Table of Contents

⮲

Itivuttaka-aṭṭhakathā

Edit
4
Ganthārambhakathā
Introduction to the Book
Lời Mở Đầu Bộ Sách
5
Mahākāruṇikaṃ nāthaṃ, ñeyyasāgarapāraguṃ;
The Lord, the Greatly Compassionate, who has reached the far shore of the ocean of knowable phenomena;
Tôi xin đảnh lễ bậc Nātha (Bảo Hộ) có lòng đại bi vĩ đại, Đấng đã vượt qua bờ bên kia của biển tri thức (ñeyya dhamma);
6
Vande nipuṇagambhīra-vicitranayadesanaṃ.
Who teaches subtle, profound, and varied methods—Him I revere.
Đấng đã thuyết giảng với những phương pháp vi tế, sâu sắc và đa dạng.
7
Vijjācaraṇasampannā, yena niyyanti lokato;
Perfect in knowledge and conduct, by which they emerge from the world;
Tôi xin đảnh lễ Dhamma (Giáo Pháp) tối thượng đó, Giáo Pháp mà nhờ đó các bậc đầy đủ tam minh và mười lăm hạnh (vijjācaraṇasampannā) thoát khỏi thế gian;
8
Vande tamuttamaṃ dhammaṃ, sammāsambuddhapūjitaṃ.
That supreme Dhamma, revered by the Perfectly Self-Enlightened Ones, by which those perfect in knowledge and conduct emerge from the world—That Dhamma I revere.
Giáo Pháp được các bậc Chánh Đẳng Giác (Sammāsambuddha) tôn kính.
9
Sīlādiguṇasampanno, ṭhito maggaphalesu yo;
Endowed with virtues like sīla, who stands firm in the paths and fruits;
Tôi xin đảnh lễ Tăng đoàn Thánh (Ariyasaṅgha) đó, Tăng đoàn đầy đủ các đức tính như giới (sīla) và an trú trong các đạo và quả (magga-phala);
10
Vande ariyasaṅghaṃ taṃ, puññakkhettaṃ anuttaraṃ.
That noble Saṅgha, the unsurpassed field of merit—That I revere.
Tăng đoàn là ruộng phước vô thượng.
11
Vandanājanitaṃ puññaṃ, iti yaṃ ratanattaye;
By the power of the merit generated by this reverence shown to the Triple Gem,
Nhờ năng lực của phước báu phát sinh từ sự đảnh lễ ba ngôi báu đó,
12
Hatantarāyo sabbattha, hutvāhaṃ tassa tejasā.
May I be free from all obstacles everywhere.
Nguyện cho tôi được vượt qua mọi chướng ngại ở khắp mọi nơi.
13
Ekakādippabhedena, desitāni mahesinā;
The Suttas, preached by the Great Sage, are characterized by their division into units starting with one, and so on,
Những sự từ bỏ tham ái (lobha) và các phiền não khác, được Đức Đạo Sư (Mahesī) thuyết giảng,
14
Lobhādīnaṃ pahānāni, dīpanāni visesato.
And they especially illuminate the abandonment of greed and other defilements.
Đặc biệt là những lời chỉ dẫn về sự đoạn trừ các phiền não đó, được phân loại theo từng nhóm một, hai, v.v.
15
Suttāni ekato katvā, itivuttapadakkharaṃ;
The elder Dhammasaṅgāhakā, having gathered these Suttas together,
Các vị Trưởng lão (Thera) kết tập Pháp (Dhamma-saṅgāhaka) đã tập hợp các bài kinh lại với nhau,
16
Dhammasaṅgāhakā therā, saṅgāyiṃsu mahesayo.
Recited the words and letters of the Itivuttaka.
Và đã tụng đọc bộ kinh Itivuttaka (Phật Thuyết Như Vậy) này, với từng lời từng chữ, là những bậc vĩ đại (mahesayo).
17
Itivuttakamicceva, nāmena vasino pure;
That which, in the Khuddakanikāya, was known in ancient times by the name Itivuttaka,
Bộ kinh này, được gọi là Itivuttaka (Phật Thuyết Như Vậy), đã tồn tại từ thời xa xưa;
18
Yaṃ khuddakanikāyasmiṃ, gambhīratthapadakkamaṃ.
With its profound meaning and sequence of words, they recited.
Nó thuộc Tiểu Bộ Kinh (Khuddakanikāya) và có dòng nghĩa và dòng chữ sâu sắc.
19
Tassa gambhīrañāṇehi, ogāhetabbabhāvato;
Since it must be fathomed by profound wisdom,
Vì ý nghĩa của nó cần được thâm nhập bằng trí tuệ sâu sắc,
20
Kiñcāpi dukkarā kātuṃ, atthasaṃvaṇṇanā mayā.
It is difficult for me to compose an exposition of its meaning.
Nên việc tôi chú giải ý nghĩa của nó có phần khó khăn.
21
Sahasaṃvaṇṇanaṃ yasmā, dharate satthu sāsanaṃ;
However, since the Teacher's Dispensation continues to exist with commentaries,
Tuy nhiên, vì giáo pháp của Đức Đạo Sư (Satthu) vẫn còn tồn tại cùng với các chú giải,
22
Pubbācariyasīhānaṃ, tiṭṭhateva vinicchayo.
And the conclusions of the ancient lion-like teachers remain firm,
Và những lời quyết định của các bậc sư tử tiền bối (pubbācariya) vẫn còn đó.
23
Tasmā taṃ avalambitvā, ogāhetvāna pañcapi;
Therefore, relying on that, and having fathomed all five Nikāyas,
Vì vậy, tôi sẽ nương tựa vào đó, thâm nhập vào năm bộ Nikāya,
24
Nikāye upanissāya, porāṇaṭṭhakathānayaṃ.
And having based it on the method of the ancient Aṭṭhakathās,
Và dựa vào phương pháp của các chú giải cổ xưa (porāṇaṭṭhakathā).
25
Nissitaṃ vācanāmaggaṃ, suvisuddhaṃ anākulaṃ;
And having relied on the exceedingly pure, undisturbed teaching tradition of the Mahāvihāra residents,
Theo phương pháp tụng đọc của các vị Đại Trưởng lão (Mahāvihāravāsī), một phương pháp rất thanh tịnh và không bị xáo trộn,
26
Mahāvihāravāsīnaṃ, nipuṇatthavinicchayaṃ.
With their subtle determination of meaning;
Với sự quyết định ý nghĩa vi tế của họ.
27
Punappunāgataṃ atthaṃ, vajjayitvāna sādhukaṃ;
And having carefully avoided repetition of meaning that has come again and again,
Sau khi loại bỏ cẩn thận những ý nghĩa đã được lặp đi lặp lại,
28
Yathābalaṃ karissāmi, itivuttakavaṇṇanaṃ.
I shall compose this Itivuttaka commentary to the best of my ability.
Tôi sẽ thực hiện Chú Giải Itivuttaka này tùy theo khả năng của mình.
29
Iti ākaṅkhamānassa, saddhammassa ciraṭṭhitiṃ;
Thus, I, aspiring for the long endurance of the Saddhamma,
Hỡi các bậc hiền thiện, hãy lắng nghe lời giải thích ý nghĩa của bộ kinh này,
30
Vibhajantassa tassatthaṃ, nisāmayatha sādhavoti.
And explaining its meaning, say: "Good people, listen to me!"
Lời giải thích được thực hiện với mong muốn cho Chánh Pháp (Saddhamma) được trường tồn!
31
Tattha itivuttakaṃ nāma ekakanipāto, dukanipāto, tikanipāto, catukkanipātoti catunipātasaṅgahaṃ.
Herein, the Itivuttaka consists of four nipātas: the Ekanipāta (Book of Ones), Dukanipāta (Book of Twos), Tikanipāta (Book of Threes), and Catukkanipāta (Book of Fours). It is comprised of these four nipātas. It is included in the Suttanta Piṭaka among the three Piṭakas (Vinaya Piṭaka, Suttanta Piṭaka, and Abhidhamma Piṭaka); it is included in the Khuddakanikāya among the five Nikāyas (Dīghanikāya, Majjhimanikāya, Saṃyuttanikāya, Aṅguttaranikāya, and Khuddakanikāya); and it forms part of the Itivuttakaṅga among the nine divisions of the Buddha's Teachings (Sutta, Geyya, Veyyākaraṇa, Gāthā, Udāna, Itivuttaka, Jātaka, Abbhutadhamma, and Vedalla).
Trong đó, Itivuttaka bao gồm bốn tập: Tập Một (Ekakanipāta), Tập Hai (Dukanipāta), Tập Ba (Tikanipāta) và Tập Bốn (Catukkanipāta). Nó thuộc Suttanta Piṭaka trong ba tạng kinh điển (Vinaya Piṭaka, Suttanta Piṭaka, Abhidhamma Piṭaka); nó thuộc Khuddakanikāya trong năm bộ Nikāya (Dīghanikāya, Majjhimanikāya, Saṃyuttanikāya, Aṅguttaranikāya, Khuddakanikāya); nó là một phần của Itivuttaka trong chín chi phần giáo pháp (sāsanaṅga): Sutta, Geyya, Veyyākaraṇa, Gāthā, Udāna, Itivuttaka, Jātaka, Abbhutadhamma, Vedalla.
Tampi vinayapiṭakaṃ, suttantapiṭakaṃ, abhidhammapiṭakanti tīsu piṭakesu suttantapiṭakapariyāpannaṃ; dīghanikāyo majjhimanikāyo, saṃyuttanikāyo, aṅguttaranikāyo, khuddakanikāyoti pañcasu nikāyesu khuddakanikāyapariyāpannaṃ; suttaṃ, geyyaṃ, veyyākaraṇaṃ, gāthā, udānaṃ, itivuttakaṃ, jātakaṃ, abbhutadhammaṃ, vedallanti navasu sāsanaṅgesu itivuttakaṅgabhūtaṃ.
It is included in the Suttanta Piṭaka among the three Piṭakas (Vinaya Piṭaka, Suttanta Piṭaka, and Abhidhamma Piṭaka); it is included in the Khuddakanikāya among the five Nikāyas (Dīghanikāya, Majjhimanikāya, Saṃyuttanikāya, Aṅguttaranikāya, and Khuddakanikāya); and it forms part of the Itivuttakaṅga among the nine divisions of the Buddha's Teachings (Sutta, Geyya, Veyyākaraṇa, Gāthā, Udāna, Itivuttaka, Jātaka, Abbhutadhamma, and Vedalla).
Nó bao gồm một số trong số tám mươi bốn ngàn pháp uẩn đã được vị Thủ kho Giáo Pháp (Dhammabhaṇḍāgārika) tuyên bố như sau:
32
‘‘Dvāsīti buddhato gaṇhiṃ, dvesahassāni bhikkhuto;
"I received eighty-two thousand from the Buddha, two thousand from the bhikkhus;
“Tôi đã học tám mươi hai ngàn pháp uẩn từ Đức Phật, hai ngàn từ các Tỳ-khưu;
33
Caturāsīti sahassāni, ye me dhammā pavattino’’ti.(theragā. 1027) –
These eighty-four thousand Dhamma-sections became current for me."
Tám mươi bốn ngàn pháp uẩn này đã được tôi giảng dạy.”
34
Evaṃ dhammabhaṇḍāgārikena paṭiññātesu caturāsītiyā dhammakkhandhasahassesu katipayadhammakkhandhasaṅgahaṃ.
Thus, it is a compilation of a certain number of Dhamma-sections among the eighty-four thousand Dhamma-sections acknowledged by the Dhammabhaṇḍāgārika. From the perspective of suttas, in the Ekanipāta there are twenty-seven suttas; in the Dukanipāta, twenty-two; in the Tikanipāta, fifty; and in the Catukkanipāta, thirteen, thus comprising one hundred and twelve suttas. Among its nipātas, the Ekanipāta is the beginning; among its divisions (vaggas), the Pāṭibhogavagga; and among its suttas, the Lobhasutta. The introduction to this Lobhasutta begins with "Vuttañhetaṃ Bhagavatā" (This was said by the Blessed One), spoken by Venerable Ānanda at the time of the First Great Saṅgīti. This First Great Saṅgīti is indeed recorded in the Vinaya Piṭaka. As for the narrative path to be spoken for skill in the introduction, that too has been extensively explained in the Dīghanikāya-aṭṭhakathā called Sumaṅgalavilāsinī, and thus should be understood according to the method stated there.
Về các bài kinh, có hai mươi bảy bài kinh trong Tập Một, hai mươi hai trong Tập Hai, năm mươi ba trong Tập Ba, và mười ba trong Tập Bốn, tổng cộng là một trăm mười hai bài kinh.
Suttato ekakanipāte tāva sattavīsati suttāni, dukanipāte dvāvīsati, tikanipāte paññāsa, catukkanipāte terasāti dvādasādhikasuttasatasaṅgahaṃ.
From the perspective of suttas, in the Ekanipāta there are twenty-seven suttas; in the Dukanipāta, twenty-two; in the Tikanipāta, fifty; and in the Catukkanipāta, thirteen, thus comprising one hundred and twelve suttas.
Trong các tập của nó, Tập Một là khởi đầu; trong các phẩm, phẩm Pāṭibhoga là khởi đầu; trong các bài kinh, kinh Lobha là khởi đầu.
Tassa nipātesu ekakanipāto ādi, vaggesu pāṭibhogavaggo, suttesu lobhasuttaṃ.
Among its nipātas, the Ekanipāta is the beginning; among its divisions (vaggas), the Pāṭibhogavagga; and among its suttas, the Lobhasutta.
Phần dẫn nhập của kinh đó, bắt đầu bằng “Vuttañhetaṃ Bhagavatā” (Điều này đã được Đức Thế Tôn nói), đã được Tôn giả Ānanda thuyết giảng trong kỳ Đại Kết Tập lần thứ nhất.
Tassāpi ‘‘vuttañhetaṃ bhagavatā’’tiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādi.
The introduction to this Lobhasutta begins with "Vuttañhetaṃ Bhagavatā" (This was said by the Blessed One), spoken by Venerable Ānanda at the time of the First Great Saṅgīti.
Đại Kết Tập lần thứ nhất này đã được ghi chép trong Vinaya Piṭaka.
Sā panāyaṃ paṭhamamahāsaṅgīti vinayapiṭake tantimāruḷhā eva.
This First Great Saṅgīti is indeed recorded in the Vinaya Piṭaka.
Con đường thuyết giảng cần được nói ở đây để hiểu rõ phần dẫn nhập cũng đã được giải thích chi tiết trong Chú Giải Dīghanikāya (Sumaṅgalavilāsinī);
Yo panettha nidānakosallatthaṃ vattabbo kathāmaggo, sopi sumaṅgalavilāsiniyā dīghanikāya-aṭṭhakathāya vitthārato vuttoyevāti tattha vuttanayeneva veditabbo.
As for the narrative path to be spoken for skill in the introduction, that too has been extensively explained in the Dīghanikāya-aṭṭhakathā called Sumaṅgalavilāsinī, and thus should be understood according to the method stated there.
Vì vậy, nó nên được hiểu theo cách đã nói ở đó.
