaṭisaṃvedī” có nghĩa là an trú trong sự cảm nhận niềm an lạc của giải thoát (vimuttisukha), tức là niềm an lạc của quả vị nhập định (phalasamāpattisukha).
Tattha vimuttīti tadaṅgavimutti, vikkhambhanavimutti, samucchedavimutti, paṭippassaddhivimutti, nissaraṇavimuttīti pañca vimuttiyo.
Here, ‘ vimutti’ refers to five kinds of liberation: tadaṅga-vimutti, vikkhambhana-vimutti, samuccheda-vimutti, paṭippassaddhi-vimutti, and nissaraṇa-vimutti.
Ở đây, “ vimutti” (giải thoát) có năm loại: tadaṅgavimutti (giải thoát từng phần), vikkhambhanavimutti (giải thoát bằng cách trấn áp), samucchedavimutti (giải thoát bằng cách đoạn trừ), paṭippassaddhivimutti (giải thoát bằng cách an tịnh), và nissaraṇavimutti (giải thoát bằng cách xuất ly).
Tāsu yaṃ deyyadhammapariccāgādīhi tehi tehi guṇaṅgehi nāmarūpaparicchedādīhi vipassanaṅgehi ca yāva tassa tassa aṅgassa aparihānivasena pavatti, tāva taṃtaṃpaṭipakkhato vimuccanato vimuccanaṃ pahānaṃ.
Among these, the liberation and abandonment that occurs by means of giving meritorious gifts and other virtuous practices, and by means of insight practices like discerning name-and-form, as long as each of those factors is not lost, is a liberation from its respective opposing defilement.
Trong số đó, sự giải thoát, sự từ bỏ (pahāna) khỏi các đối thủ tương ứng, diễn ra chừng nào sự thực hành các yếu tố công đức như bố thí, v.v., và các yếu tố tuệ quán như phân biệt danh sắc, v.v., không bị suy giảm, thì đó là tadaṅgavimutti.
Seyyathidaṃ?
For example:
Chẳng hạn:
Dānena macchariyalobhādito, sīlena pāṇātipātādito, nāmarūpavavatthānena sakkāyadiṭṭhito, paccayapariggahena ahetuvisamahetudiṭṭhīhi, tasseva aparabhāgena kaṅkhāvitaraṇena kathaṃkathībhāvato, kalāpasammasanena ‘‘ahaṃ mamā’’ti gāhato, maggāmaggavavatthānena amagge maggasaññāya, udayadassanena ucchedadiṭṭhiyā, vayadassanena sassatadiṭṭhiyā, bhayadassanena sabhaye abhayasaññāya, ādīnavadassanena assādasaññāya, nibbidānupassanena abhiratisaññāya, muccitukamyatāñāṇena amuccitukamyatāya, upekkhāñāṇena anupekkhāya, anulomena dhammaṭṭhitiyaṃ nibbāne ca paṭilomabhāvato, gotrabhunā saṅkhāranimittabhāvato vimuccanaṃ, ayaṃ tadaṅgavimutti nāma.
By giving, liberation from stinginess, greed, and so on; by morality, from taking life, and so on; by discerning name-and-form, from personality view; by comprehending conditionality, from the views of causelessness and uneven cause; by the knowledge of doubt-crossing in its later stage, from a state of indecision; by contemplating aggregates, from the grasping of ‘I’ and ‘mine’; by discerning the path and non-path, from the perception of the non-path as the path; by observing arising, from the annihilation view; by observing passing away, from the eternalist view; by observing fear, from the perception of fearlessness in what is fearful; by observing danger, from the perception of enjoyment; by contemplating disenchantment, from the perception of delight; by the knowledge of the desire for liberation, from the desire for non-liberation; by the knowledge of equanimity, from non-equanimity; by conformity knowledge, from opposition to the stability of Dhamma and Nibbāna; by gotrabhū knowledge, from the state of being a sign of formations. This liberation is called tadaṅga-vimutti.
Bố thí giải thoát khỏi lòng tham keo kiệt, v.v.; trì giới giải thoát khỏi sát sinh, v.v.; phân biệt danh sắc giải thoát khỏi tà kiến thân kiến (sakkāyadiṭṭhi); nắm giữ nhân duyên giải thoát khỏi tà kiến vô nhân và dị nhân; sau đó, vượt qua nghi ngờ giải thoát khỏi trạng thái hoài nghi; quán xét các nhóm giải thoát khỏi sự chấp thủ “ta và của ta”; phân biệt đạo và phi đạo giải thoát khỏi sự nhận thức sai lầm về đạo; thấy sự sinh khởi giải thoát khỏi tà kiến đoạn kiến (ucchedadiṭṭhi); thấy sự diệt vong giải thoát khỏi tà kiến thường kiến (sassatadiṭṭhi); thấy sự sợ hãi giải thoát khỏi nhận thức không sợ hãi trong điều đáng sợ; thấy sự nguy hiểm giải thoát khỏi nhận thức về sự thích thú; quán chiếu sự nhàm chán giải thoát khỏi nhận thức về sự vui thích; trí tuệ muốn giải thoát giải thoát khỏi sự không muốn giải thoát; trí tuệ xả giải thoát khỏi sự không xả; thuận thứ giải thoát khỏi trạng thái nghịch lại với sự an trú của Pháp và Niết Bàn; trí tuệ chuyển tộc (gotrabhu) giải thoát khỏi trạng thái là tướng của các hành (saṅkhāranimitta). Đây gọi là tadaṅgavimutti.
Yaṃ pana upacārappanābhedena samādhinā yāvassa aparihānivasena pavatti, tāva kāmacchandādīnaṃ nīvaraṇānañceva, vitakkādīnañca paccanīkadhammānaṃ, anuppattisaññitaṃ vimuccanaṃ, ayaṃ vikkhambhanavimutti nāma.
The liberation which is the non-arising, as a result of jhāna, of hindrances such as sensual desire, and of antagonistic phenomena such as initial application, as long as that jhāna is not lost, is called vikkhambhana-vimutti.
Còn sự giải thoát khỏi các triền cái như dục ái, v.v., và các pháp đối nghịch như tầm, v.v., được gọi là không sinh khởi, diễn ra chừng nào sự định tâm (samādhi) theo cách cận định (upacāra) và an định (appanā) không bị suy giảm, thì đây gọi là vikkhambhanavimutti.
Yaṃ catunnaṃ ariyamaggānaṃ bhāvitattā taṃtaṃmaggavato ariyassa santāne yathārahaṃ ‘‘diṭṭhigatānaṃ pahānāyā’’tiādinā (dha. sa. 277; vibha. 628) nayena vuttassa samudayapakkhiyassa kilesagaṇassa puna accantaṃ appavattibhāvena samucchedappahānavasena vimuccanaṃ, ayaṃ samucchedavimutti nāma.
The liberation that is the complete eradication and abandonment of the group of defilements belonging to the origin, as stated in phrases like ‘for the abandonment of wrong views’ (Dhs. 277; Vbh. 628) in the appropriate manner in the continuum of a noble one who possesses that path, due to the cultivation of the four noble paths, is called samuccheda-vimutti.
Còn sự giải thoát bằng cách đoạn trừ hoàn toàn các nhóm phiền não thuộc về tập khởi, được thuyết giảng theo cách “để từ bỏ các tà kiến”, v.v., trong dòng tâm thức của các Bậc Thánh đã thành tựu các đạo quả tương ứng, do đã tu tập bốn Thánh đạo, thì đây gọi là samucchedavimutti.
Yaṃ pana phalakkhaṇe paṭippassaddhattaṃ kilesānaṃ, ayaṃ paṭippassaddhivimutti nāma.
That quiescence of defilements at the moment of fruition is called paṭippassaddhi-vimutti.
Còn sự an tịnh các phiền não trong khoảnh khắc quả, thì đây gọi là paṭippassaddhivimutti.
Sabbasaṅkhatanissaṭattā pana sabbasaṅkhāravimuttaṃ nibbānaṃ, ayaṃ nissaraṇavimutti nāma.
Nibbāna, however, being disengaged from all conditioned things, liberated from all formations, is called nissaraṇa-vimutti.
Còn Niết Bàn, là sự xuất ly khỏi mọi hành (saṅkhāra), do thoát ly khỏi mọi pháp hữu vi (saṅkhata), thì đây gọi là nissaraṇavimutti.
Idha pana bhagavato nibbānārammaṇā phalavimutti adhippetā.
Here, however, the fruition liberation, which has Nibbāna as its object, is intended for the Blessed One.
Ở đây, giải thoát quả (phalavimutti) với Niết Bàn làm đối tượng được Đức Thế Tôn đề cập.
Tena vuttaṃ – ‘‘vimuttisukhapaṭisaṃvedīti vimuttisukhaṃ phalasamāpattisukhaṃ paṭisaṃvediyamāno nisinno hotīti attho’’ti.
Therefore, it is said: ‘‘Vimuttisukhapaṭisaṃvedī’ means that he sat experiencing the bliss of liberation, which is the bliss of fruition-attainment,’—this is the meaning.’
Do đó, đã nói: “’Vimuttisukhapaṭisaṃvedī’ có nghĩa là an trú trong sự cảm nhận niềm an lạc của giải thoát, tức là niềm an lạc của quả vị nhập định.”
Vimuttīti ca upakkilesehi paṭippassaddhivasena cittassa vimuttabhāvo, cittameva vā tathā vimuttaṃ veditabbaṃ, tāya vimuttiyā jātaṃ sampayuttaṃ vā sukhaṃ vimuttisukhaṃ.
‘ Vimutti’ also means the state of mind being liberated through the calming of defilements, or the mind itself, thus liberated, should be understood. The happiness born of or associated with that liberation is the bliss of liberation.
Và “ vimutti” (giải thoát) là trạng thái tâm được giải thoát khỏi các cấu uế (upakkilesa) bằng cách an tịnh chúng, hoặc chính tâm được giải thoát như vậy cần được hiểu. Hạnh phúc sinh ra hoặc liên hệ với sự giải thoát đó là vimuttisukha (an lạc giải thoát).
‘‘Yāyaṃ, bhante, upekkhā sante sukhe vuttā bhagavatā’’ti (ma. ni. 2.88) vacanato upekkhāpi cettha sukhamicceva veditabbā.
As it is said, ‘Bhante, this equanimity spoken of by the Blessed One as a peaceful happiness’ (MN II, 88), equanimity here should also be understood as happiness.
Theo lời dạy của Đức Thế Tôn: “Bạch Thế Tôn, sự xả (upekkhā) này được Đức Thế Tôn nói là niềm an lạc an tịnh,” thì ở đây, xả cũng cần được hiểu là an lạc.
Tathā ca vuttaṃ sammohavinodaniyaṃ ‘‘upekkhā pana santattā, sukhamicceva bhāsitā’’ti (vibha. aṭṭha. 232).
And so it is said in the Sammohavinodanī, ‘Equanimity, being peaceful, is indeed spoken of as happiness’ (VibhA. 232).
Như đã nói trong Sammohavinodanī: “Sự xả, vì là an tịnh, nên được thuyết giảng là an lạc.”
Bhagavā hi catutthajjhānikaṃ arahattasamāpattiṃ samāpajjati, na itaraṃ.
For the Blessed One attains the fruition-attainment of Arahantship, which is associated with the fourth jhāna, not any other.
Đức Thế Tôn thực hành nhập A-la-hán quả định (arahattasamāpatti) thuộc Tứ thiền, chứ không phải các thiền khác.
Atha vā ‘‘tesaṃ vūpasamo sukho’’tiādīsu yathā saṅkhāradukkhūpasamo sukhoti vuccati, evaṃ sakalakilesadukkhūpasamabhāvato aggaphale labbhamānā paṭippassaddhivimutti eva idha sukhanti veditabbā.
Alternatively, just as the cessation of the suffering of formations is called happiness in phrases like ‘their appeasement is happiness’ and so on, so too, the paṭippassaddhi-vimutti attained in the highest fruition, being the cessation of the suffering of all defilements, should be understood as happiness here.
Hoặc, như trong các câu như “Sự an tịnh của chúng là an lạc,” sự an tịnh của khổ hành được gọi là an lạc, thì tương tự, sự giải thoát an tịnh (paṭippassaddhivimutti) đạt được trong quả vị tối thượng (aggaphala) do sự an tịnh của mọi khổ phiền não, cần được hiểu là an lạc ở đây.
Tayidaṃ vimuttisukhaṃ maggavīthiyaṃ kālantareti phalacittassa pavattivibhāgena duvidhaṃ hoti.
This bliss of liberation is of two kinds, distinguished by the occurrence of fruition-consciousness: in the path-process and at a later time.
An lạc giải thoát này có hai loại theo sự phân chia của tâm quả (phalacitta) trong lộ trình đạo (maggavīthi) và trong thời gian sau (kālantara).
Ekekassa hi ariyamaggassa anantarā tassa tasseva vipākabhūtāni nibbānārammaṇāni tīṇi dve vā phalacittāni uppajjanti anantaravipākattā lokuttarakusalānaṃ.
Immediately following each of the noble paths, three or two fruition-consciousnesses, which are the results of that noble path and have Nibbāna as their object, arise, due to supramundane wholesome kamma giving result immediately.
Vì các thiện pháp siêu thế (lokuttarakusala) có quả báo vô gián, nên ngay sau mỗi Thánh đạo, ba hoặc hai tâm quả làm đối tượng Niết Bàn, là quả báo của Thánh đạo đó, sẽ sinh khởi.
Yasmiñhi javanavāre ariyamaggo uppajjati, tattha yadā dve anulomāni, tadā tatiyaṃ gotrabhu, catutthaṃ maggacittaṃ, tato paraṃ tīṇi phalacittāni honti.
Indeed, in the javana-process wherein a noble path arises, when there are two conforming cognitions (anuloma), then the third is gotrabhū, the fourth is path-consciousness, and thereafter there are three fruition-consciousnesses.
Trong sát na tốc hành (javanavāra) nào Thánh đạo sinh khởi, nếu có hai tâm thuận thứ (anuloma), thì tâm chuyển tộc (gotrabhu) là thứ ba, tâm đạo là thứ tư, và sau đó là ba tâm quả.
Yadā pana tīṇi anulomāni, tadā catutthaṃ gotrabhu, pañcamaṃ maggacittaṃ, tato paraṃ dve phalacittāni honti.
However, when there are three conforming cognitions, then the fourth is gotrabhū, the fifth is path-consciousness, and thereafter there are two fruition-consciousnesses.
Nếu có ba tâm thuận thứ, thì tâm chuyển tộc là thứ tư, tâm đạo là thứ năm, và sau đó là hai tâm quả.
Evaṃ catutthaṃ pañcamaṃ appanāvasena pavattati, na tato paraṃ bhavaṅgassa āsannattā.
Thus, the fourth and fifth conscious-moments occur by way of absorption, and no further, because of the proximity of the life-continuum.
Như vậy, tâm thứ tư và thứ năm sinh khởi theo cách an định (appanā), không có tâm nào sau đó vì gần với hữu phần (bhavaṅga).
Keci pana ‘‘chaṭṭhampi cittaṃ appetī’’ti vadanti, taṃ aṭṭhakathāsu (visuddhi. 2.811) paṭikkhittaṃ.
Some, however, say that ‘the sixth consciousness also reaches absorption,’ but this is rejected in the Commentaries (Vism. 2.811).