35
Nidānavaṇṇanā
Explanation of the Introduction
Giải Thích Phần Dẫn Nhập
36
Yaṃ panetaṃ vuttañhetaṃ bhagavatātiādikaṃ nidānaṃ.
The introduction beginning with "Vuttañhetaṃ Bhagavatā" (This was said by the Blessed One),
Phần dẫn nhập bắt đầu bằng “Vuttañhetaṃ Bhagavatā” (Điều này đã được Đức Thế Tôn nói),
Ekadhammaṃ, bhikkhave, pajahathātiādikaṃ suttaṃ.
And the sutta beginning with "Ekadhammaṃ, bhikkhave, pajahatha" (Bhikkhus, abandon one thing).
Và bài kinh bắt đầu bằng “Ekadhammaṃ, bhikkhave, pajahatha” (Này các Tỳ-khưu, hãy từ bỏ một pháp).
Tattha vuttaṃ bhagavatātiādīni nāmapadāni.
Herein, "Vuttaṃ Bhagavatā" and so forth are noun phrases.
Trong đó, “Vuttaṃ Bhagavatā” và các từ tương tự là danh từ.
Itīti nipātapadaṃ.
"Iti" is a particle.
“Iti” là một từ bất biến (nipāta).
Pajahathāti ettha pa-iti upasaggapadaṃ, jahathā-ti ākhyātapadaṃ.
In "pajahatha," "pa-" is a prefix, and "jahatha" is a verb.
Trong “Pajahatha”, “pa-” là một tiền tố (upasagga), và “jahatha” là một động từ (ākhyāta).
Iminā nayena sabbattha padavibhāgo veditabbo.
In this manner, the division of words should be understood everywhere.
Theo cách này, sự phân tích từ ngữ nên được hiểu ở khắp mọi nơi.
37
Atthato pana vuttasaddo tāva saupasaggo anupasaggo ca vapane vāpasamakaraṇe kesohāraṇe jīvitavuttiyaṃ pavuttabhāve pāvacanabhāvena pavattite ajjhesane kathaneti evamādīsu dissati.
As for the meaning, the word "vutta" appears with and without a prefix, in meanings such as sowing, preparing for sowing, shaving the hair, livelihood, being detached, being uttered as noble speech, recitation, and speaking.
Về ý nghĩa, từ vutta (được nói) có thể xuất hiện với tiền tố hoặc không có tiền tố, và nó được thấy trong các ý nghĩa như gieo trồng (vapana), làm sạch (vāpasamakaraṇa), cạo tóc (kesohāraṇa), sinh kế (jīvitavutti), được giải thoát (pavuttabhāva), được thuyết giảng như lời dạy cao quý (pāvacanabhāvena pavattite), học hỏi (ajjhesana), và nói (kathana).
Tathā hesa –
Thus, indeed,
Như vậy, từ này –
38
‘‘Gāvo tassa pajāyanti, khette vuttaṃ virūhati;
"His cows bring forth, what is sown in the field grows;
“Đàn bò của người đó sinh sôi, hạt giống gieo trên ruộng nảy mầm;
39
Vuttānaṃ phalamasnāti, yo mittānaṃ na dubbhatī’’ti–
He who does not betray his friends enjoys the fruit of what is sown" —
Người không lừa dối bạn bè sẽ gặt hái thành quả của những gì đã gieo.” –
40
Ādīsu (jā. 2.22.19) vapane āgato.
In passages like these, it appears in the sense of sowing. In "No ca kho paṭivuttaṃ" and so on, it refers to preparing for sowing with eight-pronged implements. In "Kāpaṭiko māṇavo daharo vuttasiro" and so on, it means shaving the hair. In "Pannalomo paradattavutto migabhūtena cetasā viharati" and so on, it means livelihood. In "Seyyathāpi nāma paṇḍupalāso bandhanā pavutto abhabbo haritatthāyā" and so on, it refers to being detached from the stem. In "Yesamidaṃ etarahi, brāhmaṇā, porāṇaṃ mantapadaṃ gītaṃ pavuttaṃ samihitaṃ" and so on, it refers to being uttered as noble speech. In common usage, in "vutto gaṇo vutto pārāyano" and so on, it means recitation. In "Vuttaṃ kho panetaṃ Bhagavatā Dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā" and so on, it means speaking.
Trong các trường hợp như trên, nó có nghĩa là gieo trồng.
‘‘No ca kho paṭivutta’’ntiādīsu (pārā. 289) aṭṭhadantakādīhi vāpasamakaraṇe.
In "No ca kho paṭivuttaṃ" and so on, it refers to preparing for sowing with eight-pronged implements.
Trong các trường hợp như “No ca kho paṭivuttaṃ” (chưa được làm sạch), nó có nghĩa là làm sạch bằng tám chiếc răng cày, v.v.
‘‘Kāpaṭiko māṇavo daharo vuttasiro’’tiādīsu (ma. ni. 2.426) kesohāraṇe.
In "Kāpaṭiko māṇavo daharo vuttasiro" and so on, it means shaving the hair.
Trong các trường hợp như “Kāpaṭiko māṇavo daharo vuttasiro” (chàng thanh niên Kāpaṭika với đầu đã cạo), nó có nghĩa là cạo tóc.
‘‘Pannalomo paradattavutto migabhūtena cetasā viharatī’’tiādīsu (cūḷava. 332) jīvitavuttiyaṃ.
In "Pannalomo paradattavutto migabhūtena cetasā viharati" and so on, it means livelihood.
Trong các trường hợp như “Pannalomo paradattavutto migabhūtena cetasā viharati” (người đã rụng lông, sống nhờ của người khác, với tâm trí như con nai), nó có nghĩa là sinh kế.
‘‘Seyyathāpi nāma paṇḍupalāso bandhanā pavutto abhabbo haritatthāyā’’tiādīsu (pārā. 92; pāci. 666; mahāva. 129) bandhanato pavuttabhāve.
In "Seyyathāpi nāma paṇḍupalāso bandhanā pavutto abhabbo haritatthāyā" and so on, it refers to being detached from the stem.
Trong các trường hợp như “Seyyathāpi nāma paṇḍupalāso bandhanā pavutto abhabbo haritatthāyā” (như một chiếc lá vàng đã rụng khỏi cuống thì không thể xanh tươi trở lại), nó có nghĩa là được giải thoát khỏi sự ràng buộc.
‘‘Yesamidaṃ etarahi, brāhmaṇā, porāṇaṃ mantapadaṃ gītaṃ pavuttaṃ samihita’’ntiādīsu pāvacanabhāvena pavattite.
In "Yesamidaṃ etarahi, brāhmaṇā, porāṇaṃ mantapadaṃ gītaṃ pavuttaṃ samihitaṃ" and so on, it refers to being uttered as noble speech.
Trong các trường hợp như “Yesamidaṃ etarahi, brāhmaṇā, porāṇaṃ mantapadaṃ gītaṃ pavuttaṃ samihitaṃ” (này các Bà-la-môn, đây là những câu thần chú cổ xưa đã được tụng, thuyết giảng và tập hợp), nó có nghĩa là được thuyết giảng như lời dạy cao quý.
Loke pana – ‘‘vutto gaṇo vutto pārāyano’’tiādīsu ajjhene.
In common usage, in "vutto gaṇo vutto pārāyano" and so on, it means recitation.
Trong đời thường, trong các trường hợp như “Vutto gaṇo, vutto pārāyano” (phẩm Gaṇa đã được tụng, phẩm Pārāyana đã được tụng), nó có nghĩa là học hỏi.
‘‘Vuttaṃ kho panetaṃ bhagavatā dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’tiādīsu (ma. ni. 1.30) kathane.
In "Vuttaṃ kho panetaṃ Bhagavatā Dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā" and so on, it means speaking.
Trong các trường hợp như “Vuttaṃ kho panetaṃ Bhagavatā: ‘Dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’” (Điều này đã được Đức Thế Tôn nói: ‘Này các Tỳ-khưu, hãy là những người thừa kế Pháp của Ta, đừng là những người thừa kế vật chất’), nó có nghĩa là nói.
Idhāpi kathane daṭṭhabbo.
Here too, it should be understood in the sense of speaking.
Ở đây cũng nên hiểu là nói.
Tasmā vuttaṃ kathitaṃ bhāsitanti attho.
Therefore, "vuttaṃ" means spoken, uttered, declared.
Vì vậy, vuttaṃ có nghĩa là được nói, được kể, được thuyết giảng.
41
Dutiyo pana vuttasaddo vacane ciṇṇabhāve ca veditabbo.
The second word vutta should be understood in the sense of saying and practiced state.
Từ vutta thứ hai nên được hiểu là lời nói và sự thực hành.
Hi-iti jātu vibyattanti etasmiṃ atthe nipāto.
The particle " Hi" is used in the sense of "indeed" or "certainly clear."
Từ bất biến hi (thật vậy) ở đây có nghĩa là chắc chắn và rõ ràng.
So idāni vuccamānasuttassa bhagavato vibyattaṃ bhāsitabhāvaṃ joteti.
Here, it clarifies that the Sutta about to be spoken was indeed clearly declared by the Blessed One.
Nó làm sáng tỏ rằng bài kinh sắp được nói là lời thuyết giảng rõ ràng của Đức Thế Tôn.
Vācakasaddasannidhāne hi payuttā nipātā.
Indeed, particles are used in conjunction with active verbs.
Các từ bất biến được sử dụng cùng với các từ chỉ định.
Tehi vattabbamatthaṃ jotenti.
They illuminate the meaning that is to be conveyed.
Chúng làm sáng tỏ ý nghĩa cần được nói.
Etanti ayaṃ etasaddo –
As for " Etaṃ," this word "eta" appears—
Từ etaṃ (điều này) –
42
‘‘Yo ca buddhañca dhammañca, saṅghañca saraṇaṃ gato;
"And whoever has gone for refuge to the Buddha, the Dhamma, and the Saṅgha;
“Ai quy y Phật, Pháp và Tăng;
43
Cattāri ariyasaccāni, sammappaññāya passati.
And sees the four noble truths with right wisdom:
Và thấy rõ Tứ Diệu Đế bằng chánh trí:
44
‘‘Dukkhaṃ dukkhasamuppādaṃ, dukkhassa ca atikkamaṃ;
Suffering, the origin of suffering, and the transcending of suffering;
Khổ, nguyên nhân của khổ, sự diệt khổ;
45
Ariyañcaṭṭhaṅgikaṃ maggaṃ, dukkhūpasamagāminaṃ.
And the noble eightfold path that leads to the cessation of suffering.
Và Bát Chánh Đạo cao quý dẫn đến sự an tịnh của khổ.
46
‘‘Etaṃ kho saraṇaṃ khemaṃ, etaṃ saraṇamuttamaṃ;
This indeed is the safe refuge, this is the supreme refuge;
Đây thật sự là nơi nương tựa an toàn, đây là nơi nương tựa tối thượng;
47
Etaṃ saraṇamāgamma, sabbadukkhā pamuccatī’’ti.(dha. pa. 190-192) –
Having gone to this refuge, one is released from all suffering."
Nương tựa vào nơi nương tựa này, người ta thoát khỏi mọi khổ đau.” –
48
Ādīsu yathāvutte āsannapaccakkhe āgato.
In passages like these, it refers to what has already been stated and is immediately present.
Trong các trường hợp như trên, nó có nghĩa là điều đã được nói gần đây và trực tiếp.
‘‘Appamattakaṃ kho panetaṃ, bhikkhave, oramattakaṃ sīlamattakaṃ, yena puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyyā’’tiādīsu (dī. ni. 1.7) pana vakkhamāne āsannapaccakkhe.
But in passages like "Appamattakaṃ kho panetaṃ, bhikkhave, oramattakaṃ sīlamattakaṃ, yena puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyyā" it refers to what is about to be stated and is immediately present.
Trong các trường hợp như “Appamattakaṃ kho panetaṃ, bhikkhave, oramattakaṃ sīlamattakaṃ, yena puthujjano Tathāgatassa vaṇṇaṃ vadamāno vadeyyā” (Này các Tỳ-khưu, điều này thật sự là nhỏ nhặt, tầm thường, chỉ là giới hạnh, mà một phàm nhân có thể dùng để khen ngợi Như Lai), nó có nghĩa là điều sắp được nói gần đây và trực tiếp.
Idhāpi vakkhamāneyeva daṭṭhabbo.
Here too, it should be understood as referring to what is about to be stated.
Ở đây cũng nên hiểu là điều sắp được nói.
Saṅgāyanavasena vakkhamānañhi suttaṃ dhammabhaṇḍāgārikena buddhiyaṃ ṭhapetvā tadā ‘‘eta’’nti vuttaṃ.
Indeed, the Sutta that was to be recited according to the manner of the Saṅgīti was held in the wisdom of the Dhammabhaṇḍāgārika and was then spoken as "etaṃ."
Bài kinh sắp được nói theo cách kết tập đã được vị Thủ kho Giáo Pháp (Dhammabhaṇḍāgārika) ghi nhớ trong trí tuệ và được nói là “etaṃ” (điều này) vào thời điểm đó.
49
Bhagavatāti ettha bhagavāti garuvacanaṃ.
In " Bhagavatā," "Bhagavā" is a term of reverence.
Trong từ Bhagavatā (Đức Thế Tôn), từ Bhagavat là một từ tôn kính.
Garuṃ hi loke bhagavāti vadanti.
Indeed, people in the world refer to a revered one as "Bhagavā."
Thật vậy, người đời gọi bậc đáng tôn kính là Bhagavat.
Tathāgato ca sabbaguṇavisiṭṭhatāya sattānaṃ garu, tasmā bhagavāti veditabbo.
And the Tathāgata is revered by all beings due to his superiority in all qualities, therefore he should be known as Bhagavā.
Và Như Lai là bậc đáng tôn kính của tất cả chúng sinh vì Ngài vượt trội về mọi đức tính, do đó nên hiểu Ngài là Bhagavat.
Porāṇehipi vuttaṃ –
It was also said by the ancients:
Các bậc cổ đức cũng đã nói:
50
‘‘Bhagavāti vacanaṃ seṭṭhaṃ, bhagavāti vacanamuttamaṃ;
"The word 'Bhagavā' is excellent, the word 'Bhagavā' is supreme;
“Bhagavat là lời nói tối thượng, Bhagavat là lời nói cao quý nhất;
51
Garu gāravayutto so, bhagavā tena vuccatī’’ti.
He is the Teacher, endowed with respect; for that reason, he is called Bhagavā.
Ngài là bậc đáng tôn kính, đầy đủ sự tôn kính, nên Ngài được gọi là Bhagavat.”
52
Seṭṭhavācakañhi vacanaṃ seṭṭhaguṇasahacaraṇato seṭṭhanti vuttaṃ.
Indeed, the word that denotes "supreme" is said to be supreme due to its association with supreme qualities.
Lời nói chỉ sự tối thượng được gọi là tối thượng vì nó đi kèm với những đức tính tối thượng.
Atha vā vuccatīti vacanaṃ, attho.
Or, "vuccati" means "vacanaṃ" (word), which is the meaning.
Hoặc, vacana (lời nói) có nghĩa là điều được nói, tức là ý nghĩa.
Tasmā bhagavāti vacanaṃ seṭṭhanti bhagavāti iminā vacanena vacanīyo yo attho, so seṭṭhoti attho.
Therefore, in the phrase " Bhagavāti vacanaṃ seṭṭhaṃ," the meaning is that the meaning to be expressed by this word Bhagavā is supreme.
Vì vậy, Bhagavatāti vacanaṃ seṭṭhaṃ có nghĩa là ý nghĩa được diễn đạt bằng từ Bhagavat là tối thượng.
Bhagavāti vacanamuttamanti etthāpi eseva nayo.
The same method applies to " Bhagavāti vacanamuttamaṃ."
Ở đây cũng vậy đối với Bhagavatāti vacanamuttamaṃ.
Gāravayuttoti garubhāvayutto garuguṇayogato, garukaraṇaṃ vā sātisayaṃ arahatīti gāravayutto, gāravārahoti attho.
Gāravayutto means endowed with reverence, due to being endowed with qualities worthy of respect, or because he is exceedingly worthy of veneration, thus gāravayutto, meaning worthy of respect.
Gāravayutto có nghĩa là đầy đủ sự tôn kính, do sự liên kết với các đức tính đáng tôn kính; hoặc Ngài rất xứng đáng được tôn kính, tức là đáng được tôn kính.
Evaṃ guṇavisiṭṭhasattuttamagarugāravādhivacanametaṃ yadidaṃ bhagavāti.
Thus, this word Bhagavā is an appellation for the most excellent being, distinguished by qualities, worthy of great respect.
Vì vậy, từ Bhagavat này là một danh hiệu chỉ bậc tối thượng trong các chúng sinh, đầy đủ các đức tính đặc biệt, đáng được tôn kính và kính trọng.
Apica –
Furthermore—
Hơn nữa –
53
‘‘Bhagī bhajī bhāgī vibhattavā iti,
“He is endowed with blessings (bhagī), he partakes (bhajī), he possesses (bhāgī), he has distinguished (vibhattavā);
“Bhagī (có phước), bhajī (thường thực hành), bhāgī (có phần), vibhattavā (đã phân chia), v.v.,
54
Akāsi bhagganti garūti bhāgyavā;
He has broken (bhaggaṃ)*, he is venerable (garū), thus he is fortunate (bhāgyavā);
Ngài đã phá hủy (điều xấu ác); Ngài đáng được tôn kính; Ngài có phước báu;
55
Bahūhi ñāyehi subhāvitattano,
Having cultivated himself well through many methods,
Với tự ngã đã được tu tập tốt đẹp bằng nhiều phương pháp,
56
Bhavantago so bhagavāti vuccatī’’ti–
He has reached the end of existence (bhavantago), thus he is called Bhagavā.”
Ngài đã chấm dứt các kiếp sống, nên Ngài được gọi là Bhagavā”—
57
Niddese āgatanayena –
In accordance with what is stated in the Niddesa—
Theo phương pháp đã được trình bày trong Niddesa—
58
‘‘Bhāgyavā bhaggavā yutto, bhagehi ca vibhattavā;
“Fortunate (Bhāgyavā), having broken (bhaggavā), endowed with blessings (bhagehi yutto), and having distinguished (vibhattavā);
“Ngài có phước báu, đã phá hủy (điều xấu ác), đã được trang bị (các phẩm chất), đã chia sẻ (các phẩm chất);
59
Bhattavā vantagamano, bhavesu bhagavā tato’’ti.
He has partaken (bhattavā), he has vomited forth going (vantagamano) in existences—therefore he is Bhagavā.”
Ngài đã tích lũy (các phẩm chất), đã từ bỏ sự tái sinh, nên Ngài là Bhagavā trong các cõi sống.”
60
Imissā gāthāya ca vasena bhagavāti padassa attho vattabbo.
The meaning of the word Bhagavā should be explained in accordance with this verse.
Cũng theo ý nghĩa của bài kệ này, ý nghĩa của từ Bhagavā cần được giải thích.
So panāyaṃ attho sabbākārena visuddhimagge buddhānussatiniddese vuttoti.
This meaning is fully explained in the Buddhānussati Niddesa of the Visuddhimagga.
Ý nghĩa đó, với tất cả các khía cạnh, đã được trình bày trong phần giải thích về sự niệm Phật trong Visuddhimagga.
Tattha vuttanayeneva veditabbo.
It should be understood in the way stated there.
Cần phải hiểu theo phương pháp đã được trình bày ở đó.
61
Aparo nayo – bhāgavāti bhagavā, bhatavāti bhagavā, bhāge vanīti bhagavā, bhage vanīti bhagavā, bhattavāti bhagavā, bhage vamīti bhagavā, bhāge vamīti bhagavā.
Another method: Bhagavā means bhāgavā, bhatavā means Bhagavā, bhāge vanī means Bhagavā, bhage vanī means Bhagavā, bhattavā means Bhagavā, bhage vamī means Bhagavā, bhāge vamī means Bhagavā.
Một phương pháp khác: Bhāgavā là Bhagavā, Bhatavā là Bhagavā, Bhāge vanī là Bhagavā, Bhage vanī là Bhagavā, Bhattavā là Bhagavā, Bhage vamī là Bhagavā, Bhāge vamī là Bhagavā.
62
‘‘Bhāgavā bhatavā bhāge, bhage ca vani bhattavā;
“Bhāgavā, bhatavā, and in portions (bhāge), and in blessings (bhage) he desired, he partook (bhattavā);
“Vì Ngài có các phần công đức, đã tích lũy (các phẩm chất), mong muốn các phần (công đức),
63
Bhage vami tathā bhāge, vamīti bhagavā jino’’.
He vomited forth blessings (bhage vami), and likewise portions (bhāge) he vomited forth—thus the Conqueror is Bhagavā.”
Đã tích lũy (các phẩm chất), đã từ bỏ các phần (tham dục), và cũng đã từ bỏ các phần (phiền não), nên Ngài là Bhagavā, là Đấng Chiến Thắng.”
64
Tattha kathaṃ bhāgavāti bhagavā? Ye te sīlādayo dhammakkhandhā guṇakoṭṭhāsā, te anaññasādhāraṇā niratisayā tathāgatassa atthi upalabbhanti.
Therein, how is Bhagavā (one who possesses portions)? Those aggregates of Dhamma, such as sīla, and those portions of qualities, which are unique and unsurpassed, exist and are found in the Tathāgata.
Trong đó, làm thế nào mà Bhāgavā lại là Bhagavā? Những pháp uẩn như giới, v.v., những phần phẩm chất đó, là những phẩm chất độc đáo, vô thượng, có mặt và được tìm thấy nơi Đức Như Lai.
Tathā hissa sīlaṃ, samādhi, paññā, vimutti, vimuttiñāṇadassanaṃ, hirī, ottappaṃ, saddhā, vīriyaṃ, sati, sampajaññaṃ, sīlavisuddhi, cittavisuddhi, diṭṭhivisuddhi, samatho, vipassanā, tīṇi kusalamūlāni, tīṇi sucaritāni, tayo sammāvitakkā, tisso anavajjasaññā, tisso dhātuyo, cattāro satipaṭṭhānā, cattāro sammappadhānā, cattāro iddhipādā, cattāro ariyamaggā, cattāri ariyaphalāni, catasso paṭisambhidā, catuyoniparicchedakañāṇāni, cattāro ariyavaṃsā, cattāri vesārajjañāṇāni, pañca padhāniyaṅgāni, pañcaṅgiko sammāsamādhi, pañcañāṇiko sammāsamādhi, pañcindriyāni, pañca balāni, pañca nissāraṇīyā dhātuyo, pañca vimuttāyatanañāṇāni, pañca vimuttiparipācanīyā saññā, cha anussatiṭṭhānāni, cha gāravā, cha nissāraṇīyā dhātuyo, cha satatavihārā, cha anuttariyāni, cha nibbedhabhāgiyā saññā, cha abhiññā, cha asādhāraṇañāṇāni, satta aparihāniyā dhammā, satta ariyadhanāni, satta bojjhaṅgā, satta sappurisadhammā, satta nijjaravatthūni, satta saññā, satta dakkhiṇeyyapuggaladesanā, satta khīṇāsavabaladesanā, aṭṭha paññāpaṭilābhahetudesanā, aṭṭhasammattāni, aṭṭha lokadhammātikkamo, aṭṭha ārambhavatthūni, aṭṭha akkhaṇadesanā, aṭṭha mahāpurisavitakkā, aṭṭha abhibhāyatanadesanā, aṭṭha vimokkhā, nava yonisomanasikāramūlakā dhammā, nava pārisuddhipadhāniyaṅgāni, nava sattāvāsadesanā, nava āghātappaṭivinayā, nava saññā, nava nānattā, nava anupubbavihārā, dasa nāthakaraṇā dhammā, dasa kasiṇāyatanāni, dasa kusalakammapathā, dasa sammattāni, dasa ariyavāsā, dasa asekkhā dhammā, dasa tathāgatabalāni, ekādasa mettānisaṃsā, dvādasa dhammacakkākārā, terasa dhutaguṇā, cuddasa buddhañāṇāni, pañcadasa vimuttiparipācanīyā dhammā, soḷasavidhā ānāpānassati, soḷasa aparantapanīyā dhammā, aṭṭhārasa buddhadhammā, ekūnavīsati paccavekkhaṇañāṇāni, catucattālīsa ñāṇavatthūni, paññāsa udayabbayañāṇāni, paropaṇṇāsa kusaladhammā, sattasattati ñāṇavatthūni, catuvīsatikoṭisatasahassasamāpattisañcārimahāvajirañāṇaṃ, anantanayasamantapaṭṭhānapavicayapaccavekkhaṇadesanāñāṇāni, tathā anantāsu lokadhātūsu anantānaṃ sattānaṃ āsayādivibhāvanañāṇāni cāti, evamādayo anantā aparimāṇabhedā anaññasādhāraṇā niratisayā guṇabhāgā guṇakoṭṭhāsā vijjanti upalabbhanti.
Thus, indeed, for him there exist and are attained virtues such as sīla, samādhi, paññā, vimutti, vimuttiñāṇadassana, hirī, ottappa, saddhā, vīriya, sati, sampajañña, sīlavisuddhi, cittavisuddhi, diṭṭhivisuddhi, samatha, vipassanā; the three roots of skillfulness, the three good conduct, the three right thoughts, the three blameless perceptions, the three elements (dhātu), the four foundations of mindfulness, the four right efforts, the four bases of psychic power, the four Noble Paths, the four Noble Fruits, the four analytical knowledges (paṭisambhidā), the four knowledges discerning the wombs of rebirth, the four Noble Lineages, the four knowledges of self-confidence; the five factors of exertion, the five-factored right concentration, the five-knowledge right concentration, the five faculties, the five powers, the five elements of escape, the five knowledges of the liberation-sphere, the five perceptions conducive to the ripening of liberation; the six bases of recollection, the six respects, the six elements of escape, the six continuous abidings, the six unsurpassed things, the six perceptions conducive to penetration, the six higher knowledges (abhiññā), the six uncommon knowledges; the seven conditions of non-decline, the seven Noble Treasures, the seven factors of enlightenment, the seven qualities of a good person, the seven bases of wearing away (of defilements), the seven perceptions, the teaching on the seven persons worthy of offerings, the teaching on the seven powers of the Arahant; the teaching on the eight causes for the attainment of wisdom, the eight rightnesses, the transcendence of the eight worldly conditions, the eight bases for effort, the teaching on the eight inopportune moments, the eight thoughts of a great man, the teaching on the eight spheres of mastery, the eight liberations; the nine factors rooted in appropriate attention, the nine factors of exertion for purification, the teaching on the nine abodes of beings, the nine ways to subdue resentment, the nine perceptions, the nine varieties, the nine progressive abidings; the ten qualities that make one a protector, the ten kasiṇa-bases, the ten courses of wholesome action, the ten rightnesses, the ten Noble Dwellings, the ten qualities of one beyond training (asekkha), the ten powers of a Tathāgata; the eleven benefits of loving-kindness; the twelve aspects of the Wheel of Dhamma; the thirteen ascetic practices (dhutaguṇa); the fourteen knowledges of the Buddha; the fifteen qualities conducive to the ripening of liberation; the sixteen-fold mindfulness of breathing, the sixteen qualities not to be tormented; the eighteen unique qualities of a Buddha; the nineteen knowledges of review; the forty-four knowledge-bases; the fifty knowledges of rise and fall; the fifty-plus wholesome qualities; the seventy-seven knowledge-bases; the great diamond-knowledge that traverses two hundred and forty million types of attainments; the knowledges of teaching, reviewing, and investigating the infinite methods of the all-encompassing Paṭṭhāna; and similarly, the knowledges discerning the dispositions, etc., of countless beings in countless world-systems. Thus, such infinite, immeasurable, unparalleled, unsurpassed, and exclusive qualities and divisions of qualities exist and are attained.
Thật vậy, nơi Ngài có: giới, định, tuệ, giải thoát, giải thoát tri kiến, tàm, quý, tín, tinh tấn, niệm, tỉnh giác, giới thanh tịnh, tâm thanh tịnh, kiến thanh tịnh, chỉ, quán, ba căn lành, ba thiện hạnh, ba chánh tư duy, ba tưởng vô tội, ba giới, bốn niệm xứ, bốn chánh cần, bốn thần túc, bốn Thánh đạo, bốn Thánh quả, bốn phân tích đạo, các trí phân biệt bốn loại sinh, bốn Thánh chủng, bốn vô úy trí, năm chi tinh tấn, chánh định có năm chi, chánh định có năm trí, năm căn, năm lực, năm giới thoát ly, năm trí giải thoát xứ, năm tưởng làm chín muồi giải thoát, sáu niệm xứ, sáu sự tôn trọng, sáu giới thoát ly, sáu trú thường xuyên, sáu vô thượng, sáu tưởng hướng đến sự thấu triệt, sáu thắng trí, sáu trí vô song, bảy pháp bất thối chuyển, bảy Thánh tài, bảy chi giác, bảy pháp của bậc chân nhân, bảy sự đoạn trừ, bảy tưởng, bảy pháp thuyết về các bậc đáng cúng dường, bảy pháp thuyết về các lực của bậc lậu tận, tám pháp thuyết về nguyên nhân đạt được tuệ, tám chánh tính, tám sự vượt qua các pháp thế gian, tám sự khởi đầu, tám pháp thuyết về các thời không thích hợp, tám tư duy của bậc đại nhân, tám pháp thuyết về các thắng xứ, tám giải thoát, chín pháp có gốc từ như lý tác ý, chín chi tinh tấn thanh tịnh, chín pháp thuyết về các trú xứ của chúng sinh, chín cách đoạn trừ sân hận, chín tưởng, chín sai biệt, chín thứ lớp an trú, mười pháp làm thành bậc lãnh đạo, mười biến xứ, mười nghiệp đạo thiện, mười chánh tính, mười Thánh trú, mười pháp vô học, mười lực của Như Lai, mười một lợi ích của tâm từ, mười hai khía cạnh của bánh xe Chánh pháp, mười ba hạnh đầu đà, mười bốn trí của Phật, mười lăm pháp làm chín muồi giải thoát, mười sáu loại hơi thở vào ra, mười sáu pháp không gây khổ, mười tám Phật pháp, mười chín trí quán xét, bốn mươi bốn trí sở y, năm mươi trí sinh diệt, hơn năm mươi pháp lành, bảy mươi bảy trí sở y, trí kim cương vĩ đại vận hành trong hai trăm bốn mươi triệu ngàn tam muội, các trí thuyết pháp quán xét sự phân tích duyên khởi vô tận phương pháp, và các trí phân biệt căn tánh chúng sinh vô tận trong vô tận thế giới, v.v., vô số các phần phẩm chất, vô lượng sai biệt, độc đáo, vô thượng như vậy có mặt và được tìm thấy.