Một số người nói rằng “tâm thứ sáu cũng an định,” nhưng điều đó đã bị bác bỏ trong các bản chú giải (aṭṭhakathā).
Evaṃ maggavīthiyaṃ phalaṃ veditabbaṃ.
Thus, fruition in the path-process should be understood.
Như vậy, quả trong lộ trình đạo cần được hiểu.
Kālantare phalaṃ pana phalasamāpattivasena pavattaṃ, nirodhā vuṭṭhahantassa uppajjamānañca eteneva saṅgahitaṃ.
Fruition at a later time, however, occurring by way of fruition-attainment, and arising for one emerging from the cessation-attainment, is also included in this.
Còn quả trong thời gian sau, sinh khởi theo cách quả nhập định (phalasamāpatti) và khi vị A-la-hán xuất khỏi diệt tận định (nirodha-samāpatti), cũng được bao gồm trong loại này.
Sā panāyaṃ phalasamāpatti atthato lokuttarakusalānaṃ vipākabhūtā nibbānārammaṇā appanāti daṭṭhabbā.
And this fruition-attainment is to be regarded, in essence, as the absorption that is the result of supramundane wholesome kamma and has Nibbāna as its object.
Và quả nhập định này, về bản chất, cần được xem là sự an định làm đối tượng Niết Bàn, là quả báo của các thiện pháp siêu thế.
Ke taṃ samāpajjanti, ke na samāpajjantīti?
Who attains it, and who does not attain it?
Ai thực hành nhập định đó, ai không thực hành nhập định đó?
Sabbepi puthujjanā na samāpajjanti anadhigatattā.
All ordinary people do not attain it, because they have not realized it.
Tất cả phàm nhân đều không thực hành nhập định đó vì chưa chứng đắc.
Tathā heṭṭhimā ariyā uparimaṃ, uparimāpi ariyā heṭṭhimaṃ na samāpajjantiyeva puggalantarabhāvūpagamanena paṭippassaddhabhāvato.
Likewise, lower noble ones do not attain higher fruition-attainments, nor do higher noble ones attain lower ones, because they have already transcended those states and their defilements are already appeased.
Tương tự, các Bậc Thánh thấp hơn không thực hành nhập định cao hơn, và các Bậc Thánh cao hơn cũng không thực hành nhập định thấp hơn, vì chúng đã được an tịnh bằng cách đạt đến trạng thái của một cá nhân khác.
Attano eva phalaṃ te te ariyā samāpajjanti.
Each of those noble ones attains only their own fruition.
Các Bậc Thánh đó chỉ thực hành nhập định quả vị của chính mình.
Keci pana ‘‘sotāpannasakadāgāmino phalasamāpattiṃ na samāpajjanti, uparimā dveyeva samāpajjanti samādhismiṃ paripūrakāribhāvato’’ti vadanti.
Some, however, say that ‘stream-enterers and once-returners do not attain fruition-attainment, only the two higher ones attain it because they are perfect in concentration.’
Một số người lại nói rằng: "Bậc Nhập Lưu (Sotāpanna) và Nhất Lai (Sakadāgāmī) không nhập quả định (phalasamāpatti), chỉ có hai bậc trên (Bất Lai và A-la-hán) mới nhập, vì họ đã thành tựu viên mãn về định (samādhi)."
Taṃ akāraṇaṃ puthujjanassāpi attanā paṭiladdhalokiyasamādhisamāpajjanato.
That is not reasonable, because even an ordinary person attains their own worldly concentration that they have gained.
Điều đó không có lý do, vì ngay cả phàm phu (puthujjana) cũng có thể nhập các thiền định thế gian (lokiyasamādhi) mà mình đã đạt được.
Kiṃ vā ettha kāraṇacintāya?
Or what is the point of considering a reason here?
Hơn nữa, có ích gì khi suy tư về lý do ở đây?
Vuttañhetaṃ paṭisambhidāyaṃ ‘‘katamā dasa saṅkhārupekkhā vipassanāvasena uppajjanti (paṭi. ma. 1.57), katame dasa gotrabhudhammā vipassanāvasena uppajjantī’’ti (paṭi. ma. 1.60) imesaṃ pañhānaṃ vissajjane sotāpattiphalasamāpattatthāya sakadāgāmiphalasamāpattatthāyāti tesampi ariyānaṃ phalasamāpattisamāpajjanaṃ vuttaṃ.
It is said in the Paṭisambhidāmagga, in the explanation of the questions "What are the ten equanimities regarding formations that arise by way of insight?" and "What are the ten gotrabhū qualities that arise by way of insight?", that even for these noble ones, the attainment of the fruit (phalasamāpatti) is mentioned for the purpose of attaining the fruit of Stream-entry and for the purpose of attaining the fruit of Once-returning.
Vì điều này đã được nói trong Paṭisambhidāmagga khi giải đáp các câu hỏi "Mười loại xả hành (saṅkhārupekkhā) nào phát sinh do tuệ quán (vipassanā)?" và "Mười pháp chuyển chủng (gotrabhudhammā) nào phát sinh do tuệ quán?", rằng các bậc Thánh đó cũng nhập quả định (phalasamāpatti) để đạt được quả Nhập Lưu (sotāpattiphala) và quả Nhất Lai (sakadāgāmiphala).
Tasmā sabbepi ariyā yathāsakaṃ phalaṃ samāpajjantīti niṭṭhamettha gantabbaṃ.
Therefore, it should be concluded here that all noble ones attain their respective fruits.
Vì vậy, phải kết luận rằng tất cả các bậc Thánh đều nhập quả định tương ứng với quả vị của mình.
Ayaṃ panettha samāpajjanakkamo – phalasamāpattitthikena ariyasāvakena rahogatena paṭisallīnena udayabbayādivasena saṅkhārā vipassitabbā.
This, here, is the method of entering (samāpatti): By an Ariya disciple desiring fruit-attainment, having gone to a secluded place and being in solitude, the formations should be contemplated with vipassanā by means of rise and fall, etc.
Đây là trình tự nhập định ở đây: Một Thánh đệ tử (ariyasāvaka) muốn nhập quả định, sau khi đi đến nơi vắng vẻ và ẩn mình, phải quán chiếu các hành (saṅkhāra) theo cách sinh diệt (udayabbayādivasena).
Tassevaṃ pavattānupubbavipassanasseva saṅkhārārammaṇagotrabhuñāṇānantaraṃ phalasamāpattivasena nirodhe cittamappeti, phalasamāpattininnabhāvena ca sekkhassāpi phalameva uppajjati, na maggo.
For that very person whose vipassanā is thus progressively developing, immediately after the gotrabhu-ñāṇa whose object is formations, the mind settles upon Nibbāna by way of fruit-attainment. And due to its inclination towards fruit-attainment, for a sekkha too, only the fruit arises, not the path.
Đối với người đã tu tập tuệ quán (vipassanā) tuần tự như vậy, ngay sau trí chuyển chủng (gotrabhuñāṇa) lấy các hành làm đối tượng, tâm sẽ hướng đến sự đoạn diệt (nirodhe) theo cách nhập quả định (phalasamāpattivasena), và do khuynh hướng hướng về quả định, ngay cả đối với bậc Hữu Học (sekkhassa), chỉ có quả (phala) phát sinh, chứ không phải đạo (magga).
Ye pana vadanti ‘‘sotāpanno attano phalasamāpattiṃ samāpajjissāmīti vipassanaṃ vaḍḍhetvā sakadāgāmī hoti, sakadāgāmī ca anāgāmī’’ti.
But those who say, “A sotāpanna, having developed vipassanā with the intention of attaining their own fruit-attainment, becomes a sakadāgāmī; and a sakadāgāmī becomes an anāgāmī,”
Còn những người nói rằng: "Bậc Nhập Lưu (Sotāpanna) tăng trưởng tuệ quán với ý định nhập quả định của mình thì trở thành bậc Nhất Lai (Sakadāgāmī), và bậc Nhất Lai thì trở thành bậc Bất Lai (Anāgāmī),"
Te vattabbā – evaṃ sante anāgāmī arahā bhavissati, arahā ca paccekabuddho, paccekabuddho ca sambuddhoti āpajjeyya, tasmā yathābhinivesaṃ yathājjhāsayaṃ vipassanā atthaṃ sādhetīti sekkhassāpi phalameva uppajjati, na maggo.
should be told: If that were the case, an anāgāmī would become an arahant, an arahant a Paccekabuddha, and a Paccekabuddha a Sammāsambuddha, which would follow. Therefore, since vipassanā accomplishes its purpose according to one’s resolve and disposition, for a sekkha too, only the fruit arises, not the path.
Thì họ phải được nói rằng: "Nếu vậy, bậc Bất Lai sẽ trở thành A-la-hán, A-la-hán sẽ trở thành Độc Giác Phật (Paccekabuddha), và Độc Giác Phật sẽ trở thành Chánh Đẳng Giác (Sambuddha)." Điều đó sẽ xảy ra, do đó, tuệ quán (vipassanā) đạt được mục đích tùy theo sự quyết tâm và ý định. Vì vậy, ngay cả đối với bậc Hữu Học (sekkhassa), chỉ có quả (phala) phát sinh, chứ không phải đạo (magga).
Phalampi tassa sace anena paṭhamajjhāniko maggo adhigato, paṭhamajjhānikameva uppajjati.
As for the fruit, if that person has attained the path associated with the first jhāna, then only the fruit associated with the first jhāna arises.
Nếu đạo (magga) mà người ấy đã đạt được là đạo liên hệ đến sơ thiền (paṭhamajjhānika), thì quả (phala) của người ấy cũng sẽ là quả liên hệ đến sơ thiền.
Sace dutiyādīsu aññatarajjhāniko, dutiyādīsu aññatarajjhānikamevāti.
If it is a path associated with any of the second (jhāna) and so on, then only the fruit associated with that particular jhāna, from the second and so on, arises.
Nếu là đạo liên hệ đến một trong các thiền thứ hai trở đi, thì quả cũng sẽ là quả liên hệ đến một trong các thiền thứ hai trở đi.
Kasmā panettha gotrabhuñāṇaṃ maggañāṇapurecārikaṃ viya nibbānārammaṇaṃ na hotīti?
Why, in this case, is the gotrabhu-ñāṇa not focused on Nibbāna, like the one preceding the path-knowledge?
Tại sao ở đây trí chuyển chủng (gotrabhuñāṇa) không lấy Nibbāna làm đối tượng như trí đi trước đạo trí (maggañāṇa)?
Phalañāṇānaṃ aniyyānikabhāvato.
Because the fruit-knowledges are not niyyānika (leading to liberation).
Vì các quả trí (phalañāṇa) không có tính chất xuất ly (aniyyānikabhāvato).
Ariyamaggadhammāyeva hi niyyānikā.
For only the Ariya path-dharmas are niyyānika.
Chỉ có các pháp Thánh đạo (ariyamaggadhammā) mới có tính chất xuất ly (niyyānika).
Vuttañhetaṃ ‘‘katame dhammā niyyānikā?
It has been said: “Which are the niyyānika dharmas?
Điều này đã được nói: "Những pháp nào có tính chất xuất ly?
Cattāro ariyamaggā apariyāpannā’’ti (dha. sa. 1295).
The four Ariya paths, not included (in the three realms).”
Bốn Thánh đạo (ariyamagga) không thuộc về ba cõi (apariyāpannā)."
Tasmā ekanteneva niyyānikabhāvassa ubhato vuṭṭhānabhāvena pavattamānassa anantarapaccayabhūtena ñāṇena nimittato vuṭṭhiteneva bhavitabbanti tassa nibbānārammaṇatā yuttā, na pana ariyamaggassa bhāvitattā tassa vipākabhāvena pavattamānānaṃ kilesānaṃ asamucchindanato aniyyānikattā avuṭṭhānasabhāvānaṃ phalañāṇānaṃ purecārikañāṇassa kadācipi nibbānārammaṇatā ubhayattha anulomañāṇānaṃ atulyākārato.
Therefore, it is appropriate for the knowledge (gotrabhu-ñāṇa) that is an immediate condition for the niyyānika state, which arises by rising from both (the mundane and supramundane), to have Nibbāna as its object, having risen from the sign (of formations). But it is not appropriate for the preceding knowledge of the fruit-knowledges, which are not niyyānika because they do not utterly cut off defilements, and which arise as the result of the Ariya path having been cultivated, and which are of a non-rising nature, to ever have Nibbāna as its object, because the nature of the anuloma-ñāṇas is not the same in both cases.
Vì vậy, trí đi trước (gotrabhuñāṇa) của quả trí, do không có tính chất xuất ly và không đoạn trừ hoàn toàn các phiền não phát sinh như là quả của Thánh đạo đã được tu tập, không thể lấy Nibbāna làm đối tượng trong bất kỳ trường hợp nào, bởi vì các trí thuận thứ (anulomañāṇa) trong cả hai trường hợp (trước đạo trí và trước quả trí) có đặc tính không tương đồng.
Ariyamaggavīthiyañhi anulomañāṇāni anibbiddhapubbānaṃ thūlathūlānaṃ lobhakkhandhādīnaṃ sātisayaṃ padālanena lokiyañāṇena ukkaṃsapāramippattāni maggañāṇānukūlāni uppajjanti, phalasamāpattivīthiyaṃ pana tāni tāni tena tena maggena tesaṃ tesaṃ kilesānaṃ samucchinnattā tattha nirussukkāni kevalaṃ ariyānaṃ phalasamāpattisukhasamaṅgibhāvassa parikammamattāni hutvā uppajjantīti na tesaṃ kutoci vuṭṭhānasambhavo, yato tesaṃ pariyosāne ñāṇaṃ saṅkhāranimittaṃ vuṭṭhānato nibbānārammaṇaṃ siyā.
For in the Ariya path-process, the anuloma-ñāṇas arise as conducive to the path-knowledge, having reached the pinnacle of excellence among mundane knowledges by intensely piercing the gross defilements such as the aggregate of greed, which had not been pierced before. In the fruit-attainment process, however, those same (anuloma-ñāṇas) arise as merely preparatory for the Ariyas’ enjoyment of the bliss of fruit-attainment, being unconcerned with piercing defilements, since those defilements have already been utterly cut off by their respective paths. Therefore, there is no possibility of their rising from anything, such that at their conclusion, knowledge (the gotrabhu-ñāṇa) would be focused on Nibbāna by rising from the sign of formations.
Trong tiến trình Thánh đạo (ariyamaggavīthiyaṃ), các trí thuận thứ (anulomañāṇa) phát sinh, đã đạt đến đỉnh cao của trí thế gian (lokiyañāṇa) bằng cách đoạn trừ một cách đặc biệt các khối tham ái thô thiển chưa từng bị xuyên phá trước đây, và chúng tương thích với đạo trí (maggañāṇa). Còn trong tiến trình nhập quả định (phalasamāpattivīthiyaṃ), do các phiền não đó đã được đoạn trừ hoàn toàn bằng đạo tương ứng, các trí thuận thứ đó trở nên không còn nỗ lực trong việc đoạn trừ phiền não, chỉ là sự chuẩn bị (parikamma) để các bậc Thánh đạt được hạnh phúc của quả định (phalasamāpattisukhasamaṅgibhāvassa), vì vậy không thể có sự xuất ly khỏi bất kỳ điều gì, từ đó trí cuối cùng của chúng có thể lấy Nibbāna làm đối tượng do xuất ly khỏi tướng của các hành (saṅkhāranimittaṃ).