Tasmā yathāvuttavibhāgā guṇabhāgā assa atthīti bhāgavāti vattabbe.
Therefore, because he possesses these aforementioned divisions of qualities, he is called Bhāgavā.
Do đó, vì Ngài có các phần phẩm chất đã được phân loại như đã nói, nên Ngài được gọi là Bhāgavā.
Ākārassa rassattaṃ katvā ‘‘bhagavā’’ti vutto.
By shortening the long ‘ā’ sound, he is called “Bhagavā.”
Đã rút ngắn nguyên âm ‘ā’ thành ‘a’ nên được gọi là ‘‘Bhagavā’’.
Evaṃ tāva bhāgavāti bhagavā.
Thus, first, Bhāgavā is Bhagavā.
Thế là, Bhāgavā là Bhagavā.
65
‘‘Yasmā sīlādayo sabbe, guṇabhāgā asesato;
“Because all divisions of virtues, such as sīla, exist completely
“Vì tất cả các phần công đức, không sót một điều gì,
66
Vijjanti sugate tasmā, bhagavāti pavuccati’’.
in the Fortunate One, therefore he is called Bhagavā.”
Đều có mặt nơi Đức Thiện Thệ, nên Ngài được gọi là Bhagavā.”
67
Kathaṃ bhatavāti bhagavā? Ye te sabbalokahitāya ussukkamāpannehi manussattādike aṭṭha dhamme samodhānetvā sammāsambodhiyā katamahābhinīhārehi mahābodhisattehi paripūretabbā dānapāramī, sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramīti dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsa pāramiyo, dānādīni cattāri saṅgahavatthūni, cattāri adhiṭṭhānāni, attapariccāgo, nayanadhanarajjaputtadārapariccāgoti pañca mahāpariccāgā, pubbayogo, pubbacariyā, dhammakkhānaṃ, lokatthacariyā, ñātatthacariyā, buddhatthacariyāti evamādayo saṅkhepato vā puññasambhārañāṇasambhārā buddhakaradhammā, te mahābhinīhārato paṭṭhāya kappānaṃ satasahassādhikāni cattāri asaṅkhyeyyāni yathā hānabhāgiyā, saṃkilesabhāgiyā, ṭhitibhāgiyā, vā na honti; atha kho uttaruttari visesabhāgiyāva honti; evaṃ sakkaccaṃ nirantaraṃ anavasesato bhatā sambhatā assa atthīti bhatavāti bhagavā; niruttinayena takārassa gakāraṃ katvā.
How is the Blessed One called Bhatavā? Because He has accumulated and fulfilled the requisites for arahattamagga-ñāṇa and sabbassuta-ñāṇa, which are the thirty Pāramīs—namely, the ten Pāramīs (dāna, sīla, nekkhamma, paññā, vīriya, khanti, sacca, adhiṭṭhāna, mettā, upekkhā), the ten Upapāramīs, and the ten Paramatthapāramīs—which were to be fulfilled by the Great Bodhisattas who, striving for the welfare of all beings, combined the eight qualities such as human existence, and made great aspirations for Perfect Self-Enlightenment. Also, the four Saṅgahavatthus beginning with generosity, the four Adhiṭṭhānas, the five great sacrifices (of oneself, eyes, wealth, sons, and wife), Pubbayoga, Pubbacariyā, Dhammakkhāna, Lokatthacariyā, Ñātatthacariyā, Buddhatthacariyā, and other such qualities, which are the Buddha-making qualities, the accumulations of merit and wisdom, briefly speaking. These qualities, from the time of the great aspiration, for four asaṅkhyeyyas and one hundred thousand kappas, did not become conducive to decline, defilement, or stagnation; rather, they became increasingly conducive to distinction. Thus, the Blessed One is called Bhatavā because He respectfully, continuously, and completely accumulated and fulfilled these requisites for arahattamagga-ñāṇa and sabbassuta-ñāṇa. The 'ta' sound in 'Bhatavā' is changed to 'ga' according to the rules of etymology, making it Bhagavā.
Làm thế nào mà Bhatavā lại là Bhagavā? Những ba-la-mật như bố thí ba-la-mật, giới ba-la-mật, xuất ly ba-la-mật, tuệ ba-la-mật, tinh tấn ba-la-mật, nhẫn nại ba-la-mật, chân thật ba-la-mật, kiên định ba-la-mật, từ ba-la-mật, xả ba-la-mật—tức là mười ba-la-mật, mười ba-la-mật phụ, mười ba-la-mật tối thượng, tổng cộng ba mươi ba-la-mật; bốn pháp nhiếp sự như bố thí, v.v.; bốn sự kiên định; năm đại thí xả như xả thân, xả mắt, xả tài sản, xả vợ con; các pháp như sự tu tập trước đây, các hạnh nghiệp trước đây, sự giảng dạy Chánh pháp, sự hành động vì lợi ích thế gian, sự hành động vì lợi ích quyến thuộc, sự hành động vì lợi ích Phật quả—tóm lại, các pháp làm nên Phật quả, tức là các tư lương phước đức và tư lương trí tuệ, mà các vị Đại Bồ Tát đã tích lũy và hoàn thành sau khi đã phát đại nguyện thành Chánh Đẳng Giác, phối hợp tám pháp như nhân loại, v.v., với sự nỗ lực vì lợi ích tất cả chúng sinh, trong bốn a-tăng-kỳ và một trăm ngàn đại kiếp, không phải là những pháp thuộc về sự suy giảm, sự ô nhiễm, hay sự đứng yên; mà là những pháp thuộc về sự tăng trưởng đặc biệt liên tục; như vậy, Ngài đã tích lũy và hoàn thành một cách cẩn trọng, liên tục, không sót một điều gì, nên Ngài là Bhatavā, tức là Bhagavā; theo phương pháp ngữ nguyên học, chữ ‘ta’ được đổi thành ‘ga’.
Atha vā bhatavāti teyeva yathāvutte buddhakaradhamme vuttanayena bhari sambhari paripūresīti attho.
Alternatively, Bhatavā means that He accumulated, gathered, and fulfilled those very Buddha-making qualities mentioned above, in the manner described.
Hoặc, Bhatavā có nghĩa là Ngài đã tích lũy, đã hoàn thành các pháp làm nên Phật quả như đã nói, theo phương pháp đã trình bày.
Evampi bhatavāti bhagavā.
Thus, too, the Blessed One is called Bhatavā.
Như vậy, Bhatavā cũng là Bhagavā.
68
‘‘Yasmā sambodhiyā sabbe, dānapāramiādike;
“Because the Protector fulfilled all the requisites for enlightenment,
“Vì Đức Hộ Chủ đã tích lũy tất cả các tư lương
69
Sambhāre bhatavā nātho, tasmāpi bhagavā mato’’.
such as the Pāramī of giving, therefore He is known as Bhagavā.”
Như bố thí ba-la-mật, v.v., để đạt Chánh Đẳng Giác, nên Ngài cũng được xem là Bhagavā.”
70
Kathaṃ bhāge vanīti bhagavā? Ye te catuvīsatikoṭisatasahassasaṅkhā devasikaṃ vaḷañjanakasamāpattibhāgā, te anavasesato lokahitatthaṃ attano diṭṭhadhammasukhavihāratthañca niccakappaṃ vani bhaji sevi bahulamakāsīti bhāge vanīti bhagavā.
How is the Exalted One called Bhagavā, because he frequented the portions? Those portions of attainments, numbering two million four hundred thousand crores, which are daily entered, these he frequented, served, and practiced abundantly and completely, for the welfare of the world and for his own comfortable abiding in this very life. Thus, the Exalted One is called Bhagavā because he frequented the portions.
Làm thế nào mà Bhāge vanī lại là Bhagavā? Những phần tam muội được thực hành hàng ngày, tổng cộng hai trăm bốn mươi triệu ngàn, Ngài đã thực hành, đã tu tập, đã thực hiện nhiều lần không sót một điều gì, vì lợi ích thế gian và vì sự an lạc trong hiện tại của chính mình, luôn luôn, nên Ngài là Bhāge vanī, tức là Bhagavā.
Atha vā abhiññeyyesu dhammesu kusalādīsu khandhādīsu ca ye te pariññeyyādivasena saṅkhepato vā catubbidhā abhisamayabhāgā, vitthārato pana ‘‘cakkhu pariññeyyaṃ …pe… jarāmaraṇaṃ pariññeyya’’ntiādinā (paṭi. ma. 1.21) aneke pariññeyyabhāgā, ‘‘cakkhussa samudayo pahātabbo…pe… jarāmaraṇassa samudayo pahātabbo’’tiādinā pahātabbabhāgā, ‘‘cakkhussa nirodho sacchikātabbo…pe… jarāmaraṇassa nirodho sacchikātabbo’’tiādinā sacchikātabbabhāgā, ‘‘cakkhunirodhagāminīpaṭipadā bhāvetabbā…pe… cattāro satipaṭṭhānā bhāvetabbā’’tiādinā ca anekabhedā bhāvetabbabhāgā ca dhammā, te sabbe vani bhaji yathārahaṃ gocarabhāvanāsevanānaṃ vasena sevi.
Alternatively, among the knowable phenomena, such as wholesome qualities and the aggregates, there are four kinds of portions of comprehension (abhisamayabhāgā) in brief, depending on whether they are to be fully understood, and so forth. In detail, however, there are many portions to be fully understood, as in “the eye is to be fully understood…pe…aging-and-death is to be fully understood”; portions to be abandoned, as in “the origin of the eye is to be abandoned…pe…the origin of aging-and-death is to be abandoned”; portions to be realized, as in “the cessation of the eye is to be realized…pe…the cessation of aging-and-death is to be realized”; and many kinds of portions to be developed, as in “the path leading to the cessation of the eye is to be developed…pe…the four establishments of mindfulness are to be developed”. All these phenomena he frequented, served, according to what was appropriate, by way of their being objects of mindfulness and cultivation.
Hoặc, trong các pháp cần được biết (abhiññeyya-dhamma), như các pháp thiện, v.v., và các uẩn, v.v., có những phần chứng ngộ (abhisamaya-bhāga) gồm bốn loại tóm tắt theo cách cần được liễu tri, v.v., và chi tiết hơn, có vô số phần cần được liễu tri như “mắt cần được liễu tri... cho đến... già chết cần được liễu tri” (Paṭi. Ma. 1.21), các phần cần được đoạn trừ như “sự sinh khởi của mắt cần được đoạn trừ... cho đến... sự sinh khởi của già chết cần được đoạn trừ”, các phần cần được chứng đạt như “sự diệt của mắt cần được chứng đạt... cho đến... sự diệt của già chết cần được chứng đạt”, và các phần cần được tu tập với nhiều sai biệt như “con đường dẫn đến sự diệt của mắt cần được tu tập... cho đến... bốn niệm xứ cần được tu tập”—tất cả các pháp đó, Ngài đã thực hành, đã tu tập, đã phụng sự một cách thích đáng theo cách thực hành đối tượng và tu tập.
Evampi bhāge vanīti bhagavā.
Thus too, the Exalted One is called Bhagavā because he frequented the portions.
Như vậy, Bhāge vanī cũng là Bhagavā.
Atha vā ye ime sīlādayo dhammakkhandhā sāvakehi sādhāraṇā guṇakoṭṭhāsā guṇabhāgā, kinti nu kho te veneyyasantānesu patiṭṭhapeyyanti mahākaruṇāya vani abhipatthayi.
Alternatively, these aggregates of phenomena such as virtue, which are common shares of qualities (guṇakoṭṭhāsā) or portions of qualities (guṇabhāgā) for his disciples, he yearned for with great compassion, thinking, “How might these be established in the mental continuums of those to be trained?”
Hoặc, những pháp uẩn như giới, v.v., là những phần phẩm chất chung với các đệ tử, Ngài đã mong muốn với lòng đại bi rằng: "Làm thế nào để những phẩm chất này có thể được thiết lập trong dòng tâm thức của những người có thể được giáo hóa?"
Sā cassa abhipatthanā yathādhippetaphalāvahā ahosi.
And that aspiration of his brought forth the desired fruit.
Và sự mong muốn đó của Ngài đã mang lại kết quả như ý.
Evampi bhāge vanīti bhagavā.
Thus too, the Exalted One is called Bhagavā because he frequented the portions.
Như vậy, Bhāge vanī cũng là Bhagavā.
71
‘‘Yasmā ñeyyasamāpatti-guṇabhāge tathāgato;
“Because the Tathāgata,
“Vì Đức Như Lai đã mong muốn các phần phẩm chất của tam muội cần được biết,
72
Bhaji patthayi sattānaṃ, hitāya bhagavā tato’’.
Frequented and yearned for the portions of the quality of knowable attainments for the welfare of beings, therefore he is Bhagavā.”
Vì lợi ích của chúng sanh, Thế Tôn đã khao khát (những điều tốt đẹp). Do đó, Ngài là Bhagavā.
73
Kathaṃ bhage vanīti bhagavā? Samāsato tāva katapuññehi payogasampannehi yathāvibhavaṃ bhajīyantīti bhagā, lokiyalokuttarā sampattiyo.
How is the Exalted One called Bhagavā, because he enjoyed good fortune? Briefly, those mundane and supramundane achievements (sampattiyo) that are enjoyed by those who have done good deeds and are endowed with effort according to their means are called bhaga (good fortune).
Thế nào là Bhagavā vì đã thọ hưởng (vani) các phúc báu (bhage)? Trước hết, nói tóm tắt, các phúc báu thế gian và siêu thế được gọi là bhaga, là những gì được những người đã tạo công đức và đầy đủ sự tinh tấn thọ hưởng tùy theo khả năng.
Tattha lokiye tāva tathāgato sambodhito pubbe bodhisattabhūto paramukkaṃsagate vani bhaji sevi, yattha patiṭṭhāya niravasesato buddhakaradhamme samannānento buddhadhamme paripācesi.
Among these, in the mundane realm, the Tathāgata, as a Bodhisatta before his enlightenment, enjoyed and attained those of the highest excellence. Establishing himself therein, he matured the Buddha-qualities (buddhadhamma) by gathering completely the qualities that make one a Buddha.
Trong đó, trước hết, về các phúc báu thế gian, Như Lai, khi còn là Bồ Tát trước khi thành đạo, đã thọ hưởng và phụng sự những điều tối thượng, nhờ đó Ngài đã hoàn thiện các Phật pháp bằng cách tích lũy đầy đủ tất cả các pháp tạo nên Phật quả.
Buddhabhūto pana te niravajjasukhūpasaṃhite anaññasādhāraṇe lokuttarepi vani bhaji sevi.
Having become a Buddha, he also enjoyed and attained those blameless, subtle, and unique supramundane achievements.
Khi đã thành Phật, Ngài cũng đã thọ hưởng và phụng sự những phúc báu siêu thế vô tì vết, an lạc vi diệu, không ai khác có được.
Vitthārato pana padesarajjaissariyacakkavattisampattidevarajjasampattiādivasena jhānavimokkhasamādhisamāpattiñāṇadassanamaggabhāvanāphala- sacchikiriyādiuttarimanussadhammavasena ca anekavihite anaññasādhāraṇe bhage vani bhaji sevi.
In detail, he enjoyed and attained various unique kinds of good fortune, such as the glory of regional sovereignty, universal monarchy, and the majesty of a deva-king, as well as the transcendent human qualities (uttarimanussadhamma) like jhāna, vimokkha, samādhi, samāpatti, knowledge, vision, the cultivation of the path, and the realization of fruition.
Nói rộng ra, Ngài đã thọ hưởng và phụng sự vô số các phúc báu không ai khác có được, như các phúc báu của quyền lực lãnh thổ, của vua chuyển luân thánh vương, của chư thiên vương, v.v., và các pháp siêu nhân như thiền định, giải thoát, định, nhập định, trí tuệ, kiến giải, tu tập đạo, chứng đắc quả, v.v.
Evaṃ bhage vanīti bhagavā.
Thus, the Exalted One is called Bhagavā because he enjoyed good fortune.
Như vậy, vì đã thọ hưởng các phúc báu (bhage vanīti), nên Ngài là Bhagavā.
74
‘‘Yā tā sampattiyo loke, yā ca lokuttarā puthū;
“Because the Sambuddha enjoyed
“Vì tất cả những phúc báu trên thế gian,
75
Sabbā tā bhaji sambuddho, tasmāpi bhagavā mato’’.
All those various mundane and supramundane achievements in the world, therefore he is also known as Bhagavā.”
Và vô số phúc báu siêu thế mà Đức Sambuddha đã thọ hưởng, nên Ngài được biết đến là Bhagavā.”
76
Kathaṃ bhattavāti bhagavā? Bhattā daḷhabhattikā assa bahū atthīti bhagavā.
How is the Exalted One called Bhagavā, because he has devotees (bhattavā)? He is Bhagavā because he has many firm devotees (daḷhabhattikā).
Thế nào là Bhagavā vì có nhiều người quy ngưỡng (bhattavā)? Vì Ngài có nhiều người quy ngưỡng với lòng tin kiên cố, nên Ngài là Bhagavā.
Tathāgato hi mahākaruṇāsabbaññutaññāṇādiaparimitanirupamappabhāvaguṇavisesasamaṅgibhāvato sabbasattuttamo, sabbānatthaparihārapubbaṅgamāya niravasesahitasukhavidhānatapparāya niratisayāya payogasampattiyā sadevamanussāya pajāya accantūpakāritāya dvattiṃsamahāpurisalakkhaṇaasītianubyañjanabyāmappabhādi- anaññasādhāraṇaguṇavisesapaṭimaṇḍitarūpakāyatāya, yathābhuccaguṇādhigatena ‘‘itipi so bhagavā’’tiādinayappavattena lokattayabyāpinā suvipulena suvisuddhena ca thutighosena samannāgatattā ukkaṃsapāramippattāsu appicchatāsantuṭṭhitādīsu suppatiṭṭhitabhāvato dasabalacatuvesārajjādiniratisayaguṇavisesasamaṅgibhāvato ca rūpappamāṇo rūpappasanno, ghosappamāṇo ghosappasanno, lūkhappamāṇo lūkhappasanno, dhammappamāṇo dhammappasannoti evaṃ catuppamāṇike lokasannivāse sabbathāpi pasādāvahabhāvena samantapāsādikattā aparimāṇānaṃ sattānaṃ sadevamanussānaṃ ādarabahumānagāravāyatanatāya paramapemasambhattiṭṭhānaṃ.
Indeed, the Tathāgata, being endowed with immeasurable, incomparable, and powerful special qualities such as great compassion and omniscience, is the most excellent of all beings. He is supremely beneficial to all beings, gods and humans, through his unsurpassed accomplishment in effort, which begins with averting all harm and diligently provides all welfare and happiness. He possesses a physical form adorned with unique special qualities such as the thirty-two marks of a Great Man, the eighty minor characteristics, and an aura spanning a fathom. He is endowed with widespread and very pure sounds of praise throughout the three worlds, proceeding in the manner of "Iti pi so Bhagavā," attained through true qualities. He is firmly established in the highest perfections such as paucity of wants and contentment, and is endowed with unsurpassed special qualities such as the Ten Powers and the Four Kinds of Intrepidity. Thus, he is an object of profound love and devotion for countless beings, gods and humans, being universally delightful due to his ability to inspire confidence in every way in a world where people are delighted by form (rūpappamāṇo), by voice (ghosappamāṇo), by austerity (lūkhappamāṇo), and by Dhamma (dhamappamāṇo).
Thật vậy, Như Lai là bậc tối thượng trong tất cả chúng sanh vì Ngài đầy đủ vô lượng, vô song những đặc tính và công đức như đại bi và tuệ giác toàn tri; vì Ngài là bậc tối thượng có lợi ích cho chúng sanh, cả chư thiên và loài người, bằng sự tinh tấn vô song, luôn sẵn lòng ban bố hạnh phúc và lợi ích vô tận, với sự loại bỏ mọi bất hạnh là điều tiên quyết; vì Ngài có thân sắc được trang hoàng bởi các đặc tính vô song như ba mươi hai tướng tốt của bậc đại nhân, tám mươi tướng phụ, và hào quang một tầm; vì Ngài đầy đủ tiếng khen ngợi rộng lớn và thanh tịnh lan tỏa khắp ba cõi, được phát ra theo đúng công đức thực sự như “Đức Bhagavā ấy là như vậy”; vì Ngài kiên cố trong các pháp Ba-la-mật tối thượng như thiểu dục, tri túc, v.v.; và vì Ngài đầy đủ các đặc tính công đức vô song như mười lực, bốn vô sở úy, v.v., nên trong thế giới loài người với bốn loại người: người ngưỡng mộ hình tướng, người ngưỡng mộ âm thanh, người ngưỡng mộ sự khắc khổ, và người ngưỡng mộ giáo pháp, Ngài là bậc đáng kính trọng tuyệt đối từ mọi phương diện, là nơi nương tựa của lòng tôn kính, sự kính trọng và quý mến của vô lượng chúng sanh, cả chư thiên và loài người.
Ye ca tassa ovāde patiṭṭhitā aveccappasādena samannāgatā honti, kenaci asaṃhāriyā tesaṃ sambhatti samaṇena vā brāhmaṇena vā devena vā mārena vā brahmunā vā.
And those who are established in his teaching and endowed with unwavering faith (aveccappasāda) have a devotion that cannot be shaken by any ascetic, brahmin, god, Māra, or Brahmā.
Và những ai nương tựa vào lời giáo huấn của Ngài, đầy đủ lòng tịnh tín bất động, thì lòng quy ngưỡng của họ không thể bị lay chuyển bởi bất kỳ vị Sa-môn, Bà-la-môn, chư thiên, Ma vương hay Phạm thiên nào.
Tathā hi te attano jīvitapariccāgepi tattha pasādaṃ na pariccajanti, tassa vā āṇaṃ daḷhabhattibhāvato.
Indeed, they do not abandon their faith in him even at the cost of their lives, nor do they transgress his command due to their firm devotion.
Thật vậy, họ không từ bỏ lòng tịnh tín đối với Ngài, ngay cả khi phải hy sinh mạng sống của mình, hoặc không vi phạm giới luật của Ngài vì lòng quy ngưỡng kiên cố.
Tenevāha –
Therefore, it is said:
Vì vậy, Ngài đã nói:
77
‘‘Yo ve kataññū katavedi dhīro;
“He who is truly grateful, a knower of gratitude, wise,
“Này hiền giả, ai là người biết ơn, báo ơn,
78
Kalyāṇamitto daḷhabhatti ca hotī’’ti.(jā. 2.17.78);
A good friend, and firmly devoted.”
Là bạn lành và có lòng quy ngưỡng kiên cố.”
79
‘‘Seyyathāpi, bhikkhave, mahāsamuddo ṭhitadhammo velaṃ nātivattati; evameva kho, bhikkhave, yaṃ mayā sāvakānaṃ sikkhāpadaṃ paññattaṃ, taṃ mama sāvakā jīvitahetupi nātikkamantī’’ti (a. ni. 8.20; udā. 45; cūḷava. 385) ca.
And: “Just as, bhikkhus, the great ocean, being steadfast by nature, does not overstep its shore; even so, bhikkhus, the training rule that has been laid down by me for my disciples, my disciples do not transgress even for the sake of their lives.”
“Này các Tỳ-khưu, ví như đại dương có bản chất ổn định, không vượt quá bờ của nó; cũng vậy, này các Tỳ-khưu, giới luật nào Ta đã chế định cho các đệ tử, thì các đệ tử của Ta không bao giờ vi phạm, ngay cả vì mạng sống.”
80
Evaṃ bhattavāti bhagavā niruttinayena ekassa takārassa lopaṃ katvā itarassa gakāraṃ katvā.
Thus, Bhagavā is called bhattavā (having devotees), by the rule of etymology, after the elision of one 't' and the change of the other 't' to 'g'.
Như vậy, vì có nhiều người quy ngưỡng (bhattavā), nên Ngài là Bhagavā, bằng cách bỏ một chữ ‘t’ và biến chữ ‘t’ còn lại thành ‘g’ theo quy tắc ngữ nguyên học.
81
‘‘Guṇātisayayuttassa, yasmā lokahitesino;
“Because the Teacher, endowed with surpassing qualities,
“Vì có vô số người quy ngưỡng Bậc Đạo Sư,
82
Sambhattā bahavo satthu, bhagavā tena vuccatī’’ti.
And devoted to the welfare of the world, has many devotees, he is therefore called Bhagavā.”
Người có công đức siêu việt và là bậc lợi ích cho thế gian, nên Ngài được gọi là Bhagavā.”
83
Kathaṃ bhage vamīti bhagavā? Yasmā tathāgato bodhisattabhūtopi purimāsu jātīsu pāramiyo pūrento bhagasaṅkhātaṃ siriṃ issariyaṃ yasañca vami uggiri kheḷapiṇḍaṃ viya anapekkho chaḍḍayi.
How is the Exalted One called Bhagavā, because he vomited forth good fortune (bhage vamī)? Because the Tathāgata, even as a Bodhisatta in previous existences, while fulfilling the Pāramīs, vomited forth, disgorged, and discarded without attachment, like a lump of spittle, prosperity (siriṃ), sovereignty (issariyaṃ), and glory (yasaṃ), which are collectively termed bhaga (good fortune).
Thế nào là Bhagavā vì đã từ bỏ (vamīti) các phúc báu (bhage)? Vì Như Lai, ngay cả khi còn là Bồ Tát trong các kiếp trước, khi đang viên mãn các Ba-la-mật, đã từ bỏ sự vinh quang, quyền lực và danh tiếng được gọi là bhaga, Ngài đã nhổ bỏ chúng như nhổ một cục đờm, không chút luyến tiếc.
Tathā hissa somanassakumārakāle, hatthipālakumārakāle, ayogharapaṇḍitakāle, mūgapakkhapaṇḍitakāle, cūḷasutasomakāleti evamādīsu nekkhammapāramipūraṇavasena devarajjasadisāya rajjasiriyā pariccattattabhāvānaṃ parimāṇaṃ natthi.
Indeed, there is no measure to the number of existences in which he renounced the glory of kingship, similar to the sovereignty of a deva-king, by way of fulfilling the Pāramī of Renunciation (Nekkhammapāramī) during his lives as Prince Somanassa, Prince Hatthipāla, Paṇḍita Ayoghara, Paṇḍita Mūgapakkha, and King Cūḷasutasoma.
Thật vậy, không thể đếm được số lần Ngài đã từ bỏ vương quyền tương đương với quyền lực của chư thiên vương, trong các kiếp như khi Ngài là hoàng tử Somanassa, hoàng tử Hatthipāla, hiền giả Ayoghara, hiền giả Mūgapakkha, và vua Cūḷasutasoma, v.v., để viên mãn Ba-la-mật xuất ly.
Carimattabhāvepi hatthagataṃ cakkavattisiriṃ devalokādhipaccasadisaṃ catuddīpissariyaṃ cakkavattisampattisannissayaṃ sattaratanasamujjalaṃ yasañca tiṇāyapi amaññamāno nirapekkho pahāya abhinikkhamitvā sammāsambodhiṃ abhisambuddho.
Even in his last existence, he disregarded the glory of a universal monarch (cakkavattisiriṃ) that was in his grasp, which was like the dominion of the deva-world, the sovereignty over the four great continents, and the resplendent renown associated with the Seven Jewels, treating it as mere grass. He abandoned it without attachment, went forth from home, and fully awakened to Perfect Self-Enlightenment.
Ngay cả trong kiếp cuối cùng, Ngài cũng đã từ bỏ quyền lực của một vị Chuyển Luân Thánh Vương trong tầm tay, quyền lực trên bốn châu lục tương đương với quyền lực của chư thiên giới, và danh tiếng rực rỡ với bảy báu, coi chúng như cỏ rác, không chút luyến tiếc, rồi xuất gia và chứng đắc Chánh Đẳng Giác.
Tasmā ime siriādike bhage vamīti bhagavā.
Therefore, the Exalted One is called Bhagavā because he vomited forth these various kinds of good fortune, such as prosperity.
Do đó, vì đã từ bỏ các phúc báu như vinh quang, v.v., nên Ngài là Bhagavā.
Atha vā bhāni nāma nakkhattāni, tehi samaṃ gacchanti pavattantīti bhagā, sineruyugandharauttarakuruhimavantādibhājanalokavisesasannissayā sobhā kappaṭṭhitiyabhāvato.
Alternatively, bhāni refers to stars (nakkhattāni), and those things that move or occur in conjunction with them are called bhagā (good fortune). These are the splendours associated with the special kinds of worlds, such as Mount Sineru, Mount Yugandhara, Uttarakuru, and Himavanta, which endure for an eon.
Hoặc, bhā là các vì sao. Bhaga là những gì đồng hành và vận hành cùng với chúng, tức là vẻ đẹp nương tựa vào các thế giới đặc biệt như núi Sineru, Yugandhara, Uttarakuru, Himavanta, v.v., những nơi tồn tại suốt một kappa (kiếp trái đất).
Tepi bhagavā vami taṃnivāsisattāvāsasamatikkamanatotappaṭibaddhachandarāgappahānena pajahīti.
The Exalted One also vomited forth these, abandoning them by transcending the abodes of the beings residing there and relinquishing craving and attachment associated with them.
Thế Tôn cũng đã từ bỏ những điều đẹp đẽ ấy, bằng cách vượt qua nơi cư trú của chúng sanh và đoạn trừ tham ái chấp thủ vào chúng.
Evampi bhage vamīti bhagavā.