Evañca katvā sekkhassa attano phalasamāpattivaḷañjanatthāya udayabbayādivasena saṅkhāre sammasantassa vipassanāñāṇānupubbāya phalameva uppajjati, na maggoti ayañca attho samatthito hoti.
And having established this, the meaning that for a sekkha, when contemplating formations by way of rise and fall, etc., for the purpose of experiencing their own fruit-attainment, only the fruit arises in sequence with the vipassanā-knowledges, and not the path, is thus confirmed.
Và như vậy, ý nghĩa này được xác lập rằng: khi bậc Hữu Học (sekkhassa) quán chiếu các hành (saṅkhāra) theo cách sinh diệt (udayabbayādivasena) để thọ hưởng quả định của mình, thì chỉ có quả (phala) phát sinh theo tuần tự của các tuệ quán (vipassanāñāṇa), chứ không phải đạo (magga).
Evaṃ tāva phalasamāpattiyā samāpajjanaṃ veditabbaṃ.
Thus, first, the entering of fruit-attainment should be understood.
Như vậy, trước hết, cần phải hiểu sự nhập quả định (phalasamāpattiyā samāpajjanaṃ).
Athāti adhikāratthe nipāto.
Atha is a particle in the sense of 'further' or 'subsequent'.
Athā là một từ phụ (nipāta) mang nghĩa "hơn nữa" (adhikāratthe).
Khoti padapūraṇe.
Kho is for filling out the phrase.
Kho là một từ phụ để làm đầy đủ câu (padapūraṇe).
Tesu adhikāratthena athāti iminā vimuttisukhapaṭisaṃvedanato aññaṃ adhikāraṃ dasseti.
Among these, by the particle atha in the sense of 'further', another subsequent matter is indicated, distinct from the experience of the bliss of liberation.
Trong số đó, với nghĩa "hơn nữa" (adhikāratthe), từ athā này chỉ ra một điều kiện khác ngoài việc cảm nhận niềm an lạc giải thoát.
Ko panesoti?
What is it?
Điều đó là gì?
Paṭiccasamuppādamanasikāro.
It is the attention to paṭiccasamuppāda.
Là sự tác ý đến Duyên Khởi (Paṭiccasamuppāda).
Athāti vā pacchāti etasmiṃ atthe nipāto, tena ‘‘tassa sattāhassa accayenā’’ti vakkhamānameva atthaṃ joteti.
Or, atha is a particle in the sense of 'afterwards'; thereby, it illuminates the meaning of what will be stated: “after the lapse of that week.”
Hoặc athā là một từ phụ mang nghĩa "sau đó" (pacchā). Từ đó, nó làm sáng tỏ ý nghĩa sẽ được nói đến là "sau khi bảy ngày đó trôi qua."
Tassa sattāhassāti pallaṅkasattāhassa.
Tassa sattāhassa means the week of the Bodhi-seat.
Tassa sattāhassa có nghĩa là "của bảy ngày ngồi kiết già (pallaṅkasattāhassa)."
Accayenāti apagamena.
Accayena means by the passing away.
Accayenā có nghĩa là "sau khi trôi qua" (apagamena).
Tamhā samādhimhāti arahattaphalasamādhito.
Tamhā samādhimhā means from that samādhi of Arahantship-fruit.
Tamhā samādhimhā có nghĩa là "từ định của quả A-la-hán (arahattaphalasamādhi)."
Idha pana ṭhatvā paṭipāṭiyā satta sattāhāni dassetabbānīti keci tāni vitthārayiṃsu.
Some here, staying in this context, expounded the seven weeks in sequence, saying they should be shown.
Ở đây, một số người đã mở rộng ra để trình bày bảy tuần lễ theo thứ tự.
Mayaṃ pana tāni khandhakapāṭhena imissā udānapāḷiyā avirodhadassanamukhena parato vaṇṇayissāma.
However, we shall describe them later in accordance with the Khandhaka text, in a way that shows no contradiction with this Udāna Pāḷi.
Tuy nhiên, chúng tôi sẽ giải thích chúng sau, theo văn bản của Khandhaka và theo cách trình bày sự hòa hợp với Kinh Udāna này.
Rattiyāti avayavasambandhe sāmivacanaṃ.
Rattiyā is a genitive case in the sense of a part-whole relationship (of the night).
Rattiyā là cách nói sở hữu (sāmivacanaṃ) trong mối quan hệ bộ phận.
Paṭhamanti accantasaṃyogatthe upayogavacanaṃ.
The word paṭhamaṃ is a term used for the accusative case in the sense of absolute connection.
Paṭhamaṃ là cách dùng đối cách (upayogavacanaṃ) trong nghĩa "liên tục" (accantasaṃyogatthe).
Bhagavā hi tassā rattiyā sakalampi paṭhamaṃ yāmaṃ teneva manasikārena yutto ahosīti.
Indeed, the Blessed One spent the entire first watch of that night engaged in that same mode of attention.
Vì Đức Thế Tôn đã an trụ trong sự tác ý đó suốt cả canh đầu của đêm ấy.
Paṭiccasamuppādanti paccayadhammaṃ.
Paṭiccasamuppāda means the aggregate of causal phenomena.
Paṭiccasamuppādaṃ là pháp nhân duyên (paccayadhammaṃ).
Avijjādayo hi paccayadhammā paṭiccasamuppādo.
Indeed, causal phenomena such as avijjā (ignorance) and so forth are paṭiccasamuppāda.
Các pháp nhân duyên như vô minh (avijjā) v.v... chính là Duyên Khởi (Paṭiccasamuppāda).
Kathamidaṃ jānitabbanti ce?
If one asks, "How is this to be known?"
Nếu hỏi: "Làm sao biết được điều này?"
Bhagavato vacanena.
Through the word of the Blessed One.
Là do lời dạy của Đức Thế Tôn.
Bhagavatā hi ‘‘tasmātihānanda, eseva hetu, etaṃ nidānaṃ, esa samudayo, esa paccayo jarāmaraṇassa, yadidaṃ jāti…pe… saṅkhārānaṃ, yadidaṃ avijjā’’ti (dī. ni. 2.105 ādayo) evaṃ avijjādayo hetūti vuttā.
For the Blessed One stated: "Therefore, Ānanda, this is the reason, this is the origin, this is the arising, this is the condition for old age and death, namely, birth... (abridged)... for formations, namely, avijjā," thus stating that avijjā and so forth are conditions.
Đức Thế Tôn đã dạy rằng các pháp như vô minh (avijjā) là nhân, như trong câu: "Này Ānanda, đây chính là nhân, đây là cội nguồn, đây là sự phát sinh, đây là duyên của già chết, tức là sinh... (v.v.)... của các hành (saṅkhārā), tức là vô minh."
Yathā dvādasa paccayā dvādasa paṭiccasamuppādāti.
Just as the twelve conditions are the twelve paṭiccasamuppādas.
Như mười hai duyên là mười hai Paṭiccasamuppāda (Duyên khởi).
Tatrāyaṃ vacanattho – aññamaññaṃ paṭicca paṭimukhaṃ katvā kāraṇasamavāyaṃ appaṭikkhipitvā sahite uppādetīti paṭiccasamuppādo.
In this context, the etymological meaning is: that which gives rise to associated (phenomena) by making each other a condition, without rejecting the concordance of causes, is paṭiccasamuppāda.
Ở đây, ý nghĩa của từ ngữ là: Paṭiccasamuppāda là sự phát sinh khi nương tựa lẫn nhau, không phủ nhận sự hòa hợp của các nhân, mà cùng nhau tạo ra các pháp đồng sinh.
Atha vā paṭicca paccetabbaṃ paccayārahataṃ paccayaṃ paṭigantvā na vinā tena sambandhassa uppādo paṭiccasamuppādo.
Alternatively, paṭiccasamuppāda is the arising of an effect that is connected to a condition, not without that condition, having approached a condition that is to be understood as a cause and is fit to be a condition.
Hoặc, Paṭiccasamuppāda là sự phát sinh của một mối liên hệ không thể thiếu, sau khi đã tiếp nhận một nhân đáng được nương tựa, một nhân có tính cách duyên.
Paṭiccasamuppādoti cettha samuppādapadaṭṭhānavacanaviññeyyo phalassa uppādanasamatthatāyutto hetu, na paṭiccasamuppattimattaṃ veditabbaṃ.
Here, in "paṭiccasamuppāda," the word "samuppāda" refers to a cause endowed with the ability to produce fruit, and it should not be understood as merely the arising of conditions.
Ở đây, Paṭiccasamuppāda cần được hiểu là nhân có khả năng tạo ra quả, không chỉ là sự phát sinh của các duyên.
Atha vā paccetuṃ arahanti naṃ paṇḍitāti paṭicco, sammā sayameva vā uppādetīti samuppādo, paṭicco ca so samuppādo cāti paṭiccasamuppādoti evamettha attho daṭṭhabbo.
Alternatively, the meaning here should be understood as: paṇḍitas are capable of approaching it, hence it is paṭicca; it arises rightly or by itself, hence it is samuppāda; it is paṭicca and it is samuppāda, thus it is paṭiccasamuppāda.
Hoặc, các bậc hiền trí nên nương tựa vào nó nên gọi là Paṭicca; tự nó sinh ra một cách đúng đắn nên gọi là Samuppāda; nó vừa là Paṭicca vừa là Samuppāda, nên gọi là Paṭiccasamuppāda. Ý nghĩa ở đây cần được hiểu như vậy.
Anulomanti ‘‘avijjāpaccayā saṅkhārā’’tiādinā nayena vutto avijjādiko paccayākāro attanā kattabbakiccakaraṇato anulomoti vuccati.
Anuloma is said to be the causal aspect beginning with avijjā, as described by the method starting with "dependent on avijjā are formations," because it performs its own designated function.
Anuloma (thuận chiều) được gọi như vậy vì cách thức duyên khởi như vô minh (avijjā) v.v., được nói theo cách "do vô minh có các hành (saṅkhārā)" v.v., thực hiện chức năng cần làm của chính nó.
Atha vā ādito paṭṭhāya antaṃ pāpetvā vuttattā pavattiyā vā anulomato anulomo, taṃ anulomaṃ.
Alternatively, it is called anuloma because it is stated from beginning to end, or because of its conformity with occurrence, and that is anuloma.
Hoặc, nó là anuloma vì được nói từ đầu đến cuối, hoặc vì sự vận hành theo chiều thuận.
Sādhukaṃ manasākāsīti sakkaccaṃ manasi akāsi.
Sādhukaṃ manasākāsi means he paid careful attention.
Sādhukaṃ manasākāsi (tác ý kỹ lưỡng) có nghĩa là chú tâm một cách cẩn trọng.
Yo yo paccayadhammo yassa yassa paccayuppannadhammassa yathā yathā hetupaccayādinā paccayabhāvena paccayo hoti, taṃ sabbaṃ aviparītaṃ aparihāpetvā anavasesato paccavekkhaṇavasena citte akāsīti attho.
The meaning is that he thoroughly reflected in his mind, without distortion, without omission, and without remainder, on how each causal phenomenon acts as a condition for its respective dependently arisen phenomenon by way of cause-condition and so forth.
Nghĩa là, Ngài đã tác ý vào tâm tất cả những cách thức mà mỗi pháp duyên là duyên cho mỗi pháp do duyên sinh, như nhân duyên v.v., một cách không sai lạc, không bỏ sót, không còn gì.
Yathā pana bhagavā paṭiccasamuppādānulomaṃ manasākāsi, taṃ saṅkhepena tāva dassetuṃ ‘‘iti imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti vuttaṃ.
And to briefly show how the Blessed One attended to the arising of paṭiccasamuppāda, it is said: "When this exists, that comes to be; with the arising of this, that arises."
Để tóm tắt cách Đức Thế Tôn đã tác ý thuận chiều Duyên khởi, đã nói rằng "Do cái này có mặt, cái kia có; do cái này sinh, cái kia sinh."
Tattha itīti evaṃ, anena pakārenāti attho.
Therein, iti means "thus," or "in this manner."
Trong đó, iti có nghĩa là "như vậy", "theo cách này".
Imasmiṃ sati idaṃ hotīti imasmiṃ avijjādike paccaye sati idaṃ saṅkhārādikaṃ phalaṃ hoti.
Imasmiṃ sati idaṃ hoti means: when this condition, such as avijjā, exists, then this result, such as saṅkhāras, comes to be.
Imasmiṃ sati idaṃ hoti có nghĩa là "khi duyên này, như vô minh (avijjā) v.v., có mặt, thì quả này, như các hành (saṅkhārā) v.v., có."
Imassuppādā idaṃ uppajjatīti imassa avijjādikassa paccayassa uppādā idaṃ saṅkhārādikaṃ phalaṃ uppajjatīti attho.
Imassuppādā idaṃ uppajjati means: with the arising of this condition, such as avijjā, this result, such as saṅkhāras, arises.
Imassuppādā idaṃ uppajjati có nghĩa là "do sự sinh khởi của duyên này, như vô minh (avijjā) v.v., thì quả này, như các hành (saṅkhārā) v.v., sinh khởi."
Imasmiṃ asati idaṃ na hoti, imassa nirodhā idaṃ nirujjhatīti avijjādīnaṃ abhāve saṅkhārādīnaṃ abhāvassa avijjādīnaṃ nirodhe saṅkhārādīnaṃ nirodhassa ca dutiyatatiyasuttavacanena etasmiṃ paccayalakkhaṇe niyamo dassito hoti – imasmiṃ sati eva, nāsati.
By the statement in the second and third suttas, "When this does not exist, that does not come to be; with the cessation of this, that ceases," a rule is shown regarding this characteristic of conditionality: only when this exists, not when it does not exist.
Với câu nói trong kinh thứ hai và thứ ba về "khi cái này không có, cái kia không có; do cái này diệt, cái kia diệt", quy luật trong đặc tính duyên này được chỉ ra là: "chỉ khi cái này có mặt, chứ không phải khi không có."
Imassuppādā eva, nānuppādā.
Only with the arising of this, not with its non-arising.
"Chỉ do cái này sinh, chứ không phải do không sinh."
Anirodhā eva, na nirodhāti.
Only with its non-cessation, not with its cessation.
"Chỉ do cái này không diệt, chứ không phải do diệt."
Tenetaṃ lakkhaṇaṃ antogadhaniyamaṃ idha paṭiccasamuppādassa vuttanti daṭṭhabbaṃ.
Therefore, it should be understood that this characteristic, which contains a rule, is stated here concerning paṭiccasamuppāda.
Vì vậy, đặc tính này, bao hàm quy luật, được nói ở đây là của Paṭiccasamuppāda.
Nirodhoti ca avijjādīnaṃ virāgādhigamena āyatiṃ anuppādo appavatti.
And nirodha (cessation) is the non-arising, the non-occurrence in the future, of avijjā and so forth, through their complete dispassion and attainment.
Và nirodha (sự diệt) có nghĩa là sự không sinh khởi, sự không tiếp diễn trong tương lai của vô minh (avijjā) v.v., thông qua sự ly tham (virāga).
Tathā hi vuttaṃ – ‘‘avijjāya tveva asesavirāganirodhā saṅkhāranirodho’’tiādi.
Thus it is said: "However, with the complete fading away and cessation of avijjā, there is the cessation of saṅkhāras," and so forth.
Quả thật, đã nói rằng: "Chỉ do sự ly tham hoàn toàn và sự diệt của vô minh (avijjā) mà có sự diệt của các hành (saṅkhārā)" v.v.
Nirodhanirodhī ca uppādanirodhībhāvena vutto ‘‘imassa nirodhā idaṃ nirujjhatī’’ti.
And the cessation of cessation is spoken of as the cessation of arising by the phrase "with the cessation of this, that ceases."
Sự đối lập với diệt (nirodha) là sinh (uppāda), và sự sinh này được nói là đối lập với diệt qua câu "do cái này diệt, cái kia diệt".
Tenetaṃ dasseti – anirodho uppādo nāma, so cettha atthibhāvotipi vuccatīti.
Thereby, it shows this meaning: non-cessation is called arising, and that arising is also called existence here.
Do đó, nó chỉ ra ý nghĩa này: cái không diệt (anirodha) được gọi là sự sinh (uppāda), và ở đây nó cũng được gọi là sự hiện hữu.
‘‘Imasmiṃ sati idaṃ hotī’’ti idameva hi lakkhaṇaṃ pariyāyantarena ‘‘imassa uppādā idaṃ uppajjatī’’ti vadantena parena purimaṃ visesitaṃ hoti.
Indeed, by stating this very characteristic in another way with "with the arising of this, that arises," the latter statement qualifies the former.
Quả thật, chính đặc tính "khi cái này có mặt, cái kia có" này đã được làm rõ bởi câu sau "do cái này sinh, cái kia sinh" thông qua một cách diễn đạt khác.
Tasmā na dharamānataṃyeva sandhāya ‘‘imasmiṃ satī’’ti vuttaṃ, atha kho maggena aniruddhabhāvañcāti viññāyati.
Therefore, "when this exists" is not stated merely with reference to its present existence, but it is understood that it also refers to its unceased state by means of the path.
Vì vậy, "khi cái này có mặt" không chỉ được nói để chỉ sự hiện hữu, mà còn để chỉ trạng thái chưa bị diệt bởi Đạo (magga).
Yasmā ca ‘‘imasmiṃ asati idaṃ na hoti, imassa nirodhā idaṃ nirujjhatī’’ti dvidhāpi uddiṭṭhassa lakkhaṇassa niddesaṃ vadantena ‘‘avijjāya tveva asesavirāganirodhā saṅkhāranirodho’’tiādinā nirodho eva vutto, tasmā natthibhāvopi nirodho evāti natthibhāvaviruddho atthibhāvo anirodhoti dassitaṃ hoti.
And since cessation is spoken of in both ways for the characteristic that is stated as "when this does not exist, that does not come to be; with the cessation of this, that ceases," by statements like "with the complete fading away and cessation of avijjā, there is the cessation of saṅkhāras," therefore it is shown that non-existence is also cessation, and that existence, which is contrary to non-existence, is non-cessation.
Và vì, khi nói về sự chỉ định của đặc tính được trình bày theo hai cách "khi cái này không có, cái kia không có; do cái này diệt, cái kia diệt", chỉ có sự diệt (nirodha) được nói đến qua câu "chỉ do sự ly tham hoàn toàn và sự diệt của vô minh (avijjā) mà có sự diệt của các hành (saṅkhārā)" v.v., nên trạng thái không hiện hữu cũng là sự diệt. Như vậy, trạng thái hiện hữu, đối lập với trạng thái không hiện hữu, được chỉ ra là không diệt (anirodha).
Tena anirodhasaṅkhātena atthibhāvena uppādaṃ viseseti.
Thereby, it qualifies arising by existence, which is called non-cessation.
Do đó, nó làm rõ sự sinh (uppāda) bằng trạng thái hiện hữu được gọi là không diệt.
Tato na idha atthibhāvamattaṃ uppādoti attho adhippeto, atha kho anirodhasaṅkhāto atthibhāvo cāti ayamattho vibhāvitoti.
From this, it is not intended that merely existence here is arising, but rather that existence, which is called non-cessation, is also intended, and this meaning is clarified.
Từ đó, ý nghĩa ở đây không phải là chỉ trạng thái hiện hữu đơn thuần là sự sinh (uppāda), mà là trạng thái hiện hữu được gọi là không diệt (anirodha). Ý nghĩa này đã được làm rõ.
Evametaṃ lakkhaṇadvayavacanaṃ aññamaññavisesanavisesitabbabhāvena sātthakanti veditabbaṃ.
Thus, it should be understood that this twofold characteristic statement is meaningful by way of qualifying and being qualified by each other.
Như vậy, hai cách diễn đạt đặc tính này có ý nghĩa vì chúng làm rõ lẫn nhau.
Na hi aggamaggādhigamato uddhaṃ yāva parinibbānā saḷāyatanādīnaṃ appavatti.
For it is not that the six sense bases and so forth do not occur from the attainment of the highest path until parinibbāna.
Quả thật, không phải từ khi đạt được đạo quả tối thượng (aggamagga) cho đến khi nhập Niết Bàn (parinibbāna) mà các sáu xứ (saḷāyatana) v.v. không còn tiếp diễn.
Atha kho natthitā nirodhasaddavacanīyatā khīṇasaṃyojanatāti nirodho vutto.
Rather, cessation is spoken of as non-existence and as being worthy of the term "cessation" because of the destruction of fetters.
Mà chính sự không hiện hữu, sự xứng đáng được gọi là diệt (nirodha) do sự diệt tận kiết sử (khīṇasaṃyojanatā) mới được gọi là diệt.
Apica cirakatampi kammaṃ anibbattitaphalatāya appahīnāhāratāya ca phalārahaṃ santaṃ eva nāma hoti, na nibbattitaphalaṃ, nāpi pahīnāhāranti.
Furthermore, even an action performed long ago is capable of producing results by virtue of its unripened fruit and its unabandoned support, and thus it merely exists, it is not a ripened fruit, nor is its support abandoned.
Hơn nữa, ngay cả nghiệp đã tạo từ lâu, nếu chưa sinh quả và chưa bị đoạn trừ nhân, thì nó vẫn được gọi là có khả năng sinh quả, chứ không phải là đã sinh quả, cũng không phải là nhân đã bị đoạn trừ.
Phaluppattipaccayānaṃ avijjāsaṅkhārādīnaṃ vuttanayeneva phalārahabhāvo anirodhoti veditabbo.
The fitness of avijjā, saṅkhāras, and other causes for the arising of results, in the manner stated, should be understood as non-cessation.
Khả năng sinh quả của các nhân sinh quả như vô minh (avijjā), các hành (saṅkhārā) v.v., theo cách đã nói, cần được hiểu là không diệt (anirodha).
Evaṃ aniruddhabhāveneva hi yena vinā phalaṃ na sambhavati, taṃ kāraṇaṃ atītantipi imasmiṃ satīti iminā vacanena vuttaṃ.
Indeed, in this way, the cause, without which the result does not come to be, even if it is past, is stated by the words "when this exists" precisely by virtue of its unceased state.
Quả thật, chính do trạng thái không diệt này mà nhân, nếu không có nó thì quả không thể sinh khởi, dù đã là quá khứ, cũng được nói bằng câu "khi cái này có mặt".
Tatoyeva ca avusitabrahmacariyassa appavattidhammataṃ anāpanno paccayuppādo kālabhedaṃ anāmasitvā anivattanāya eva imassa uppādāti vutto.
And for this very reason, the origination of a condition, not having attained the state of non-occurrence for one who has not completed the holy life, is spoken of as ‘its arising’ for its non-cessation, without considering any distinction of time.
Và chính vì vậy, sự sinh khởi của duyên, chưa đạt đến trạng thái không tiếp diễn của người chưa sống Phạm hạnh, được nói là "do cái này sinh" mà không đề cập đến sự khác biệt về thời gian, chỉ để chỉ sự không quay trở lại.
Atha vā avasesapaccayasamavāye avijjamānassapi vijjamānassa viya pageva vijjamānassa yā phaluppattiabhimukhatā, sā imassa uppādāti vuttā.
Alternatively, the readiness for the arising of a result, which exists in a manner as if it existed even when it does not, when the remaining conditions are complete, or even more so when it does exist, is called 'its arising'.
Hoặc, sự hướng đến sinh quả, dù không hiện hữu khi các duyên còn lại hòa hợp, nhưng như thể đã hiện hữu từ trước, được gọi là "sự sinh của cái này".
Tathā hi tato phalaṃ uppajjatīti tadavatthaṃ kāraṇaṃ phalassa uppādanabhāvena uṭṭhitaṃ uppatitaṃ nāma hoti, na vijjamānampi atadavatthanti tadavatthatā uppādoti veditabbo.
Indeed, it is said that the result arises from that*; therefore, that very cause, being in the state of producing the result, is said to have arisen or come into being. Thus, even what does not exist is not in that state; hence, the state of being in that condition is to be understood as arising.
Quả thật, từ đó quả sinh khởi. Do đó, nhân ở trạng thái đó, khi trỗi dậy để sinh quả, được gọi là đã sinh. Dù không hiện hữu, nhưng không ở trạng thái đó. Vì vậy, trạng thái đó cần được hiểu là sự sinh.
Tattha satīti iminā vijjamānatāmattena paccayabhāvaṃ vadanto abyāpārataṃ paṭiccasamuppādassa dasseti.
Here, by the word ‘sati’ (there being), by merely stating the existence of the condition, he shows the non-agency of paṭiccasamuppāda.
Trong đó, bằng từ sati (có mặt), khi nói về trạng thái duyên chỉ bằng sự hiện hữu, nó chỉ ra sự không hoạt động của Paṭiccasamuppāda.
Uppādāti uppattidhammataṃ asabbakālabhāvitaṃ phaluppattiabhimukhatañca dīpento aniccataṃ paṭiccasamuppādassa dasseti.
By ‘uppādā’ (from the arising), by illuminating the nature of arising, its not occurring at all times, and its readiness for the arising of the result, he shows the impermanence of paṭiccasamuppāda.
Bằng từ uppādā (do sinh), khi chỉ ra trạng thái có tính chất sinh khởi, sự không hiện hữu ở mọi thời điểm, và sự hướng đến sinh quả, nó chỉ ra tính vô thường (aniccata) của Paṭiccasamuppāda.
‘‘Sati, nāsati, uppādā, na nirodhā’’ti pana hetuatthehi bhummanissakkavacanehi samatthitaṃ nidānasamudayajātipabhavabhāvaṃ paṭiccasamuppādassa dasseti.
Furthermore, by the words ‘‘Sati, nāsati, uppādā, na nirodhā’’ (there being, there not being; from the arising, not from the cessation), which express a causal meaning through locative and ablative cases, he shows paṭiccasamuppāda as being the nidāna (source), samudaya (origin), jāti (birth), and pabhava (origin).
Tuy nhiên, với các từ ngữ ở cách vị trí (locative) và cách xuất xứ (ablative) mang ý nghĩa nhân quả, tức là ‘‘khi có, không phải khi không có; do sự phát sinh, không phải do sự diệt đi’’, thì nó trình bày trạng thái nhân duyên (nidāna), tập khởi (samudaya), sinh khởi (jāti) và phát sinh (pabhava) của Paṭiccasamuppāda đã được xác lập.
Hetuatthatā cettha bhummavacane yassa bhāve tadavinābhāviphalassa bhāvo lakkhīyati, tattha pavattiyā veditabbā yathā ‘‘adhanānaṃ dhane ananuppadīyamāne dāliddiyaṃ vepullaṃ agamāsī’’ti (dī. ni. 3.91) ca ‘‘nipphannesu sassesu subhikkhaṃ jāyatī’’ti ca.
Here, the causal meaning of the locative case is to be understood as applying where, by the existence of something, the existence of its inseparable result is indicated, as in ‘‘When wealth is not given to the poor, poverty will increase’’ and ‘‘When crops are abundant, prosperity arises.’’
Ở đây, ý nghĩa nhân quả trong cách vị trí cần được hiểu là khi sự tồn tại của một điều gì đó được nhận biết, thì sự tồn tại của kết quả không thể tách rời khỏi điều đó cũng được nhận biết, như trong câu ‘‘khi của cải không được phân phát cho người nghèo, sự nghèo đói lan rộng’’ và ‘‘khi mùa màng bội thu, sự sung túc phát sinh’’.
Nissakkavacanassāpi hetuatthatā phalassa pabhave pakatiyañca pavattito yathā ‘‘kalalā hoti abbudaṃ, abbudā jāyatī pesī’’ti (saṃ. ni. 1.235) ca ‘‘himavatā gaṅgā pabhavanti, siṅgato saro jāyatī’’ti ca.
The ablative case also has a causal meaning, due to its occurrence as the origin and nature of the result, as in ‘‘From the morula comes the embryo, from the embryo is born the flesh’’ and ‘‘The Ganges arises from the Himālayas, a lake is born from a peak.’’
Ý nghĩa nhân quả của cách xuất xứ cũng được hiểu là do sự phát sinh của quả và do sự khởi đầu của bản chất, như trong câu ‘‘từ máu đông thành cục thịt, từ cục thịt sinh ra miếng thịt’’ và ‘‘sông Gaṅgā phát nguyên từ Hy Mã Lạp Sơn, từ sừng sinh ra âm thanh’’.
Avijjādibhāve ca tadavinābhāvena saṅkhārādibhāvo lakkhīyati, avijjādīhi ca saṅkhārādayo pabhavanti pakariyanti cāti te tesaṃ pabhavo pakati ca, tasmā tadatthadīpanatthaṃ ‘‘imasmiṃ sati imassa uppādā’’ti hetuatthe bhummanissakkaniddesā katāti.
And by the existence of ignorance (avijjā) and so forth, the existence of formations (saṅkhārā) and so forth is indicated as inseparable from it; and from ignorance and so forth, formations and so forth arise and are produced. Therefore, these (ignorance etc.) are their (formations etc.) origin and nature. For this reason, in order to illuminate that meaning, locative and ablative designations in a causal sense, ‘‘imasmiṃ sati imassa uppādā’’ (when this exists, this arises), are made.
Và khi vô minh (avijjā) và các yếu tố khác hiện hữu, sự hiện hữu của các hành (saṅkhārā) và các yếu tố khác được nhận biết một cách không thể tách rời; và từ vô minh và các yếu tố khác, các hành và các yếu tố khác phát sinh và được tạo ra. Do đó, chúng là nguồn gốc và bản chất của những điều đó. Vì vậy, để làm sáng tỏ ý nghĩa đó, các chỉ định cách vị trí và cách xuất xứ với ý nghĩa nhân quả ‘‘khi có điều này, điều này phát sinh’’ đã được thực hiện.
Yasmā cettha ‘‘imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti saṅkhepena uddiṭṭhassa paṭiccasamuppādassa ‘‘avijjāpaccayā saṅkhārā’’tiādiko niddeso, tasmā yathāvutto atthibhāvo uppādo ca tesaṃ tesaṃ paccayuppannadhammānaṃ paccayabhāvoti viññāyati.
Since the paṭiccasamuppāda, briefly stated as ‘‘When this exists, this comes to be; from the arising of this, this arises,’’ is elucidated here by the exposition beginning with ‘‘avijjāpaccayā saṅkhārā’’ (conditioned by ignorance, formations arise), it is understood that the aforementioned state of being and arising constitute the conditionality of those conditioned phenomena.
Và bởi vì ở đây, Paṭiccasamuppāda được trình bày tóm tắt là ‘‘khi có điều này, điều này xảy ra; do sự phát sinh của điều này, điều này phát sinh’’, thì lời giải thích ‘‘do duyên vô minh mà có các hành’’ v.v. được hiểu là trạng thái hiện hữu và sự phát sinh đó chính là trạng thái duyên của các pháp duyên và pháp do duyên sinh đó.