Thus too, the Exalted One is called Bhagavā because he vomited forth good fortune.
Như vậy, vì đã từ bỏ các phúc báu (bhage vamīti), nên Ngài là Bhagavā.
84
‘‘Cakkavattisiriṃ yasmā, yasaṃ issariyaṃ sukhaṃ;
“Because the Sugata abandoned the glory of a universal monarch,
“Vì Đức Sugata đã từ bỏ quyền lực Chuyển Luân Thánh Vương, danh tiếng, quyền uy và hạnh phúc,
85
Pahāsi lokacittañca, sugato bhagavā tato’’.
Renown, sovereignty, happiness, and the world’s delight, he is therefore Bhagavā.”
Cũng như tâm thế gian, nên Ngài là Bhagavā.”
86
Kathaṃ bhāge vamīti bhagavā? Bhāgā nāma koṭṭhāsā.
How is the Exalted One called Bhagavā, because he vomited forth portions (bhāge vamī)? Bhāgā means portions (koṭṭhāsā).
Thế nào là Bhagavā vì đã từ bỏ (vamīti) các phần (bhāge)? Bhāga có nghĩa là các phần.
Te khandhāyatanadhātādivasena, tatthāpi rūpavedanādivasena, atītādivasena ca anekavidhā.
These are of various kinds, such as by way of aggregates, sense bases, and elements, and within those, by way of form, feeling, etc., and by way of past, etc.
Chúng có nhiều loại khác nhau theo các uẩn, xứ, giới, v.v., và trong đó, theo sắc, thọ, v.v., và theo quá khứ, v.v.
Te ca bhagavā sabbaṃ papañcaṃ, sabbaṃ yogaṃ, sabbaṃ ganthaṃ, sabbaṃ saṃyojanaṃ, samucchinditvā amatadhātuṃ samadhigacchanto vami uggiri anapekkho chaḍḍayi, na paccāgami.
And the Blessed One, having entirely cut off all proliferation, all yokes, all fetters, all bonds, and having attained the Deathless element, vomited forth, ejected, renounced, cast aside without any longing, and did not return to them.
Khi Đức Bhagavā đoạn trừ tất cả hý luận, tất cả ách, tất cả kiết sử, tất cả tùy miên, và chứng đắc Niết Bàn, Ngài đã từ bỏ, nhổ bỏ chúng mà không chút luyến tiếc, không bao giờ quay lại.
Tathā hesa sabbatthakameva pathaviṃ, āpaṃ, tejaṃ, vāyaṃ, cakkhuṃ, sotaṃ, ghānaṃ, jīvhaṃ, kāyaṃ, manaṃ, rūpe, sadde, gandhe, rase, phoṭṭhabbe, dhamme, cakkhuviññāṇaṃ…pe… manoviññāṇaṃ, cakkhusamphassaṃ …pe… manosamphassaṃ, cakkhusamphassajaṃ vedanaṃ…pe… manosamphassajaṃ vedanaṃ, cakkhusamphassajaṃ saññaṃ…pe… manosamphassajaṃ saññaṃ; cakkhusamphassajaṃ cetanaṃ…pe… manosamphassajaṃ cetanaṃ; rūpataṇhaṃ …pe… dhammataṇhaṃ; rūpavitakkaṃ…pe… dhammavitakkaṃ; rūpavicāraṃ…pe… dhammavicārantiādinā anupadadhammavibhāgavasenapi sabbeva dhammakoṭṭhāse anavasesato vami uggiri anapekkhapariccāgena chaḍḍayi.
Therefore, this Blessed One also vomited forth, ejected, cast aside without any longing, without remainder, all these categories of phenomena, in the manner of analyzing phenomena step-by-step, such as the earth element, water element, fire element, air element, eye, ear, nose, tongue, body, mind, visible objects, sounds, odours, tastes, tactile objects, mental objects; eye-consciousness… mind-consciousness; eye-contact… mind-contact; feeling born of eye-contact… feeling born of mind-contact; perception born of eye-contact… perception born of mind-contact; volition born of eye-contact… volition born of mind-contact; craving for form… craving for mental objects; initial application of mind to form… initial application of mind to mental objects; sustained application of mind to form… sustained application of mind to mental objects, and so on.
Thật vậy, Ngài đã từ bỏ tất cả các phần của pháp một cách đầy đủ và không chút luyến tiếc, như đất, nước, lửa, gió, mắt, tai, mũi, lưỡi, thân, ý, sắc, thanh, hương, vị, xúc, pháp, nhãn thức... cho đến ý thức, nhãn xúc... cho đến ý xúc, thọ do nhãn xúc sinh... cho đến thọ do ý xúc sinh, tưởng do nhãn xúc sinh... cho đến tưởng do ý xúc sinh; tư do nhãn xúc sinh... cho đến tư do ý xúc sinh; tham sắc... cho đến tham pháp; tầm sắc... cho đến tầm pháp; tứ sắc... cho đến tứ pháp, v.v., theo cách phân tích từng pháp một.
Vuttañhetaṃ –
It has been said:
Điều này đã được nói:
87
‘‘Yaṃ taṃ, ānanda, cattaṃ vantaṃ muttaṃ pahīnaṃ paṭinissaṭṭhaṃ, taṃ tathāgato puna paccāgamissatīti netaṃ ṭhānaṃ vijjatī’’ti.(Dī. ni. 2.183) –
“That, Ananda, which has been discarded, vomited, liberated, abandoned, given up, for the Tathāgata to return to it again—that is impossible.”
“Này Ānanda, một khi Như Lai đã từ bỏ, nhổ bỏ, buông bỏ, đoạn trừ, xả ly, thì không có trường hợp nào Ngài sẽ quay lại với chúng.”
88
Evampi bhāge vamīti bhagavā.
In this way, the Blessed One is called Vamī (vomited forth) with regard to portions.
Như vậy, vì đã từ bỏ các phần (bhāge vamīti), nên Ngài là Bhagavā.
Atha vā bhāge vamīti sabbepi kusalākusale sāvajjānavajje hīnappaṇīte kaṇhasukkasappaṭibhāge dhamme ariyamaggañāṇamukhena vami uggiri anapekkho pariccaji pajahi, paresañca tathattāya dhammaṃ desesi.
Alternatively, the meaning of Bhāge vamī is that the Blessed One, through the insight of the noble path, vomited forth, ejected, renounced, and abandoned without any longing, all phenomena—wholesome and unwholesome, blameworthy and blameless, inferior and superior, with dark and bright counterparts—and taught the Dhamma for others to attain that same state.
Hoặc, bhāge vamīti có nghĩa là Ngài đã từ bỏ, nhổ bỏ, xả ly tất cả các pháp thiện và bất thiện, hữu tội và vô tội, thấp kém và cao thượng, các phần đen và trắng, thông qua tuệ giác của Thánh đạo, và Ngài đã thuyết pháp để người khác cũng đạt được điều đó.
Vuttampi cetaṃ –
It has also been said:
Điều này cũng đã được nói:
89
‘‘Dhammāpi vo, bhikkhave, pahātabbā pageva adhammā, kullūpamaṃ, vo bhikkhave, dhammaṃ desessāmi, nittharaṇatthāya no gahaṇatthāyā’’tiādi.(Ma. ni. 1.240) –
“Even dhammas, bhikkhus, are to be abandoned, how much more so non-dhammas! I will teach you, bhikkhus, the Dhamma as a raft, for crossing over, not for holding on to,” and so on.
“Này các Tỳ-khưu, ngay cả các pháp thiện cũng cần phải từ bỏ, huống hồ là các pháp bất thiện. Này các Tỳ-khưu, Ta sẽ thuyết pháp cho các con như một chiếc bè, để vượt qua chứ không phải để nắm giữ,” v.v.
90
Evampi bhāge vamīti bhagavā.
In this way, the Blessed One is called Vamī (vomited forth) with regard to portions.
Như vậy, vì đã từ bỏ các phần (bhāge vamīti), nên Ngài là Bhagavā.
91
‘‘Khandhāyatanadhātādi-dhammabhedā mahesinā;
“Since the Great Sage has vomited forth
“Vì Bậc Đại Hiền đã nhổ bỏ các pháp đen và trắng,
92
Kaṇhasukkā yato vantā, tatopi bhagavā mato’’.
the dark and bright distinctions of phenomena, such as aggregates, sense bases, and elements, therefore he is known as Bhagavā.”
Các phân loại pháp như uẩn, xứ, giới, v.v., nên Ngài được biết đến là Bhagavā.”
93
Tena vuttaṃ –
Therefore, it is said:
Vì vậy, đã nói:
94
‘‘Bhāgavā bhatavā bhāge, bhage ca vani bhattavā;
“Bhāgavā (fortunate one), Bhatavā (one who has consumed) portions, and one who desired (Vani) portions;
“Bhāgavā (có các phần công đức), Bhattavā (có nhiều người quy ngưỡng), Bhāge (các phần công đức) và Bhage (các phúc báu) đã thọ hưởng (vani), Bhattavā (có nhiều người quy ngưỡng);
95
Bhage vami tathā bhāge, vamīti bhagavā jino’’ti.
The Victorious One, Bhagavā, is called Vamī (one who vomited forth) portions and likewise vomited portions.”
Bhage (các phúc báu) đã từ bỏ (vami), và Bhāge (các phần pháp) cũng đã từ bỏ (vami); do đó, Bậc Chiến Thắng là Bhagavā.”
96
Tena bhagavatā.
By that Blessed One.
Do đó, bởi Bậc Bhagavā ấy. Arahatā (Bậc A-la-hán) là vì Ngài xa lìa các phiền não (kilesa), hoặc vì Ngài đã tiêu diệt tất cả các kẻ thù phiền não còn sót lại, hoặc vì Ngài đã phá hủy các nan hoa của bánh xe luân hồi, hoặc vì Ngài xứng đáng với các vật cúng dường, v.v., hoặc vì Ngài không có nơi ẩn náu khi làm điều ác. Vì những lý do này, Ngài là Arahatā.
Arahatāti kilesehi ārakattā, anavasesānaṃ vā kilesārīnaṃ hatattā, saṃsāracakkassa vā arānaṃ hatattā, paccayādīnaṃ arahattā, pāpakaraṇe rahābhāvāti imehi kāraṇehi arahatā.
Arahant is so called for these reasons: because he is far from defilements (ārakattā), or because he has slain all enemies of defilements (kilesārīnaṃ hatattā), or because he has broken the spokes (arānaṃ hatattā) of the wheel of saṃsāra, or because he is worthy (arahattā) of requisites and so on, or because there is no secrecy (rahābhāvā) in committing evil.
Arahatā (A-la-hán) là bậc Thánh vì: (1) xa lìa các phiền não (kilesa); (2) đã tiêu diệt tất cả kẻ thù là phiền não mà không còn sót lại; (3) đã phá hủy các nan hoa của bánh xe luân hồi; (4) xứng đáng thọ nhận các vật dụng cúng dường; và (5) không còn chỗ kín đáo để làm điều ác. Do những lý do này mà gọi là Arahatā.
Ayamettha saṅkhepo.
This is the brief explanation here.
Đây là phần tóm tắt ở đây.
Vitthāro pana visuddhimagge vuttanayena veditabbo.
The extensive explanation, however, should be understood in the manner stated in the Visuddhimagga.
Tuy nhiên, phần giải thích chi tiết cần được hiểu theo cách đã nói trong bộ Visuddhimagga.
97
Ettha ca bhagavatāti imināssa bhāgyavantatādīpanena kappānaṃ anekesu asaṅkhyeyyesu upacitapuññasambhārabhāvato satapuññalakkhaṇadharassa dvattiṃsamahāpurisalakkhaṇaasītianubyañjana- byāmappabhāketumālādipaṭimaṇḍitā anaññasādhāraṇā rūpakāyasampattidīpitā hoti.
Here, by the word Bhagavatā, by revealing his blessedness and so on, it is indicated that due to accumulating a mass of merit over countless eons, his unrivaled excellence in physical form is adorned with the characteristic of a hundred merits, the thirty-two marks of a great man, the eighty minor characteristics, a fathom-wide aura, and a light-halo.
Ở đây, với từ Bhagavatā (Thế Tôn), bằng cách chỉ rõ Ngài là bậc có phước báu, đã tích lũy công đức vô số kiếp, nên sự hoàn hảo của sắc thân Ngài được hiển lộ, được trang hoàng bởi ba mươi hai tướng tốt của bậc Đại nhân, tám mươi tướng phụ, hào quang một tầm, và vầng hào quang trên đỉnh đầu, v.v., vốn là những đặc điểm không ai sánh bằng.
Arahatāti imināssa anavasesakilesappahānadīpanena āsavakkhayapadaṭṭhānasabbaññutaññāṇādhigamaparidīpanato dasabalacatuvesārajjachaasādhāraṇañāṇaaṭṭhārasāveṇikabuddhadhammādi- acinteyyāparimeyyadhammakāyasampatti dīpitā hoti.
By the word Arahatā, by revealing his complete abandonment of defilements, it is indicated that his immeasurable and inconceivable excellence in Dhamma-body (dhammakāya) —comprising the ten powers, the four kinds of intrepidity, the six uncommon knowledges, the eighteen unique Buddha-qualities, and so on— is revealed by his attainment of all-knowing knowledge (sabbaññutañāṇa), which has the destruction of taints (āsavakkhaya) as its proximate cause.
Với từ Arahatā (A-la-hán), bằng cách chỉ rõ Ngài đã đoạn trừ tất cả phiền não không còn dư sót, đã chứng đắc Tuệ Toàn Tri (Sabbaññutaññāṇa) mà sự đoạn tận các lậu hoặc (Āsavakkhaya) là nhân cận, nên sự hoàn hảo của pháp thân Ngài được hiển lộ, vốn là những đặc tính không thể nghĩ bàn, không thể đo lường, như mười lực (Dasabala), bốn sự vô úy (Catuvesārajja), sáu trí tuệ bất cộng (Cha Asādhāraṇañāṇa), mười tám Phật pháp bất cộng (Aṭṭhārasāveṇikabuddhadhamma), v.v.
Tadubhayenapi lokiyasarikkhakānaṃ bahumatabhāvo, gahaṭṭhapabbajitehi abhigamanīyatā, tathā abhigatānañca tesaṃ kāyikacetasikadukkhāpanayane paṭibalabhāvo, āmisadānadhammadānehi upakāritā, lokiyalokuttarehi guṇehi saṃyojanasamatthatā ca pakāsitā hoti.
By both of these, it is made known that he is highly esteemed by those similar to worldly beings, approachable by both laypeople and monastics, capable of alleviating the physical and mental sufferings of those who approach him, beneficial through material giving and Dhamma giving, and capable of uniting with worldly and transcendent qualities.
Cả hai từ đó cũng cho thấy Ngài là bậc được nhiều người thế gian kính trọng, là bậc mà cả gia chủ và người xuất gia đều nên đến gần, và khi họ đến gần, Ngài có khả năng loại bỏ những khổ đau về thân và tâm cho họ, Ngài là bậc hữu ích qua việc bố thí vật chất (āmisadāna) và bố thí Pháp (dhammadāna), và có khả năng kết nối họ với các pháp thế gian và siêu thế.