Na hi aniruddhatāsaṅkhātaṃ atthibhāvaṃ uppādañca anivattasabhāvatāsaṅkhātaṃ udayāvatthatāsaṅkhātaṃ vā ‘‘sati eva, nāsati, uppādā eva, na nirodhā’’ti antogadhaniyamehi vacanehi abhihitaṃ muñcitvā añño paccayabhāvo nāma atthi, tasmā yathāvutto atthibhāvo uppādo ca paccayabhāvoti veditabbaṃ.
For there is no other conditionality apart from the aforementioned state of being (which is the state of non-cessation) and arising (which is the state of not returning or the state of arising), as expressed by the restrictive clauses ‘‘sati eva, nāsati, uppādā eva, na nirodhā’’ (only when it exists, not when it does not; only from its arising, not from its cessation). Therefore, the aforementioned state of being and arising are to be understood as conditionality.
Thật vậy, không có trạng thái duyên nào khác ngoài trạng thái hiện hữu được gọi là không diệt và sự phát sinh được gọi là không ngừng nghỉ, hoặc được gọi là trạng thái khởi sinh, được trình bày bằng những lời nói có quy tắc giới hạn: ‘‘chỉ khi có, không phải khi không có; chỉ do sự phát sinh, không phải do sự diệt đi’’. Do đó, trạng thái hiện hữu và sự phát sinh như đã nói cần được hiểu là trạng thái duyên.
Yepi paṭṭhāne āgatā hetuādayo catuvīsati paccayā, tepi etasseva paccayabhāvassa visesāti veditabbā.
And the twenty-four conditions, such as the root condition (hetu), found in the Paṭṭhāna, are also to be understood as specific distinctions of this very conditionality.
Ngay cả hai mươi bốn duyên như nhân duyên (hetu-paccaya) v.v. được đề cập trong Paṭṭhāna cũng cần được hiểu là những đặc điểm riêng của trạng thái duyên này.
Iti yathā vitthārena anulomaṃ paṭiccasamuppādaṃ manasi akāsi, taṃ dassetuṃ, ‘‘yadidaṃ avijjāpaccayā saṅkhārā’’tiādi vuttaṃ.
Thus, in order to show how the Blessed One contemplated the paṭiccasamuppāda in forward order extensively, the statement beginning with ‘‘yadidaṃ avijjāpaccayā saṅkhārā’’ has been made.
Như vậy, để trình bày cách đã quán xét Paṭiccasamuppāda theo chiều thuận một cách chi tiết, lời nói ‘‘đó là, do duyên vô minh mà có các hành’’ v.v. đã được nói.
Tattha yadidanti nipāto, tassa yo ayanti attho.
Here, yadidaṃ is a particle; its meaning is ‘this which is’.
Trong đó, yadidaṃ là một giới từ, có nghĩa là ‘‘điều này là gì’’.
Avijjāpaccayātiādīsu avindiyaṃ kāyaduccaritādiṃ vindatīti avijjā, vindiyaṃ kāyasucaritādiṃ na vindatīti avijjā, dhammānaṃ aviparītasabhāvaṃ aviditaṃ karotīti avijjā, antavirahite saṃsāre bhavādīsu satte javāpetīti avijjā, avijjamānesu javati vijjamānesu na javatīti avijjā, vijjāya paṭipakkhāti avijjā, sā ‘‘dukkhe aññāṇa’’ntiādinā catubbidhā veditabbā.
Among Avijjāpaccayā and so forth, that which finds what should not be found, such as wrong conduct by body, is avijjā (ignorance); that which does not find what should be found, such as right conduct by body, is avijjā; that which makes the unperverted nature of phenomena unknown is avijjā; that which makes beings rush in existences and so forth in the endless cycle of saṃsāra is avijjā; that which arises among what does not exist (ultimately) and does not arise among what does exist (ultimately) is avijjā; that which is the opposite of vijja (knowledge) is avijjā. This (avijjā) is to be understood as fourfold, as in ‘‘ignorance of suffering’’ and so forth.
Trong các từ Avijjāpaccayā v.v.: ‘‘Avijjā’’ là cái tìm thấy những điều không đáng tìm như thân ác hạnh v.v.; ‘‘avijjā’’ là cái không tìm thấy những điều đáng tìm như thân thiện hạnh v.v.; ‘‘avijjā’’ là cái làm cho bản chất không sai lệch của các pháp trở nên không được biết đến; ‘‘avijjā’’ là cái khiến chúng sinh chạy theo các cõi tái sinh v.v. trong vòng luân hồi vô tận; ‘‘avijjā’’ là cái chạy theo những điều không hiện hữu và không chạy theo những điều hiện hữu; ‘‘avijjā’’ là đối nghịch của minh (vijjā). Vô minh này cần được hiểu là có bốn loại, như ‘‘không biết khổ’’ v.v.
Paṭicca na vinā phalaṃ eti uppajjati ceva pavattati cāti paccayo, upakārakattho vā paccayo.
That, conditioned by which, a result comes to be, arises and persists, is paccaya (condition); or, a condition is a helper.
Cái nương tựa vào (paṭicca) mà quả không thể không sinh khởi và tiếp diễn, đó là paccaya (duyên), hoặc ‘‘paccaya’’ là cái có ý nghĩa hỗ trợ.
Avijjā ca sā paccayo cāti avijjāpaccayo, tasmā avijjāpaccayā.
That which is avijjā and is also a condition is avijjāpaccaya; therefore, avijjāpaccayā (conditioned by ignorance).
Vô minh (avijjā) là duyên, nên là avijjāpaccayo, do đó avijjāpaccayā.
Saṅkharontīti saṅkhārā, lokiyakusalākusalacetanā, sā puññāpuññāneñjābhisaṅkhāravasena tividhā veditabbā.
They fabricate or prepare; therefore, they are saṅkhārā (formations). These are mundane wholesome and unwholesome volitions. This (saṅkhārā) is to be understood as threefold in terms of meritorious (puññābhisaṅkhāra), demeritorious (apuññābhisaṅkhāra), and imperturbable (āneñjābhisaṅkhāra) formations.
Cái tạo tác là saṅkhārā (hành), tức là các ý định thiện và bất thiện thuộc thế gian. Hành này cần được hiểu là có ba loại: phước hành (puññābhisaṅkhāra), phi phước hành (apuññābhisaṅkhāra) và bất động hành (āneñjābhisaṅkhāra).
Vijānātīti viññāṇaṃ, taṃ lokiyavipākaviññāṇavasena dvattiṃsavidhaṃ.
It cognizes; therefore, it is viññāṇaṃ (consciousness). This is thirty-two-fold in terms of mundane resultant consciousness.
Cái biết là viññāṇaṃ (thức), thức này có ba mươi hai loại theo thức quả thuộc thế gian.
Namatīti nāmaṃ, vedanādikkhandhattayaṃ.
It inclines; therefore, it is nāmaṃ (mentality), which is the three aggregates beginning with feeling (vedanā).
Cái nghiêng về là nāmaṃ (danh), tức là ba uẩn: thọ (vedanā), tưởng (saññā) và hành (saṅkhārā).
Ruppatīti rūpaṃ, bhūtarūpaṃ cakkhādiupādārūpañca.
It is afflicted; therefore, it is rūpaṃ (materiality), which includes elemental matter (bhūtarūpa) and dependent matter like the eye (cakkhu).
Cái biến hoại là rūpaṃ (sắc), tức là đại chủng sắc (bhūtarūpa) và các sở y sắc như mắt v.v.
Āyatati āyatañca saṃsāradukkhaṃ nayatīti āyatanaṃ.
It extends (the suffering of saṃsāra) and leads to prolonged saṃsāric suffering; therefore, it is āyatanaṃ (sense-base).
Cái mở rộng (āyatati) và dẫn đến khổ đau luân hồi kéo dài (āyatañca saṃsāradukkhaṃ nayati) là āyatanaṃ (xứ).
Phusatīti phasso.
It contacts; therefore, it is phasso (contact).
Cái xúc chạm là phasso (xúc).
Vedayatīti vedanā.
It feels; therefore, it is vedanā (feeling).
Cái cảm thọ là vedanā (thọ).
Idampi dvayaṃ dvāravasena chabbidhaṃ, vipākavasena gahaṇe chattiṃsavidhaṃ.
These two (contact and feeling) are sixfold by way of their doors, and thirty-six-fold when taken by way of results.
Hai điều này (xúc và thọ) cũng có sáu loại theo cửa giác quan, và ba mươi sáu loại khi được hiểu theo quả dị thục.
Paritassatīti taṇhā, sā kāmataṇhādivasena saṅkhepato tividhā, vitthārato aṭṭhuttarasatavidhā ca.
It yearns intensely; therefore, it is taṇhā (craving). This (taṇhā) is threefold in brief, by way of sensual craving (kāmataṇhā) and so forth, and one hundred and eightfold in detail.
Cái khát khao là taṇhā (ái), ái này tóm tắt có ba loại như dục ái (kāmataṇhā) v.v., và chi tiết có một trăm lẻ tám loại.
Upādīyatīti upādānaṃ, taṃ kāmupādānādivasena catubbidhaṃ.
It is clung to; therefore, it is upādānaṃ (clinging). This (upādāna) is fourfold by way of sensual clinging (kāmupādāna) and so forth.
Cái được chấp thủ là upādānaṃ (thủ), thủ này có bốn loại như dục thủ (kāmupādāna) v.v.
Bhavati bhāvayati cāti bhavo, so kammūpapattibhedato duvidho.
It exists and causes to exist; therefore, it is bhavo (existence). This (bhava) is twofold, distinguished as kamma-bhava (kamma-becoming) and upapatti-bhava (rebirth-becoming).
Cái hiện hữu và tạo ra sự hiện hữu là bhavo (hữu), hữu này có hai loại theo nghiệp hữu (kammabhava) và tái sinh hữu (upapattibhava).
Jananaṃ jāti.
Being born is jāti (birth).
Sự sinh ra là jāti (sinh).
Jīraṇaṃ jarā.
Ageing is jarā (old age).
Sự già đi là jarā (già).
Maranti tenāti maraṇaṃ.
They die because of it; therefore, it is maraṇaṃ (death).
Cái mà do đó chúng sinh chết đi là maraṇaṃ (chết).
Socanaṃ soko.
Grieving is soko (sorrow).
Sự sầu muộn là soko (sầu).
Paridevanaṃ paridevo.
Lamenting is paridevo (lamentation).
Sự than khóc là paridevo (bi).
Dukkhayatīti dukkhaṃ, uppādaṭṭhitivasena dvedhā khaṇatīti dukkhaṃ.
It afflicts; therefore, it is dukkhaṃ (pain). Or, it cuts in two ways, by way of arising and ceasing; therefore, it is dukkha.
Cái gây đau khổ là dukkhaṃ (khổ), hoặc ‘‘dukkhaṃ’’ là cái hủy hoại theo hai cách: sinh và trụ.
Dumanassa bhāvo domanassaṃ.
The state of mental unpleasantness is domanassaṃ (distress).
Trạng thái của tâm bất mãn là domanassaṃ (ưu).
Bhuso āyāso upāyāso.
Intense despair is upāyāso (despair).
Sự phiền não tột độ là upāyāso (não).
Sambhavantīti nibbattanti.
Sambhavanti means they arise.
Sambhavantī có nghĩa là phát sinh.
Na kevalañca sokādīhiyeva, atha kho sabbapadehi ‘‘sambhavantī’’ti padassa yojanā kātabbā.
And the word ‘‘sambhavanti’’ (they arise) is not to be connected only with sorrow and so forth, but with all terms.
Và không chỉ riêng với sầu (soka) v.v., mà từ tất cả các từ đều phải kết hợp với từ ‘‘sambhavantī’’.
Evañhi ‘‘avijjāpaccayā saṅkhārā sambhavantī’’ti paccayapaccayuppannavavatthānaṃ dassitaṃ hoti.
In this way, by ‘‘avijjāpaccayā saṅkhārā sambhavanti’’ (conditioned by ignorance, formations arise), the distinction between condition and conditioned is shown.
Chính như vậy, sự phân định nhân duyên và quả duyên được trình bày là ‘‘do duyên vô minh mà các hành phát sinh’’.
Esa nayo sabbattha.
This method applies everywhere.
Nguyên tắc này áp dụng cho mọi trường hợp.
Tattha aññāṇalakkhaṇā avijjā, sammohanarasā, chādanapaccupaṭṭhānā, āsavapadaṭṭhānā.
Here, avijjā has the characteristic of ignorance, the function of delusion, the manifestation as concealment, and its proximate cause is the āsavas (cankers).
Trong đó, vô minh (avijjā) có đặc tính là không biết, có chức năng làm cho mê mờ, có biểu hiện là che lấp, và có nguyên nhân gần là các lậu hoặc (āsava).
Abhisaṅkharaṇalakkhaṇā saṅkhārā, āyūhanarasā, saṃvidahanapaccupaṭṭhānā, avijjāpadaṭṭhānā.
Saṅkhārā (formations) have the characteristic of fabricating, the function of striving, the manifestation as arranging, and their proximate cause is avijjā.
Các hành (saṅkhārā) có đặc tính là tạo tác, có chức năng là nỗ lực, có biểu hiện là sắp đặt, và có nguyên nhân gần là vô minh.
Vijānanalakkhaṇaṃ viññāṇaṃ, pubbaṅgamarasaṃ, paṭisandhipaccupaṭṭhānaṃ, saṅkhārapadaṭṭhānaṃ, vatthārammaṇapadaṭṭhānaṃ vā.
Viññāṇa (consciousness) has the characteristic of cognizing, the function of being a forerunner, the manifestation as reconnection (paṭisandhi), and its proximate cause is saṅkhārā, or alternatively, the base and object.
Thức (viññāṇa) có đặc tính là nhận biết, có chức năng là dẫn đầu, có biểu hiện là tái tục, và có nguyên nhân gần là các hành, hoặc có nguyên nhân gần là nền t tảng và đối tượng.
Namanalakkhaṇaṃ nāmaṃ, sampayogarasaṃ, avinibbhogapaccupaṭṭhānaṃ, viññāṇapadaṭṭhānaṃ.
Nāma (mentality) has the characteristic of inclining, the function of association, the manifestation as inseparability, and its proximate cause is viññāṇa.
Danh (nāma) có đặc tính là nghiêng về (đối tượng), có chức năng là kết hợp, có biểu hiện là không thể tách rời, và có nguyên nhân gần là thức.
Ruppanalakkhaṇaṃ rūpaṃ, vikiraṇarasaṃ, appaheyyabhāvapaccupaṭṭhānaṃ, viññāṇapadaṭṭhānaṃ.
Rūpa (materiality) has the characteristic of affliction, the function of dispersion, the manifestation as being irreducible, and its proximate cause is viññāṇa.
Sắc (rūpa) có đặc tính là biến hoại, có chức năng là phân tán, có biểu hiện là không thể từ bỏ, và có nguyên nhân gần là thức.
Āyatanalakkhaṇaṃ saḷāyatanaṃ, dassanādirasaṃ, vatthudvārabhāvapaccupaṭṭhānaṃ, nāmarūpapadaṭṭhānaṃ.