98
Tathā bhagavatāti iminā caraṇadhammesu muddhabhūtadibbavihārādivihāravisesasamāyogaparidīpanena caraṇasampadā dīpitā hoti.
Similarly, by Bhagavatā, by revealing his endowment with special abodes, such as divine abodes, which are the pinnacle among the practices of conduct (caraṇa), his perfection in conduct (caraṇasampadā) is indicated.
Tương tự, với từ Bhagavatā, bằng cách chỉ rõ sự viên mãn của các biệt trú như Phạm trú (Brahmavihāra) và Thiên trú (Dibba Vihāra) là những trú xứ tối thượng trong các pháp hạnh (Caraṇadhamma), nên sự hoàn hảo về hạnh (Caraṇasampadā) được hiển lộ.
Arahatāti iminā sabbavijjāsu sikhāppattaāsavakkhayañāṇādhigamaparidīpanena vijjāsampadā dīpitā hoti.
By Arahatā, by revealing his attainment of the knowledge of the destruction of taints (āsavakkhayañāṇa), which is the culmination of all knowledges (vijjā), his perfection in knowledge (vijjāsampadā) is indicated.
Với từ Arahatā, bằng cách chỉ rõ sự chứng đắc Trí tuệ đoạn tận các lậu hoặc (Āsavakkhayañāṇa) đã đạt đến đỉnh cao trong tất cả các minh (Vijjā), nên sự hoàn hảo về minh (Vijjāsampadā) được hiển lộ.
Purimena vā antarāyikaniyyānikadhammānaṃ aviparītavibhattabhāvadīpanena pacchimavesārajjadvayasamāyogo, pacchimena savāsananiravasesakilesappahānadīpanena purimavesārajjadvayasamāyogo vibhāvito hoti.
Or, by the former, by revealing his correct classification of obstructive and liberating phenomena, his possession of the latter two kinds of intrepidity is made manifest; and by the latter, by revealing his complete abandonment of defilements along with their latent tendencies, his possession of the former two kinds of intrepidity is made manifest.
Hoặc, với từ trước (Bhagavatā) được hiển thị là sự kết hợp của hai sự vô úy sau (Pacchima Vesārajja Dvaya) bằng cách chỉ rõ sự phân biệt đúng đắn các pháp chướng ngại (Antarāyikadhammā) và các pháp dẫn đến giải thoát (Niyyānikadhammā); với từ sau (Arahatā) được hiển thị là sự kết hợp của hai sự vô úy trước (Purima Vesārajja Dvaya) bằng cách chỉ rõ sự đoạn trừ tất cả phiền não cùng với tập khí (Savāsana Niravasesakilesa).
99
Tathā purimena tathāgatassa paṭiññāsaccavacīsaccañāṇasaccaparidīpanena, kāmaguṇalokiyādhipaccayasalābhasakkārādipariccāgaparidīpanena, anavasesakilesābhisaṅkhārapariccāgaparidīpanena, ca saccādhiṭṭhānacāgādhiṭṭhānapāripūri pakāsitā hoti; dutiyena sabbasaṅkhārūpasamasamadhigamaparidīpanena, sammāsambodhiparidīpanena ca, upasamādhiṭṭhānapaññādhiṭṭhānapāripūri pakāsitā hoti.
Likewise, by the former, by revealing the Tathāgata’s truthfulness in his vows, words, and knowledge, and by revealing his renunciation of sense pleasures, worldly dominion, honor, gain, respect, and so on, and by revealing his renunciation of all defilements and formations, the fulfillment of the determination of truth (saccādhiṭṭhāna) and the determination of generosity (cāgādhiṭṭhāna) is declared; by the latter, by revealing his attainment of the appeasement of all formations and his perfect enlightenment, the fulfillment of the determination of peace (upasamādhiṭṭhāna) and the determination of wisdom (paññādhiṭṭhāna) is declared.
Tương tự, với từ trước (Bhagavatā), bằng cách chỉ rõ sự viên mãn của Sự kiên định về Chân thật (Saccādhiṭṭhāna) và Sự kiên định về Bố thí (Cāgādhiṭṭhāna) qua việc chỉ rõ sự chân thật trong lời hứa (Paṭiññāsacca), lời nói chân thật (Vacīsacca), trí tuệ chân thật (Ñāṇasacca) của Đức Như Lai, qua việc chỉ rõ sự từ bỏ các dục lạc (Kāmaguṇa), quyền lực thế gian (Lokiyādhipacca), lợi lộc, danh vọng, v.v., và qua việc chỉ rõ sự từ bỏ tất cả các phiền não và hành (Abhisaṅkhāra) không còn dư sót; với từ thứ hai (Arahatā), bằng cách chỉ rõ sự viên mãn của Sự kiên định về Tịch tịnh (Upasamādhiṭṭhāna) và Sự kiên định về Trí tuệ (Paññādhiṭṭhāna) qua việc chỉ rõ sự chứng đắc sự an tịnh của tất cả các hành (Sabbasaṅkhārūpasama) và qua việc chỉ rõ sự Giác ngộ Chánh đẳng Chánh giác (Sammāsambodhi).
Tathā hi bhagavato bodhisattabhūtassa lokuttaraguṇe katābhinīhārassa mahākaruṇāyogena yathāpaṭiññaṃ sabbapāramitānuṭṭhānena saccādhiṭṭhānaṃ, pāramitāpaṭipakkhapariccāgena cāgādhiṭṭhānaṃ, pāramitāguṇehi cittavūpasamena upasamādhiṭṭhānaṃ, pāramitāhi eva parahitūpāyakosallato paññādhiṭṭhānaṃ pāripūrigataṃ.
Thus, when the Blessed One was a Bodhisatta, having made a resolute aspiration for transcendent qualities, by virtue of great compassion and by practicing all pāramīs as vowed, his determination of truth was fulfilled; by renouncing what was contrary to the pāramīs, his determination of generosity was fulfilled; by the appeasement of mind through the qualities of the pāramīs, his determination of peace was fulfilled; and by his skill in means for the welfare of others through the pāramīs, his determination of wisdom was fulfilled.
Quả thật, khi Đức Thế Tôn còn là Bồ-tát, với đại bi tâm đã phát nguyện đạt đến các pháp siêu thế, Ngài đã hoàn thành Sự kiên định về Chân thật (Saccādhiṭṭhāna) bằng cách thực hành tất cả các Ba-la-mật đúng như lời đã hứa; hoàn thành Sự kiên định về Bố thí (Cāgādhiṭṭhāna) bằng cách từ bỏ những gì đối nghịch với Ba-la-mật; hoàn thành Sự kiên định về Tịch tịnh (Upasamādhiṭṭhāna) bằng cách làm cho tâm an tịnh với các đức tính Ba-la-mật; và hoàn thành Sự kiên định về Trí tuệ (Paññādhiṭṭhāna) bằng sự khéo léo trong phương tiện lợi ích cho người khác chính từ các Ba-la-mật.
100
Tathā ‘yācakajanaṃ avisaṃvādetvā dassāmī’ti paṭijānanena paṭiññaṃ avisaṃvādetvā dānena ca saccādhiṭṭhānaṃ, deyyapariccāgato cāgādhiṭṭhānaṃ, deyyapaṭiggāhakadānadeyyaparikkhayesu lobhadosamohabhayavūpasamena upasamādhiṭṭhānaṃ, yathārahaṃ yathākālaṃ yathāvidhi ca dānena paññuttaratāya ca paññādhiṭṭhānaṃ pāripūrigataṃ.
Similarly, by promising “I will give without disappointing beggars” and by giving without disappointing his promise, his determination of truth was fulfilled; by renouncing what was to be given, his determination of generosity was fulfilled; by the appeasement of greed, hatred, delusion, and fear concerning the recipient, the gift, and the exhaustion of the gift, his determination of peace was fulfilled; and by giving appropriately, timely, and according to proper procedure, and by the supremacy of his wisdom, his determination of wisdom was fulfilled.
Tương tự, bằng cách hứa "Ta sẽ ban cho mà không làm thất vọng người xin", và bằng cách bố thí mà không làm thất vọng lời hứa, Sự kiên định về Chân thật (Saccādhiṭṭhāna) đã được hoàn thành; bằng cách từ bỏ vật thí, Sự kiên định về Bố thí (Cāgādhiṭṭhāna) đã được hoàn thành; bằng cách làm cho tham, sân, si, sợ hãi lắng dịu khi nhận vật thí, người nhận vật thí và sự tiêu hao vật thí, Sự kiên định về Tịch tịnh (Upasamādhiṭṭhāna) đã được hoàn thành; và bằng cách bố thí đúng lúc, đúng cách, đúng quy định, và do có trí tuệ siêu việt, Sự kiên định về Trí tuệ (Paññādhiṭṭhāna) đã được hoàn thành.
Iminā nayena sesapāramīsupi caturādhiṭṭhānapāripūri veditabbā.
In this way, the fulfillment of the four determinations should be understood in the case of the remaining pāramīs as well.
Theo cách này, sự viên mãn của bốn sự kiên định cũng cần được hiểu trong các Ba-la-mật còn lại.
Sabbā hi pāramiyo saccappabhāvitā cāgābhibyañjitā upasamānubrūhitā paññāparisuddhāti evaṃ caturādhiṭṭhānasamudāgatassa tathāgatassa saccādhiṭṭhānaṃ saccādhiṭṭhānasamudāgamena sīlavisuddhi, cāgādhiṭṭhānasamudāgamena ājīvavisuddhi, upasamādhiṭṭhānasamudāgamena cittavisuddhi, paññādhiṭṭhānasamudāgamena diṭṭhivisuddhi.
For all pāramīs are permeated by truth, manifested by generosity, strengthened by peace, and purified by wisdom. Thus, for the Tathāgata, who possessed these four determinations, the determination of truth led to the purity of morality (sīlavisuddhi); the determination of generosity led to the purity of livelihood (ājīvavisuddhi); the determination of peace led to the purity of mind (cittavisuddhi); and the determination of wisdom led to the purity of views (diṭṭhivisuddhi).
Quả thật, tất cả các Ba-la-mật đều được thúc đẩy bởi chân thật (sacca), được biểu hiện bởi bố thí (cāga), được tăng trưởng bởi sự an tịnh (upasama), và được thanh tịnh bởi trí tuệ (paññā). Như vậy, đối với Đức Như Lai đã đạt được bốn sự kiên định, sự thanh tịnh về giới (Sīlavisuddhi) là do sự thành tựu của Sự kiên định về Chân thật (Saccādhiṭṭhāna); sự thanh tịnh về sinh kế (Ājīvavisuddhi) là do sự thành tựu của Sự kiên định về Bố thí (Cāgādhiṭṭhāna); sự thanh tịnh về tâm (Cittavisuddhi) là do sự thành tựu của Sự kiên định về Tịch tịnh (Upasamādhiṭṭhāna); và sự thanh tịnh về kiến (Diṭṭhivisuddhi) là do sự thành tựu của Sự kiên định về Trí tuệ (Paññādhiṭṭhāna).
Tathā saccādhiṭṭhānasamudāgamenassa saṃvāsena sīlaṃ veditabbaṃ, cāgādhiṭṭhānasamudāgamena saṃvohārena soceyyaṃ veditabbaṃ, upasamādhiṭṭhānasamudāgamena āpadāsu thāmo veditabbo, paññādhiṭṭhānasamudāgamena sākacchāya paññā veditabbā.
Likewise, by his determination of truth, his morality is to be known through his association; by his determination of generosity, his purity is to be known through his dealings; by his determination of peace, his fortitude is to be known in adversities; and by his determination of wisdom, his wisdom is to be known through discussion.
Tương tự, giới của Ngài được biết qua sự chung sống (Saṃvāsa) do sự thành tựu của Sự kiên định về Chân thật; sự trong sạch (Soceyya) được biết qua lời nói (Saṃvohāra) do sự thành tựu của Sự kiên định về Bố thí; sức mạnh (Thāma) được biết trong những lúc nguy hiểm (Āpadā) do sự thành tựu của Sự kiên định về Tịch tịnh; và trí tuệ (Paññā) được biết qua sự đàm luận (Sākacchā) do sự thành tựu của Sự kiên định về Trí tuệ.
101
Tathā saccādhiṭṭhānasamudāgamena aduṭṭho adhivāseti, cāgādhiṭṭhānasamudāgamena aluddho paṭisevati, upasamādhiṭṭhānasamudāgamena abhīto parivajjeti, paññādhiṭṭhānasamudāgamena amūḷho vinodeti.
Similarly, by his determination of truth, he endures without ill-will; by his determination of generosity, he partakes without craving; by his determination of peace, he avoids without fear; by his determination of wisdom, he dispels without delusion.
Tương tự, do sự thành tựu của Sự kiên định về Chân thật, Ngài nhẫn nại mà không sân hận; do sự thành tựu của Sự kiên định về Bố thí, Ngài thọ dụng mà không tham lam; do sự thành tựu của Sự kiên định về Tịch tịnh, Ngài tránh xa mà không sợ hãi; do sự thành tựu của Sự kiên định về Trí tuệ, Ngài loại bỏ mà không si mê.
Tathā saccādhiṭṭhānasamudāgamena cassa nekkhammasukhappatti, cāgādhiṭṭhānasamudāgamena pavivekasukhappatti, upasamādhiṭṭhānasamudāgamena upasamasukhappatti, paññādhiṭṭhānasamudāgamena sambodhisukhappatti dīpitā hoti.
And similarly, by his determination of truth, his attainment of the happiness of renunciation (nekkhamma-sukha) is indicated; by his determination of generosity, his attainment of the happiness of solitude (paviveka-sukha) is indicated; by his determination of peace, his attainment of the happiness of appeasement (upasama-sukha) is indicated; and by his determination of wisdom, his attainment of the happiness of enlightenment (sambodhi-sukha) is indicated.
Tương tự, do sự thành tựu của Sự kiên định về Chân thật, sự chứng đắc hạnh phúc viễn ly (Nekkhammasukha) được hiển lộ; do sự thành tựu của Sự kiên định về Bố thí, sự chứng đắc hạnh phúc độc cư (Pavivekasukha) được hiển lộ; do sự thành tựu của Sự kiên định về Tịch tịnh, sự chứng đắc hạnh phúc an tịnh (Upasamasukha) được hiển lộ; do sự thành tựu của Sự kiên định về Trí tuệ, sự chứng đắc hạnh phúc giác ngộ (Sambodhisukha) được hiển lộ.
Saccādhiṭṭhānasamudāgamena vā vivekajapītisukhappatti, cāgādhiṭṭhānasamudāgamena samādhijapītisukhappatti, upasamādhiṭṭhānasamudāgamena apītijakāyasukhappatti, paññādhiṭṭhānasamudāgamena satipārisuddhijaupekkhāsukhappatti.