Saḷāyatana (six sense-bases) has the characteristic of being a base, the function of seeing and so forth, the manifestation as being a physical base or door, and its proximate cause is nāmarūpa.
Sáu xứ (saḷāyatana) có đặc tính là duyên cho sự sinh khởi (trong luân hồi), có chức năng là thấy v.v., có biểu hiện là nền tảng và cửa giác quan, và có nguyên nhân gần là danh sắc (nāmarūpa).
Phusanalakkhaṇo phasso, saṅghaṭṭanaraso, saṅgatipaccupaṭṭhāno, saḷāyatanapadaṭṭhāno.
Phassa (contact) has the characteristic of touching, the function of impact, the manifestation as conjunction, and its proximate cause is saḷāyatana.
Xúc (phasso) có đặc tính là xúc chạm, có chức năng là va chạm, có biểu hiện là sự kết hợp, và có nguyên nhân gần là sáu xứ.
Anubhavanalakkhaṇā vedanā, visayarasasambhogarasā, sukhadukkhapaccupaṭṭhānā, phassapadaṭṭhānā.
Vedanā (feeling) has the characteristic of experiencing, the function of enjoying the taste of the object, the manifestation as pleasure and pain, and its proximate cause is phassa.
Thọ (vedanā) có đặc tính là cảm nhận, có chức năng là hưởng thụ hương vị của đối tượng, có biểu hiện là lạc và khổ, và có nguyên nhân gần là xúc.
Hetubhāvalakkhaṇā taṇhā, abhinandanarasā, atittibhāvapaccupaṭṭhānā, vedanāpadaṭṭhānā.
Taṇhā (craving) has the characteristic of being a cause, the function of delighting, the manifestation as insatiability, and its proximate cause is vedanā.
Ái (taṇhā) có đặc tính là nhân, có chức năng là hoan hỷ, có biểu hiện là trạng thái không thỏa mãn, và có nguyên nhân gần là thọ.
Gahaṇalakkhaṇaṃ upādānaṃ, amuñcanarasaṃ, taṇhādaḷhattadiṭṭhipaccupaṭṭhānaṃ, taṇhāpadaṭṭhānaṃ.
Upādāna (clinging) has the characteristic of grasping, the function of not letting go, the manifestation as the strength of craving or wrong view, and its proximate cause is taṇhā.
Thủ (upādāna) có đặc tính là chấp giữ, có chức năng là không buông bỏ, có biểu hiện là sự chấp chặt của ái và tà kiến, và có nguyên nhân gần là ái.
Kammakammaphalalakkhaṇo bhavo, bhavanabhāvanaraso, kusalākusalābyākatapaccupaṭṭhāno, upādānapadaṭṭhāno.
Existence (bhava) has the characteristic of kamma and kamma-results, the function of becoming and causing to become, is manifested as wholesome, unwholesome, and indeterminate states, and has grasping (upādāna) as its proximate cause.
Hữu (bhavo) có đặc tính là nghiệp và quả của nghiệp, có chức năng là hiện hữu và tạo ra sự hiện hữu, có biểu hiện là thiện, bất thiện và vô ký, và có nguyên nhân gần là thủ.
Tattha tattha bhave paṭhamābhinibbattilakkhaṇā jāti, niyyātanarasā, atītabhavato idhuppannapaccupaṭṭhānā, dukkhavicittatāpaccupaṭṭhānā vā.
In each and every existence, birth (jāti) has the characteristic of first arising, the function of delivering, is manifested as appearing in this present existence from a past existence, or as the diverse nature of suffering.
Trong mỗi cõi hữu đó, sinh (jāti) có đặc tính là sự tái sinh đầu tiên, có chức năng là dẫn dắt, có biểu hiện là sự phát sinh ở đây từ cõi hữu quá khứ, hoặc có biểu hiện là sự đa dạng của khổ.
Khandhaparipākalakkhaṇā jarā, maraṇūpanayanarasā, yobbanavināsapaccupaṭṭhānā.
Aging (jarā) has the characteristic of maturing, the function of leading towards death, is manifested as the destruction of youth.
Già (jarā) có đặc tính là sự chín muồi của các uẩn, có chức năng là dẫn đến cái chết, có biểu hiện là sự hủy hoại của tuổi trẻ.
Cutilakkhaṇaṃ maraṇaṃ, visaṃyogarasaṃ, gativippavāsapaccupaṭṭhānaṃ.
Death (maraṇa) has the characteristic of falling away, the function of disjoining, is manifested as departure from a state of being.
Chết (maraṇa) có đặc tính là sự chuyển dời, có chức năng là sự chia lìa, có biểu hiện là sự rời bỏ cõi tái sinh.
Antonijjhānalakkhaṇo soko, cetaso nijjhānaraso, anusocanapaccupaṭṭhāno.
Sorrow (soka) has the characteristic of internal burning, the function of mental burning, is manifested as lamenting.
Sầu (soko) có đặc tính là sự thiêu đốt bên trong, có chức năng là sự thiêu đốt của tâm, có biểu hiện là sự than vãn.
Lālappanalakkhaṇo paridevo, guṇadosaparikittanaraso, sambhamapaccupaṭṭhāno.
Lamentation (parideva) has the characteristic of wailing, the function of proclaiming virtues and faults, is manifested as agitation.
Bi (paridevo) có đặc tính là sự than khóc, có chức năng là ca ngợi những điều tốt và xấu, có biểu hiện là sự bối rối.
Kāyapīḷanalakkhaṇaṃ dukkhaṃ, duppaññānaṃ domanassakaraṇarasaṃ, kāyikābādhapaccupaṭṭhānaṃ.
Physical pain (dukkha) has the characteristic of bodily affliction, the function of causing mental distress (domanassa) for the unwise, is manifested as bodily ailment.
Khổ (dukkha) có đặc tính là sự đau đớn về thân, có chức năng là gây ra ưu cho những người thiếu trí tuệ, có biểu hiện là sự khó chịu về thân thể.
Cittapīḷanalakkhaṇaṃ domanassaṃ, manovighātanarasaṃ, mānasabyādhipaccupaṭṭhānaṃ.
Mental distress (domanassa) has the characteristic of mental affliction, the function of mental vexation, is manifested as mental sickness.
Ưu (domanassa) có đặc tính là sự đau đớn về tâm, có chức năng là sự hủy hoại của ý, có biểu hiện là bệnh tật về tâm.
Cittaparidahanalakkhaṇo upāyāso, nitthunanaraso, visādapaccupaṭṭhāno.
Despair (upāyāsa) has the characteristic of intense mental burning, the function of sighing, is manifested as dejection.
Não (upāyāso) có đặc tính là sự thiêu đốt của tâm, có chức năng là sự rên rỉ, có biểu hiện là sự chán nản.
Evamete avijjādayo lakkhaṇāditopi veditabbāti.
Thus, these ignorance (avijjā) and so on, should also be known from their characteristics, etc.
Như vậy, vô minh và các yếu tố khác cần được hiểu theo đặc tính của chúng.
Ayamettha saṅkhepo, vitthāro pana sabbākārasampannaṃ vinicchayaṃ icchantena sammohavinodaniyā (vibha. aṭṭha. 225) vibhaṅgaṭṭhakathāya gahetabbo.
This is the brief account here. For the detailed explanation, one who desires a comprehensive analysis should refer to the Vibhaṅgaṭṭhakathā, called Sammohavinodanī (Vbha.a. 225).
Đây là phần tóm tắt, còn phần chi tiết thì người muốn có sự phân định hoàn hảo về mọi khía cạnh nên tham khảo từ Vibhaṅgaṭṭhakathā (VibhA. 225) được gọi là Sammohavinodanī.
Tassattho – yadāti yasmiṃ kāle.
Its meaning: ‘yadā’ means at what time.
Ý nghĩa của lời cảm hứng đó là: Yadā (Khi) nghĩa là, vào thời điểm nào.
Haveti byattanti imasmiṃ atthe nipāto.
‘Have’ is a particle here in the sense of 'certainly'.
Have là một giới từ trong ý nghĩa “rõ ràng”.
Keci pana ‘‘haveti āhave yuddhe’’ti atthaṃ vadanti, ‘‘yodhetha māraṃ paññāvudhenā’’ti (dha. pa. 40) vacanato kilesamārena yujjhanasamayeti tesaṃ adhippāyo.
Some, however, interpret ‘have’ as ‘in battle, in war’, their intention being that it is the time of fighting with the defilement-Māra, in accordance with the saying: “Fight Māra with the weapon of wisdom.”
Tuy nhiên, một số người giải thích rằng “have” có nghĩa là “trong chiến trận”, ý của họ là vào thời điểm chiến đấu với phiền não ma (kilesamāra), theo câu “Hãy chiến đấu với ma bằng vũ khí trí tuệ” (Dhp. 40).
Pātubhavantīti uppajjanti.
‘Pātubhavanti’ means arise.
Pātubhavanti (xuất hiện) nghĩa là, sinh khởi.
Dhammāti anulomapaccayākārapaṭivedhasādhakā bodhipakkhiyadhammā.
‘Dhammā’ means the Bodhipakkhiyadhammas that bring about the penetration of the causal sequence in direct order (anuloma-paccayākāra).
Dhammā (các pháp) nghĩa là, các pháp giác chi (bodhipakkhiyadhammā) hỗ trợ cho sự thâm nhập vào các khía cạnh của duyên thuận chiều.
Atha vā pātubhavantīti pakāsenti, abhisamayavasena byattā pākaṭā honti.
Or else, ‘pātubhavanti’ means become manifest, become clear and evident through realization.
Hoặc pātubhavanti (xuất hiện) nghĩa là, hiển lộ, trở nên rõ ràng, hiển nhiên qua sự thâm nhập (abhisamaya).
Dhammāti catuariyasaccadhammā, ātāpo vuccati kilesasantāpanaṭṭhena vīriyaṃ.
‘Dhammā’ means the four Noble Truths. Zeal (ātāpo) is called energy (vīriya) by reason of burning up defilements.
Dhammā (các pháp) nghĩa là, các pháp Tứ Diệu Đế (catuariyasaccadhammā). Ātāpo (nhiệt tâm) được gọi là tinh tấn (vīriya) vì nó làm thiêu đốt các phiền não.
Ātāpinoti sammappadhānavīriyavato.
‘Ātāpino’ means one who possesses the energy of right endeavor.
Ātāpino (người có nhiệt tâm) nghĩa là, người có chánh tinh tấn (sammappadhānavīriya).
Jhāyatoti ārammaṇūpanijjhānena lakkhaṇūpanijjhānena jhāyantassa.
‘Jhāyato’ means one who meditates with jhāna of observing the object and jhāna of observing the characteristics.
Jhāyato (người thiền định) nghĩa là, người thiền định bằng sự quán sát đối tượng (ārammaṇūpanijjhāna) và sự quán sát đặc tính (lakkhaṇūpanijjhāna).
Brāhmaṇassāti bāhitapāpassa khīṇāsavassa.
‘Brāhmaṇassa’ means one who has banished evil, an arahant (khīṇāsava).
Brāhmaṇassa (của vị Bà-la-môn) nghĩa là, của vị A-la-hán đã loại bỏ ác pháp (bāhitapāpassa), đã diệt trừ lậu hoặc (khīṇāsavassa).
Athassa kaṅkhā vapayanti sabbāti athassa evaṃ pātubhūtadhammassa yā etā ‘‘ko nu kho, bhante, phusatīti.
‘Athassa kaṅkhā vapayanti sabbā’ means then all his doubts, which are stated concerning the causal sequence in such a way as, “Venerable Sir, who indeed touches? The Blessed One said, ‘The question is not appropriate,’”
Athassa kaṅkhā vapayanti sabbā (Rồi tất cả mọi nghi ngờ của vị ấy đều tan biến) nghĩa là, tất cả những nghi ngờ về duyên khởi đã được nói đến theo cách như “Bạch Thế Tôn, ai là người chạm đến?” “Đức Thế Tôn đã nói rằng đó không phải là câu hỏi đúng” (Saṃ. Ni. 2.12),
No kallo pañhoti bhagavā avocā’’tiādinā (saṃ. ni. 2.12) nayena, ‘‘katamaṃ nu kho, bhante, jarāmaraṇaṃ, kassa ca panidaṃ jarāmaraṇanti.
and in such a way as, “Venerable Sir, what indeed is aging and death? And to whom does this aging and death belong? The Blessed One said, ‘The question is not appropriate,’”
và theo cách như “Bạch Thế Tôn, già chết là gì? Già chết này thuộc về ai?” “Đức Thế Tôn đã nói rằng đó không phải là câu hỏi đúng” (Saṃ. Ni. 2.35),
No kallo pañhoti bhagavā avocā’’tiādinā (saṃ. ni. 2.35) nayena paccayākāre kaṅkhā vuttā, yā ca paccayākārasseva appaṭividdhattā ‘‘ahosiṃ nu kho ahaṃ atītamaddhāna’’ntiādinā (ma. ni. 1.18; saṃ. ni. 2.20) soḷasa kaṅkhā āgatā.
and also the sixteen doubts that arose due to the non-penetration of the causal sequence itself, in such a way as, “Was I indeed in the past?”
cũng như mười sáu loại nghi ngờ đã được đề cập theo cách “Ta đã từng tồn tại trong quá khứ chăng?” (Ma. Ni. 1.18; Saṃ. Ni. 2.20) do chưa thâm nhập được duyên khởi.
Tā sabbā vapayanti apagacchanti nirujjhanti.
All those cease, vanish, and are extinguished.
Tất cả những nghi ngờ đó đều tan biến, biến mất, diệt trừ.
Yato pajānāti sahetudhammaṃ, yasmā avijjādikena hetunā sahetukaṃ imaṃ saṅkhārādikaṃ kevalaṃ dukkhakkhandhadhammaṃ pajānāti aññāsi paṭivijjhīti.
‘Yato pajānāti sahetudhammaṁ,’ because he knows, he comprehends, he penetrates this entire aggregate of suffering, which comprises formations (saṅkhāra) and so on, and is with a cause, due to causes such as ignorance (avijjā) and so on.
Yato pajānāti sahetudhammaṃ (Vì vị ấy liễu tri pháp có nguyên nhân), vì vị ấy liễu tri, thấu hiểu, thâm nhập pháp duyên khởi này, khối khổ uẩn gồm các hành (saṅkhāra) v.v., có nguyên nhân là vô minh (avijjā) v.v., là hoàn toàn khổ.
Ayampi udāno vutto bhagavatā iti me sutanti ayaṃ pāḷi kesuciyeva potthakesu dissati.
‘Ayampi udāno vutto bhagavatā iti me sutaṁ’ – this Pali text is found only in some manuscripts.
Ayampi udāno vutto Bhagavatā iti me sutaṃ (Lời cảm hứng này cũng đã được Đức Thế Tôn nói, tôi nghe như vậy) – câu Pāḷi này chỉ xuất hiện trong một số bản kinh.
Tattha ayampīti pisaddo ‘‘idampi buddhe ratanaṃ paṇītaṃ, ayampi pārājiko hotī’’tiādīsu viya sampiṇḍanattho, tena uparimaṃ sampiṇḍeti.
There, in ‘ayampi’, the particle ‘pi’ has the meaning of inclusion, as in “This gem, the Buddha, is excellent. This monk also becomes defeated,” and so on, thereby including what follows.
Ở đó, ayampi (cũng vậy) – từ “pi” có nghĩa là tổng hợp, như trong “Idampi Buddhe ratanaṃ paṇītaṃ, ayampi pārājiko hotī” (Đây cũng là một viên ngọc quý trong Đức Phật, đây cũng là một tội Pārājika), v.v. Do đó, nó tổng hợp các lời cảm hứng tiếp theo.
Vuttoti ayaṃ vuttasaddo kesohāraṇavappanavāpasamīkaraṇajīvitavuttipamuttabhāvapāvacanabhāvena pavattana ajjhenakathanādīsu dissati.
In ‘vutto’, this word ‘vutta’ is seen in the meanings of shaving hair, sowing, leveling, livelihood, being released, verbal expression, reciting, and speaking.
Vutto (được nói) – từ “vutta” này được thấy trong các ý nghĩa như cạo tóc, gieo trồng, san bằng, sinh kế, giải thoát, được nói ra như một lời nói, học thuộc lòng, kể, v.v.
Tathā hesa ‘‘kāpaṭiko māṇavo daharo vuttasiro’’tiādīsu (ma. ni. 2.426) kesohāraṇe āgato.
For instance, it occurs in the sense of shaving hair in phrases like, “A young, deceitful Brahmin boy with a shaven head,” and so on.
Thật vậy, nó xuất hiện trong ý nghĩa cạo tóc trong các câu như “Kāpaṭiko māṇavo daharo vuttasiro” (Maṇava trẻ tuổi, đầu đã cạo) v.v.
Ādīsu (jā. 2.22.19) vappane.
And so on, in the sense of sowing.
Nó xuất hiện trong ý nghĩa gieo trồng trong các câu như trên (Jā. 2.22.19).
‘‘No ca kho paṭivutta’’ntiādīsu (pārā. 289) aṭṭhadaṇḍakādīhi vāpasamīkaraṇe.
In phrases like, “Not indeed leveled,” and so on, in the sense of leveling with an eight-pronged harrow, etc.
Nó xuất hiện trong ý nghĩa san bằng bằng tám răng cào v.v., trong các câu như “No ca kho paṭivuttaṃ” (Nhưng không được san bằng) v.v.
‘‘Pannalomo paradattavutto migabhūtena cetasā viharāmī’’tiādīsu (cūḷava. 332) jīvitavuttiyaṃ.
In phrases like, “With plucked hair, living on what others give, I dwell with a mind like a wild animal,” and so on, in the sense of livelihood.
Nó xuất hiện trong ý nghĩa sinh kế trong các câu như “Pannalomo paradattavutto migabhūtena cetasā viharāmī” (Tôi sống với tâm như loài thú, lông đã rụng, sống nhờ vật bố thí của người khác) v.v.
‘‘Paṇḍupalāso bandhanā pavutto abhabbo haritattāyā’’tiādīsu (pārā. 92) bandhanato pamuttabhāve.
In phrases like, “A yellow leaf released from its stem cannot become green again,” and so on, in the sense of being released from a bond.
Nó xuất hiện trong ý nghĩa giải thoát khỏi sự ràng buộc trong các câu như “Paṇḍupalāso bandhanā pavutto abhabbo haritattāyā” (Lá vàng đã lìa cành thì không thể xanh trở lại) v.v.
‘‘Gītaṃ vuttaṃ samīhita’’ntiādīsu (dī. ni. 1.285) pāvacanabhāvena pavattite.
In phrases like, “A song uttered, intended,” and so on, in the sense of expressing verbally.
Nó xuất hiện trong ý nghĩa được nói ra như một lời nói trong các câu như “Gītaṃ vuttaṃ samīhitaṃ” (Lời ca đã được nói ra, đã được mong muốn) v.v.
‘‘Vutto pārāyaṇo’’tiādīsu ajjhene.
In phrases like ‘‘Vutto pārāyaṇo’’, it means recitation.
Nó xuất hiện trong ý nghĩa học thuộc lòng trong các câu như “Vutto pārāyaṇo” (Người đã học thuộc lòng Pārāyaṇa).
‘‘Vuttaṃ kho panetaṃ bhagavatā ‘dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’’tiādīsu (ma. ni. 1.30) kathane.
In phrases like ‘‘Vuttaṃ kho panetaṃ bhagavatā ‘dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’’, it means speaking.
Nó xuất hiện trong ý nghĩa kể trong các câu như “Vuttaṃ kho panetaṃ Bhagavatā ‘Dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’” (Thật vậy, điều này đã được Đức Thế Tôn nói: ‘Này các Tỳ-kheo, hãy là người thừa kế Pháp của Ta, đừng là người thừa kế vật chất’) v.v.
Idhāpi kathane eva daṭṭhabbo, tena ayampi udāno bhāsitoti attho.
Here too, it should be understood as speaking; thus, the meaning is that this Udāna was also spoken.
Ở đây, nó cũng nên được hiểu theo ý nghĩa kể. Do đó, ý nghĩa là lời cảm hứng này cũng đã được nói.
Itīti evaṃ.
Iti means thus.
Iti (như vậy) nghĩa là, như thế này.
Me sutanti padadvayassa attho nidānavaṇṇanāyaṃ sabbākārato vuttoyeva.
The meaning of the two words me sutaṃ has already been fully explained in the Nidāna-vaṇṇanā.
Ý nghĩa của hai từ me sutaṃ (tôi nghe như vậy) đã được giải thích đầy đủ trong phần chú giải về duyên khởi (nidānavaṇṇanā).
Pubbe ‘‘evaṃ me suta’’nti nidānavasena vuttoyeva hi attho idha nigamanavasena ‘‘iti me suta’’nti puna vutto.
Indeed, the meaning previously stated as ‘‘evaṃ me sutaṃ’’ in the sense of the introduction is here stated again as ‘‘iti me sutaṃ’’ in the sense of conclusion.
Thật vậy, ý nghĩa đã được nói đến trước đây theo cách duyên khởi là “Evaṃ me sutaṃ” (Tôi nghe như vậy), nay lại được nói đến một lần nữa theo cách kết luận là “Iti me sutaṃ” (Tôi nghe như vậy).
Vuttasseva hi atthassa puna vacanaṃ nigamananti.
For, the repetition of a meaning already stated is a conclusion.
Thật vậy, việc lặp lại ý nghĩa đã được nói là kết luận.
Itisaddassa atthuddhāro evaṃ-saddena samānatthatāya ‘‘evaṃ me suta’’nti ettha viya, atthayojanā ca itivuttakavaṇṇanāya amhehi pakāsitāyevāti tattha vuttanayeneva veditabboti.
The extraction of the meaning of the word iti is, as in ‘‘evaṃ me sutaṃ’’, due to its synonymity with the word evaṃ, and its application of meaning has already been explained by us in the Itivuttaka-vaṇṇanā; thus, it should be understood in the manner stated there.
Sự giải thích ý nghĩa của từ “iti” cũng giống như trong “Evaṃ me sutaṃ” (Tôi nghe như vậy) vì nó có cùng ý nghĩa với từ “evaṃ” (như vậy), và sự áp dụng ý nghĩa đã được chúng tôi trình bày trong chú giải Itivuttaka, nên cần được hiểu theo cách đã nói ở đó.
2. Dutiye paṭilomanti ‘‘avijjānirodhā saṅkhāranirodho’’tiādinā nayena vutto avijjādikoyeva paccayākāro anuppādanirodhena nirujjhamāno attano kattabbakiccassa akaraṇato paṭilomoti vuccati.
2. In the second sutta, paṭilomaṃ means the causal condition of avijjā and so forth, as stated in the manner of ‘‘with the cessation of avijjā, there is the cessation of saṅkhāras’’, which, ceasing through non-arising and complete cessation, is called paṭiloma because it does not perform its function.
Trong kinh thứ hai, paṭilomaṃ (nghịch chiều) nghĩa là, chính duyên khởi được nói đến theo cách “Do vô minh diệt nên hành diệt” v.v., khi diệt trừ bằng sự diệt không sinh khởi (anuppādanirodha), được gọi là nghịch chiều vì không thực hiện chức năng cần làm của chính nó.
Pavattiyā vā vilomanato paṭilomo, antato pana majjhato vā paṭṭhāya ādiṃ pāpetvā avuttattā ito aññenatthenettha paṭilomatā na yujjati.
Or, it is paṭiloma because it is contrary to the process of existence. However, since it is not stated starting from the end or from the middle and bringing it to the beginning, paṭilomatā in any other sense is not appropriate here.
Hoặc nó là nghịch chiều vì ngược lại với sự tiếp diễn. Tuy nhiên, ở đây, sự nghịch chiều không phù hợp với bất kỳ ý nghĩa nào khác ngoài ý nghĩa đã nói, vì nó không được nói là bắt đầu từ cuối cùng hoặc từ giữa để đạt đến khởi đầu.
Paṭilomanti ca ‘‘visamaṃ candasūriyā parivattantī’’tiādīsu viya bhāvanapuṃsakaniddeso.
And paṭilomaṃ is an indication of the bhāvanapuṃsaka (neuter verbal noun) as in ‘‘the moon and sun revolve irregularly’’.
Và paṭilomaṃ là một từ chỉ giống trung tính (bhāvanapuṃsakaniddesa), như trong các câu “Mặt trăng và mặt trời xoay chuyển bất thường (visamaṃ candasūriyā parivattanti)” v.v.
Imasmiṃ asati idaṃ na hotīti imasmiṃ avijjādike paccaye asati maggena pahīne idaṃ saṅkhārādikaṃ phalaṃ na hoti nappavattati.
Imasmiṃ asati idaṃ na hoti means: when this cause, avijjā and so forth, is absent, being abandoned by the path, this result, saṅkhāras and so forth, does not occur, does not proceed.
Imasmiṃ asati idaṃ na hoti (Khi cái này không có, cái kia không có) nghĩa là, khi duyên vô minh (avijjā) v.v., này không có, đã được diệt trừ bằng đạo, thì quả hành (saṅkhāra) v.v., này không sinh khởi, không tiếp diễn.
Imassa nirodhā idaṃ nirujjhatīti imassa avijjādikassa paccayassa nirodhā maggena anuppattidhammataṃ āpāditattā idaṃ saṅkhārādikaṃ phalaṃ nirujjhati, nappavattatīti attho.
Imassa nirodhā idaṃ nirujjhati means: due to the cessation of this cause, avijjā and so forth, having been brought to the state of non-arising by the path, this result, saṅkhāras and so forth, ceases, does not proceed. This is the meaning.
Imassa nirodhā idaṃ nirujjhati (Do cái này diệt nên cái kia diệt) nghĩa là, do sự diệt trừ duyên vô minh (avijjā) v.v., này, đã được đưa về trạng thái không sinh khởi bằng đạo, thì quả hành (saṅkhāra) v.v., này diệt trừ, không tiếp diễn.
Idhāpi yathā ‘‘imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti ettha ‘‘imasmiṃ satiyeva, nāsati, imassa uppādā eva, na nirodhā’’ti antogadhaniyamatā dassitā.
Here too, just as in ‘‘when this exists, this comes to be; with the arising of this, this arises’’, the implicit certainty was shown as ‘‘only when this exists, not when it does not exist; only with the arising of this, not with its cessation.’’
Ở đây cũng vậy, như trong câu “Imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjati” (Khi cái này có, cái kia có; do cái này sinh, cái kia sinh), sự giới hạn nội tại được chỉ ra là “chỉ khi cái này có, không phải khi không có; chỉ do cái này sinh, không phải do cái này diệt”.
Evaṃ imasmiṃ asatiyeva, na sati, imassa nirodhā eva, na uppādāti antogadhaniyamatālakkhaṇā dassitāti veditabbaṃ.
Similarly, it should be understood that the characteristic of implicit certainty is shown as ‘‘only when this is absent, not when it exists; only with the cessation of this, not with its arising.’’
Tương tự, cần hiểu rằng ở đây, đặc tính của sự giới hạn nội tại được chỉ ra là “chỉ khi cái này không có, không phải khi có; chỉ do cái này diệt, không phải do cái này sinh”.
Sesamettha yaṃ vattabbaṃ, taṃ paṭhamabodhisuttavaṇṇanāya vuttanayānusārena veditabbaṃ.
Whatever else needs to be said here should be understood according to the method stated in the commentary on the first Bodhi Sutta.
Những gì còn lại cần nói ở đây, nên được hiểu theo cách đã được trình bày trong phần chú giải kinh Paṭhamabodhi.
Evaṃ yathā bhagavā paṭilomapaṭiccasamuppādaṃ manasi akāsi, taṃ saṅkhepena dassetvā idāni vitthārena dassetuṃ ‘‘avijjānirodhā saṅkhāranirodho’’tiādi vuttaṃ.
Having thus briefly shown how the Blessed One attended to the dependent origination in reverse order, it is now said, “With the cessation of ignorance, volitional formations cease,” and so on, in order to show it in detail.
Như vậy, sau khi đã trình bày tóm tắt cách Thế Tôn quán chiếu Duyên Khởi theo chiều nghịch (paṭiloma-paṭiccasamuppāda), bây giờ để trình bày chi tiết, đoạn kinh “Do vô minh diệt nên hành diệt” v.v. đã được nói đến.
Tattha avijjānirodhāti ariyamaggena avijjāya anavasesanirodhā, anusayappahānavasena aggamaggena avijjāya accantasamugghāṭatoti attho.
There, “with the cessation of ignorance” means the complete cessation of ignorance through the noble path, that is, the utter eradication of ignorance by the highest path (arahattamagga) through the abandoning of latent tendencies.
Trong đó, “do vô minh diệt” có nghĩa là do sự diệt tận vô minh không còn sót lại bằng Thánh đạo, nghĩa là do sự nhổ tận gốc vô minh bằng A-la-hán đạo theo cách đoạn trừ các tùy miên.
Yadipi heṭṭhimamaggehi pahīyamānā avijjā accantasamugghāṭavaseneva pahīyati, tathāpi na anavasesato pahīyati.
Although ignorance is abandoned by the lower paths through utter eradication, it is not abandoned completely.
Mặc dù vô minh được đoạn trừ bằng các đạo thấp hơn cũng được đoạn trừ theo cách nhổ tận gốc, nhưng nó không được đoạn trừ hoàn toàn không còn sót lại.
Apāyagāminiyā hi avijjā paṭhamamaggena pahīyati.
For ignorance leading to the lower realms is abandoned by the first path (sotāpattimagga).
Thật vậy, vô minh dẫn đến khổ cảnh được đoạn trừ bằng đạo thứ nhất (Tu-đà-hoàn đạo).
Tathā sakideva imasmiṃ loke sabbattha ca anariyabhūmiyaṃ upapattipaccayabhūtā avijjā yathākkamaṃ dutiyatatiyamaggehi pahīyati, na itarāti.
Similarly, ignorance that is a condition for rebirth in this sense-sphere existence and in all ignoble realms at once is abandoned by the second and third paths respectively, but not the other.
Tương tự, vô minh là nhân duyên cho sự tái sinh chỉ một lần trong cõi này và khắp các cõi bất thiện được đoạn trừ lần lượt bằng đạo thứ hai và thứ ba, chứ không phải các loại vô minh khác.
Arahattamaggeneva hi sā anavasesaṃ pahīyatīti.
For it is by the Arahantship Path (arahattamagga) that it is completely abandoned.
Chỉ bằng A-la-hán đạo, nó mới được đoạn trừ hoàn toàn không còn sót lại.
Saṅkhāranirodhoti saṅkhārānaṃ anuppādanirodho hoti.
“Cessation of volitional formations” means the cessation of volitional formations through non-arising.
“Hành diệt” có nghĩa là sự diệt trừ các hành, tức là sự không tái sinh của các hành.
Evaṃ niruddhānaṃ pana saṅkhārānaṃ nirodhā viññāṇaṃ, viññāṇādīnañca nirodhā nāmarūpādīni niruddhāni eva hontīti dassetuṃ ‘‘saṅkhāranirodhā viññāṇanirodho’’tiādiṃ vatvā ‘‘evametassa kevalassa dukkhakkhandhassa nirodho hotī’’ti vuttaṃ.
In order to show that with the cessation of such ceased volitional formations, consciousness ceases, and with the cessation of consciousness and so on, mentality-materiality and so on also cease, it is said, “With the cessation of volitional formations, consciousness ceases,” and so on, and then it is said, “Thus there is the cessation of this entire mass of suffering.”
Để chỉ ra rằng khi các hành đã diệt như vậy, thì thức cũng diệt, và do thức v.v. diệt nên danh-sắc v.v. cũng diệt, nên sau khi nói “do hành diệt nên thức diệt” v.v., đoạn kinh “như vậy, toàn bộ khối khổ này diệt tận” đã được nói đến.
Tattha yaṃ vattabbaṃ, taṃ heṭṭhā vuttanayameva.
What needs to be said there is the same as what was said earlier.
Những gì cần nói ở đây cũng giống như cách đã nói ở trên.
Apicettha kiñcāpi ‘‘avijjānirodhā saṅkhāranirodho, saṅkhāranirodhā viññāṇanirodho’’ti ettāvatāpi sakalassa dukkhakkhandhassa anavasesato nirodho vutto hoti, tathāpi yathā anulome yassa yassa paccayadhammassa atthitāya yo yo paccayuppannadhammo na nirujjhati pavattati evāti imassa atthassa dassanatthaṃ ‘‘avijjāpaccayā saṅkhārā…pe… samudayo hotī’’ti vuttaṃ.
Furthermore, even though here, by saying, “With the cessation of ignorance, volitional formations cease; with the cessation of volitional formations, consciousness ceases,” the complete cessation of the entire mass of suffering is stated, yet just as in the direct order, it was said, “With ignorance as condition, volitional formations arise… and so on… there is the origin,” to show that due to the existence of each conditioning phenomenon, each conditioned phenomenon does not cease but continues to arise.
Hơn nữa, mặc dù ở đây, chỉ với câu “do vô minh diệt nên hành diệt, do hành diệt nên thức diệt” cũng đã nói lên sự diệt tận hoàn toàn của toàn bộ khối khổ, nhưng giống như trong chiều thuận, để chỉ rõ ý nghĩa rằng “do sự hiện hữu của nhân duyên pháp này nên quả duyên sinh pháp kia không diệt mà tiếp tục tồn tại”, nên đã nói “do vô minh duyên nên có hành…v.v…khởi lên”.
Evaṃ tappaṭipakkhato tassa tassa paccayadhammassa abhāve so so paccayuppannadhammo nirujjhati nappavattatīti dassanatthaṃ idha ‘‘avijjānirodhā saṅkhāranirodho, saṅkhāranirodhā viññāṇanirodho…pe… dukkhakkhandhassa nirodho hotī’’ti vuttaṃ, na pana anulome viya kālattayapariyāpannassa dukkhakkhandhassa nirodhadassanatthaṃ.
Similarly, to show that, conversely, in the absence of each conditioning phenomenon, each conditioned phenomenon ceases and does not arise, it is said here, “With the cessation of ignorance, volitional formations cease; with the cessation of volitional formations, consciousness ceases… and so on… there is the cessation of the mass of suffering,” and not, as in the direct order, to show the cessation of the mass of suffering pertaining to all three times.
Tương tự, để chỉ rõ rằng theo chiều ngược lại, khi không có nhân duyên pháp kia thì quả duyên sinh pháp kia sẽ diệt và không tiếp tục tồn tại, nên ở đây đã nói “do vô minh diệt nên hành diệt, do hành diệt nên thức diệt…v.v…toàn bộ khối khổ này diệt tận”, chứ không phải để chỉ sự diệt tận của khối khổ thuộc ba thời như trong chiều thuận.
Anāgatasseva hi ariyamaggabhāvanāya asati uppajjanārahassa dukkhakkhandhassa ariyamaggabhāvanāya nirodho icchitoti ayampi viseso veditabbo.
For the cessation of the mass of suffering, which is capable of arising in the future if the noble path is not cultivated, is desired through the cultivation of the noble path; this distinction should also be understood.
Thật vậy, sự diệt tận của khối khổ đáng lẽ sẽ sinh khởi trong tương lai nếu không có sự tu tập Thánh đạo, được mong muốn là do sự tu tập Thánh đạo. Đây cũng là một điểm khác biệt cần được hiểu.
3. Tatiye anulomapaṭilomanti anulomañca paṭilomañca, yathāvuttaanulomavasena ceva paṭilomavasena cāti attho.
3. In the third, “in direct and reverse order” (anulomapaṭilomaṃ) means both in direct and reverse order, that is, in the manner of the direct order and in the manner of the reverse order as stated.
Trong kinh thứ ba, “chiều thuận và chiều nghịch” (anulomapaṭilomaṃ) có nghĩa là theo chiều thuận và chiều nghịch, tức là theo cách chiều thuận và chiều nghịch như đã nói.
Nanu ca pubbepi anulomavasena paṭilomavasena ca paṭiccasamuppāde manasikārappavatti suttadvaye vuttā, idha kasmā punapi tadubhayavasena manasikārappavatti vuccatīti?
Now, was not the occurrence of attention to dependent origination in both direct and reverse order already stated in the two previous suttas? Why is the occurrence of attention in both ways mentioned again here?
Há chẳng phải trước đây, trong hai kinh đã nói về sự quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch rồi sao? Tại sao ở đây lại nói về sự quán chiếu theo cả hai chiều một lần nữa?
Tadubhayavasena tatiyavāraṃ tattha manasikārassa pavattitattā.
Because attention to it occurred for the third time in both ways.
Bởi vì sự quán chiếu Duyên Khởi theo cả hai chiều đã diễn ra lần thứ ba.
Kathaṃ pana tadubhayavasena manasikāro pavattito?
How then was attention directed in both ways?
Nhưng làm thế nào mà sự quán chiếu theo cả hai chiều lại diễn ra?
Na hi sakkā apubbaṃ acarimaṃ anulomapaṭilomaṃ paṭiccasamuppādassa manasikāraṃ pavattetunti?
For is it not possible to direct attention to dependent origination (paṭiccasamuppāda) in forward and reverse order, without any precedence or subsequence?
Chẳng phải không thể quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch cùng một lúc sao?
Na kho panetaṃ evaṃ daṭṭhabbaṃ ‘‘tadubhayaṃ ekajjhaṃ manasākāsī’’ti, atha kho vārena.
Indeed, this should not be understood thus: ‘He attended to both simultaneously,’ but rather in turn.
Tuy nhiên, điều này không nên được hiểu là “vị ấy đã quán chiếu cả hai cùng một lúc”, mà là theo từng lượt.
Bhagavā hi paṭhamaṃ anulomavasena paṭiccasamuppādaṃ manasi karitvā tadanurūpaṃ paṭhamaṃ udānaṃ udānesi.
For the Blessed One, having first attended to Dependent Origination in direct order, uttered the first Udāna corresponding to that.
Thật vậy, Thế Tôn trước tiên đã quán chiếu Duyên Khởi theo chiều thuận và thốt lên lời cảm hứng thứ nhất phù hợp với điều đó.
Dutiyampi paṭilomavasena taṃ manasi karitvā tadanurūpameva udānaṃ udānesi.
Secondly, having attended to it in reverse order, He uttered the Udāna corresponding to that.
Lần thứ hai, Ngài quán chiếu Duyên Khởi theo chiều nghịch và thốt lên lời cảm hứng phù hợp với điều đó.
Tatiyavāre pana kālena anulomaṃ kālena paṭilomaṃ manasikaraṇavasena anulomapaṭilomaṃ manasi akāsi.
But in the third turn, He attended to it both in direct and reverse order, sometimes in direct order, sometimes in reverse order, by way of mental reflection.
Đến lần thứ ba, Ngài đã quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch bằng cách lúc thì quán chiếu theo chiều thuận, lúc thì quán chiếu theo chiều nghịch.
Tena vuttaṃ – ‘‘anulomapaṭilomanti anulomañca paṭilomañca, yathāvuttaanulomavasena ceva paṭilomavasena cā’’ti.
Therefore, it is said: “‘Direct and reverse order’ means both direct and reverse order, in the manner of the direct and reverse order as stated.”
Vì vậy, đã nói: “chiều thuận và chiều nghịch có nghĩa là theo chiều thuận và chiều nghịch, tức là theo cách chiều thuận và chiều nghịch như đã nói.”
Iminā manasikārassa paguṇabalavabhāvo ca vasībhāvo ca pakāsito hoti.
By this, the mastery, strength, and proficiency of the mental reflection are revealed.
Bằng cách này, sự thành thạo, mạnh mẽ và khả năng làm chủ của sự quán chiếu đã được biểu lộ.
Ettha ca ‘‘anulomaṃ manasi karissāmi, paṭilomaṃ manasi karissāmi, anulomapaṭilomaṃ manasi karissāmī’’ti evaṃ pavattānaṃ pubbābhogānaṃ vasena nesaṃ vibhāgo veditabbo.
And here, the distinction between them should be understood by means of the preliminary intentions that occurred, such as: “I will attend to the direct order, I will attend to the reverse order, I will attend to both direct and reverse order.”
Ở đây, sự phân biệt của chúng cần được hiểu dựa trên những ý định trước đó như “Ta sẽ quán chiếu theo chiều thuận, ta sẽ quán chiếu theo chiều nghịch, ta sẽ quán chiếu theo chiều thuận và chiều nghịch”.
Tattha avijjāya tvevāti avijjāya tu eva.
Therein, avijjāya tvevā means indeed by ignorance alone.
Trong đó, “chỉ do vô minh” (avijjāya tveva) có nghĩa là chỉ riêng vô minh.
Asesavirāganirodhāti virāgasaṅkhātena maggena asesanirodhā, aggamaggena anavasesaanuppādappahānāti attho.
Asesavirāganirodhā means by the path called ‘detachment’ (virāga), by the complete cessation of it; the meaning is the utter and complete abandoning, non-arising again, by the Arahant Path.
“Do sự diệt tận hoàn toàn không còn luyến ái” (asesavirāganirodhā) có nghĩa là do sự diệt tận hoàn toàn không còn sót lại bằng đạo gọi là ly tham (virāga), tức là sự đoạn trừ không tái sinh hoàn toàn bằng A-la-hán đạo.
Saṅkhāranirodhoti sabbesaṃ saṅkhārānaṃ anavasesaṃ anuppādanirodho.
Saṅkhāranirodho means the complete cessation, without remainder, of all saṅkhārās, their non-arising.
“Hành diệt” có nghĩa là sự diệt tận hoàn toàn không tái sinh của tất cả các hành.
Heṭṭhimena hi maggattayena keci saṅkhārā nirujjhanti, keci na nirujjhanti avijjāya sāvasesanirodhā.
For by the three lower paths, some saṅkhārās cease, but some do not cease, due to the cessation of ignorance with a remainder.
Thật vậy, bằng ba đạo thấp hơn, một số hành diệt, một số không diệt, do sự diệt trừ vô minh còn sót lại.
Aggamaggena panassā anavasesanirodhā na keci saṅkhārā na nirujjhantīti.
But by the Arahant Path, due to the complete cessation of ignorance without remainder, no saṅkhārās remain unceased.
Tuy nhiên, bằng A-la-hán đạo, do sự diệt trừ vô minh hoàn toàn không còn sót lại, nên không có hành nào không diệt.
Evaṃ bhagavatā paṭhamaṃ paccayākārapajānanassa, dutiyaṃ paccayakkhayādhigamassa, tatiyaṃ ariyamaggassa ānubhāvappakāsanāni imāni tīṇi udānāni tīsu yāmesu bhāsitāni.
Thus, these three Udānas, uttered by the Blessed One in the three watches of the night, are revelations of the power of understanding the nature of conditionality (paccaya-ākāra-pajānana), secondly, the attainment of the destruction of conditions (paccayakkhaya-adhigama), and thirdly, the Noble Path.
Như vậy, ba bài kệ ca tụng này đã được Đức Thế Tôn thuyết giảng trong ba canh, nhằm tuyên bố uy lực của việc giác ngộ nhân duyên (Paccaya-ākāra-pajānanassa) lần thứ nhất, việc đạt đến sự diệt trừ nhân duyên (Paccayakkhayādhigamassa) lần thứ hai, và của Thánh đạo (Ariyamaggassa) lần thứ ba.
Katarāya rattiyā?
On which night?
Vào đêm nào?
Abhisambodhito sattamāya rattiyā.
On the seventh night after His Perfect Enlightenment.
Vào đêm thứ bảy kể từ ngày chứng đắc Chánh Đẳng Giác.
Bhagavā hi visākhapuṇṇamāya rattiyā paṭhamayāme pubbenivāsaṃ anussaritvā majjhimayāme dibbacakkhuṃ visodhetvā pacchimayāme paṭiccasamuppāde ñāṇaṃ otāretvā nānānayehi tebhūmakasaṅkhāre sammasitvā ‘‘idāni aruṇo uggamissatī’’ti sammāsambodhiṃ pāpuṇi, sabbaññutappattisamanantarameva ca aruṇo uggacchīti.
For on the full moon night of Visākha, in the first watch, the Blessed One recollected His past lives; in the middle watch, He purified His divine eye; and in the last watch, He immersed His knowledge in Dependent Origination, contemplated the three planes of existence in various ways, and attained Perfect Self-Enlightenment, thinking, “Now the dawn will break.” And indeed, the dawn broke immediately upon His attainment of omniscience.
Thật vậy, Đức Thế Tôn đã chứng đắc Chánh Đẳng Giác vào canh đầu đêm trăng tròn tháng Visākha, sau khi nhớ lại các đời sống quá khứ; vào canh giữa, sau khi thanh tịnh thiên nhãn (dibbacakkhu); và vào canh cuối, sau khi quán xét trí tuệ về Duyên khởi (Paṭiccasamuppāda), và tư duy các hành (saṅkhāra) thuộc ba cõi (tebhūmaka) bằng nhiều phương cách khác nhau, và ngay khi Ngài đạt được Chánh Đẳng Giác, bình minh đã ló dạng.
Tato teneva pallaṅkena bodhirukkhamūle sattāhaṃ vītināmento sampattāya pāṭipadarattiyā tīsu yāmesu vuttanayena paṭiccasamuppādaṃ manasi karitvā yathākkamaṃ imāni udānāni udānesi.
Thereafter, remaining on that very same seat under the Bodhi tree for seven days, on the Pāṭipada night (the first day after the full moon), He attended to Dependent Origination in the manner described in the three watches, and uttered these Udānas in sequence.
Sau đó, Ngài ở lại dưới cội Bồ-đề trong bảy ngày với cùng một tư thế kiết già, và vào đêm đầu tháng (pāṭipada) của ngày thứ bảy, Ngài đã quán niệm Duyên khởi theo cách đã nói trong ba canh, và lần lượt thốt ra ba bài kệ ca tụng này.