Or, by means of the arising of the Adhiṭṭhāna of Truth, there is the attainment of the joy and happiness born of seclusion; by means of the arising of the Adhiṭṭhāna of Renunciation, the attainment of the joy and happiness born of concentration; by means of the arising of the Adhiṭṭhāna of Tranquility, the attainment of physical happiness free from rapture; by means of the arising of the Adhiṭṭhāna of Wisdom, the attainment of the happiness of equanimity born of purity of mindfulness. Furthermore, by means of the arising of the Adhiṭṭhāna of Truth, the combination with the happiness of conditions characterized by the accomplishment of retinue is declared due to its infallibility; by means of the arising of the Adhiṭṭhāna of Renunciation, the combination with the happiness of nature characterized by contentment is declared due to the absence of greed; by means of the arising of the Adhiṭṭhāna of Tranquility, the combination with the causal happiness characterized by having done merit is declared due to not being overcome by defilements; by means of the arising of the Adhiṭṭhāna of Wisdom, the combination with the happiness of the cessation of suffering characterized by the accomplishment of liberation is declared, due to the attainment of Nibbāna through the accomplishment of knowledge.
Hoặc, do sự thành tựu của Sự kiên định về Chân thật, sự chứng đắc hỷ lạc do viễn ly (Vivekaja Pītisukha) được hiển lộ; do sự thành tựu của Sự kiên định về Bố thí, sự chứng đắc hỷ lạc do định (Samādhija Pītisukha) được hiển lộ; do sự thành tựu của Sự kiên định về Tịch tịnh, sự chứng đắc thân lạc không hỷ (Apītija Kāyasukha) được hiển lộ; do sự thành tựu của Sự kiên định về Trí tuệ, sự chứng đắc xả lạc do niệm thanh tịnh (Satipārisuddhija Upekkhāsukha) được hiển lộ.
Tathā saccādhiṭṭhānasamudāgamena parivārasampattilakkhaṇapaccayasukhasamāyogo paridīpito hoti avisaṃvādanato, cāgādhiṭṭhānasamudāgamena santuṭṭhilakkhaṇasabhāvasukhasamāyogo alobhabhāvato, upasamādhiṭṭhānasamudāgamena katapuññatālakkhaṇahetusukhasamāyogo kilesehi anabhibhūtabhāvato, paññādhiṭṭhānasamudāgamena vimuttisampattilakkhaṇadukkhūpasamasukhasamāyogo paridīpito hoti, ñāṇasampattiyā nibbānādhigamanato.
Thus, by means of the arising of the Adhiṭṭhāna of Truth, he endures without anger; by means of the arising of the Adhiṭṭhāna of Renunciation, he partakes without craving; by means of the arising of the Adhiṭṭhāna of Tranquility, he avoids without fear; by means of the arising of the Adhiṭṭhāna of Wisdom, he eliminates without delusion. Furthermore, by means of the arising of the Adhiṭṭhāna of Truth, there is the attainment of the happiness of renunciation; by means of the arising of the Adhiṭṭhāna of Renunciation, the attainment of the happiness of seclusion; by means of the arising of the Adhiṭṭhāna of Tranquility, the attainment of the happiness of Nibbāna; by means of the arising of the Adhiṭṭhāna of Wisdom, the attainment of the happiness of Sambodhi (enlightenment).
Tương tự, do sự thành tựu của Sự kiên định về Chân thật, sự kết hợp của hạnh phúc nhân duyên (Paccayasukha) mang đặc tính viên mãn về quyến thuộc (Parivārasampatti) được hiển lộ vì không sai lời; do sự thành tựu của Sự kiên định về Bố thí, sự kết hợp của hạnh phúc tự tính (Sabāvasukha) mang đặc tính tri túc (Santuṭṭhi) được hiển lộ vì không tham lam; do sự thành tựu của Sự kiên định về Tịch tịnh, sự kết hợp của hạnh phúc nhân (Hetusukha) mang đặc tính đã làm phước (Katapuññatā) được hiển lộ vì không bị phiền não chi phối; do sự thành tựu của Sự kiên định về Trí tuệ, sự kết hợp của hạnh phúc diệt khổ (Dukkhūpasamasukha) mang đặc tính viên mãn giải thoát (Vimuttisampatti) được hiển lộ, vì nhờ sự viên mãn về trí tuệ mà chứng đắc Niết-bàn.
102
Tathā saccādhiṭṭhānasamudāgamena ariyassa sīlakkhandhassa anubodhappaṭivedhasiddhi, cāgādhiṭṭhānasamudāgamena ariyassa samādhikkhandhassa, paññādhiṭṭhānasamudāgamena ariyassa paññākkhandhassa, upasamādhiṭṭhānasamudāgamena ariyassa vimuttikkhandhassa anubodhappaṭivedhasiddhi dīpitā hoti.
Furthermore, by means of the arising of the Adhiṭṭhāna of Truth, there is the success of comprehension and penetration of the Noble aggregate of morality; by means of the arising of the Adhiṭṭhāna of Renunciation, of the Noble aggregate of concentration; by means of the arising of the Adhiṭṭhāna of Wisdom, of the Noble aggregate of wisdom; by means of the arising of the Adhiṭṭhāna of Tranquility, of the Noble aggregate of liberation. And by the fulfillment of the Adhiṭṭhāna of Truth, there is the success of austerities; by the fulfillment of the Adhiṭṭhāna of Renunciation, the success of all relinquishments; by the fulfillment of the Adhiṭṭhāna of Tranquility, the success of sense-restraint; by the fulfillment of the Adhiṭṭhāna of Wisdom, the success of understanding, and thereby the success of Nibbāna. Furthermore, by the fulfillment of the Adhiṭṭhāna of Truth, there is the acquisition of the comprehension of the Four Noble Truths; by the fulfillment of the Adhiṭṭhāna of Renunciation, the acquisition of the Four Noble Lineages; by the fulfillment of the Adhiṭṭhāna of Tranquility, the acquisition of the Four Noble Abodes; by the fulfillment of the Adhiṭṭhāna of Wisdom, the acquisition of the Four Noble Discourses is declared.
Tương tự, do sự thành tựu của Sự kiên định về Chân thật, sự thành tựu của việc thấu hiểu và chứng nhập giới uẩn bậc Thánh (Ariya Sīlakkhandha) được hiển lộ; do sự thành tựu của Sự kiên định về Bố thí, sự thành tựu của định uẩn bậc Thánh (Ariya Samādhikkhandha) được hiển lộ; do sự thành tựu của Sự kiên định về Trí tuệ, sự thành tựu của tuệ uẩn bậc Thánh (Ariya Paññākkhandha) được hiển lộ; do sự thành tựu của Sự kiên định về Tịch tịnh, sự thành tựu của giải thoát uẩn bậc Thánh (Ariya Vimuttikkhandha) được hiển lộ.
Saccādhiṭṭhānaparipūraṇena ca tapasiddhi, cāgādhiṭṭhānaparipūraṇena sabbanissaggasiddhi, upasamādhiṭṭhānaparipūraṇena indriyasaṃvarasiddhi, paññādhiṭṭhānaparipūraṇena buddhisiddhi, tena ca nibbānasiddhi.
And by the fulfillment of the Adhiṭṭhāna of Truth, there is the success of the four requisites; by the fulfillment of the Adhiṭṭhāna of Renunciation, the success of all relinquishments; by the fulfillment of the Adhiṭṭhāna of Tranquility, the success of sense-restraint; by the fulfillment of the Adhiṭṭhāna of Wisdom, the success of understanding, and thereby the success of Nibbāna.
Và do sự hoàn thành Sự kiên định về Chân thật, sự thành tựu của khổ hạnh (Tapasiddhi) được hiển lộ; do sự hoàn thành Sự kiên định về Bố thí, sự thành tựu của sự từ bỏ mọi thứ (Sabbanissaggasiddhi) được hiển lộ; do sự hoàn thành Sự kiên định về Tịch tịnh, sự thành tựu của sự hộ trì các căn (Indriyasaṃvarasiddhi) được hiển lộ; do sự hoàn thành Sự kiên định về Trí tuệ, sự thành tựu của trí tuệ (Buddhisiddhi) được hiển lộ, và nhờ đó là sự thành tựu của Niết-bàn (Nibbānasiddhi).
Tathā saccādhiṭṭhānaparipūraṇena catuariyasaccābhisamayappaṭilābho, cāgādhiṭṭhānaparipūraṇena catuariyavaṃsappaṭilābho, 0.upasamādhiṭṭhānaparipūraṇena catuariyavihārappaṭilābho, paññādhiṭṭhānaparipūraṇena catuariyavohārappaṭilābho dīpito hoti.
Furthermore, by the fulfillment of the Adhiṭṭhāna of Truth, there is the acquisition of the comprehension of the Four Noble Truths; by the fulfillment of the Adhiṭṭhāna of Renunciation, the acquisition of the Four Noble Lineages; by the fulfillment of the Adhiṭṭhāna of Tranquility, the acquisition of the Four Noble Abodes; by the fulfillment of the Adhiṭṭhāna of Wisdom, the acquisition of the Four Noble Discourses is declared.
Tương tự, do sự hoàn thành Sự kiên định về Chân thật, sự chứng đắc Tứ Diệu Đế (Catuariyasaccābhisamaya) được hiển lộ; do sự hoàn thành Sự kiên định về Bố thí, sự chứng đắc bốn dòng dõi bậc Thánh (Catuariyavaṃsa) được hiển lộ; do sự hoàn thành Sự kiên định về Tịch tịnh, sự chứng đắc bốn trú xứ bậc Thánh (Catuariyavihāra) được hiển lộ; do sự hoàn thành Sự kiên định về Trí tuệ, sự chứng đắc bốn cách nói của bậc Thánh (Catuariyavohāra) được hiển lộ.
103
Aparo nayo – bhagavatāti etena sattānaṃ lokiyalokuttarasampattiabhikaṅkhādīpanena tathāgatassa mahākaruṇā pakāsitā hoti.
Another method: By this* " Bhagavā" (Blessed One), the Tathāgata's great compassion is revealed by showing His aspiration for the worldly and supramundane prosperity of beings.
Một cách khác – với từ Bhagavatā, bằng cách chỉ rõ sự mong cầu hạnh phúc thế gian và siêu thế của chúng sanh, nên đại bi tâm của Đức Như Lai được hiển lộ.
Arahatāti etena pahānasampattidīpanena pahānapaññā pakāsitā hoti.
By this* " Arahatā" (Arahant), the wisdom of abandonment is revealed by showing the accomplishment of abandonment.
Với từ Arahatā, bằng cách chỉ rõ sự viên mãn của sự đoạn trừ (Pahāna), nên trí tuệ đoạn trừ (Pahānapaññā) được hiển lộ.
Tattha paññāyassa dhammarajjapatti, karuṇāya dhammasaṃvibhāgo; paññāya saṃsāradukkhanibbidā, karuṇāya saṃsāradukkhasahanaṃ; paññāya paradukkhaparijānanaṃ, karuṇāya paradukkhappaṭikārārambho.
Therein, by wisdom, He attained the kingship of Dhamma; by compassion, He elucidated the Dhamma. By wisdom, there was disenchantment with the suffering of saṃsāra; by compassion, the endurance of the suffering of saṃsāra. By wisdom, the full understanding of others' suffering; by compassion, the undertaking to remedy others' suffering.
Ở đó, sự chứng đắc Pháp vương (Dhammarājapatti) của Ngài là do trí tuệ (Paññā), sự phân chia Pháp là do lòng bi (Karuṇā); sự chán ghét khổ đau luân hồi (Saṃsāradukkhanibbidā) là do trí tuệ, sự chịu đựng khổ đau luân hồi (Saṃsāradukkhasahana) là do lòng bi; sự hiểu rõ khổ đau của người khác (Paradukkhaparijānana) là do trí tuệ, sự khởi xướng cứu giúp khổ đau của người khác (Paradukkhappaṭikārārambha) là do lòng bi.
Paññāya parinibbānābhimukhabhāvo, karuṇāya tadadhigamo; paññāya sayaṃ taraṇaṃ, karuṇāya paresaṃ tāraṇaṃ; paññāya buddhabhāvasiddhi, karuṇāya buddhakiccasiddhi.
By wisdom, His face was turned towards Parinibbāna; by compassion, He attained it. By wisdom, He crossed over Himself; by compassion, He enabled others to cross over. By wisdom, the accomplishment of Buddhahood; by compassion, the accomplishment of the Buddha's tasks.
Sự hướng đến Niết-bàn (Parinibbānābhimukhabhāva) là do trí tuệ, sự chứng đắc Niết-bàn (Tadadhigama) là do lòng bi; sự tự mình vượt qua (Sayaṃ Taraṇa) là do trí tuệ, sự giúp người khác vượt qua (Paresaṃ Tāraṇa) là do lòng bi; sự thành tựu Phật quả (Buddhabhāvasiddhi) là do trí tuệ, sự thành tựu Phật sự (Buddhakiccasiddhi) là do lòng bi.
Karuṇāya vā bodhisattabhūmiyaṃ saṃsārābhimukhabhāvo, paññāya tattha anabhirati.
Or, by compassion, there was His orientation towards saṃsāra in the Bodhisatta stage; by wisdom, His non-delight therein.
Hoặc, sự hướng về luân hồi (Saṃsārābhimukhabhāva) trong địa vị Bồ-tát là do lòng bi, sự không hoan hỷ trong đó (Anabhirati) là do trí tuệ.
Tathā karuṇāya paresaṃ avihiṃsanaṃ, paññāya sayaṃ parehi abhāyanaṃ; karuṇāya paraṃ rakkhanto attānaṃ rakkhati, paññāya attānaṃ rakkhanto paraṃ rakkhati.
Furthermore, by compassion, the non-harming of others; by wisdom, His not being intimidated by others. By compassion, protecting others, He protects himself; by wisdom, protecting himself, He protects others.
Tương tự, sự không làm hại người khác (Aparahiṃsana) là do lòng bi, sự không bị người khác làm hại (Abhāyana) là do trí tuệ; khi bảo vệ người khác (Paraṃ Rakkhato), Ngài bảo vệ chính mình (Attānaṃ Rakkhati) là do lòng bi; khi bảo vệ chính mình (Attānaṃ Rakkhato), Ngài bảo vệ người khác (Paraṃ Rakkhati) là do trí tuệ.
Tathā karuṇāya aparantapo, paññāya anattantapo.
Furthermore, by compassion, He does not torment others; by wisdom, He does not torment himself.
Tương tự, không làm khổ người khác (Aparantapo) là do lòng bi, không làm khổ chính mình (Anattantapo) là do trí tuệ.
Tena attahitāya paṭipannādīsu catutthapuggalabhāvo siddho hoti.
Thereby, He is established as the fourth type of person among those who practice for their own benefit, and so forth.
Do đó, trong số những người thực hành vì lợi ích của bản thân, v.v., địa vị của hạng người thứ tư được thành tựu.
104
Tathā karuṇāya lokanāthatā, paññāya attanāthatā; karuṇāya cassa ninnatābhāvo, paññāya unnatābhāvo.
Furthermore, by compassion, He is the refuge of the world; by wisdom, He is his own refuge. And by compassion, He is not lowly; by wisdom, He is not exalted.
Cũng vậy, nhờ lòng bi mẫn, Ngài là chỗ nương tựa của thế gian; nhờ trí tuệ, Ngài là chỗ nương tựa của chính mình. Nhờ lòng bi mẫn, Ngài không có sự thấp kém; nhờ trí tuệ, Ngài không có sự cao ngạo.
Tathā karuṇāya sabbasattesu janitānuggaho, paññānugatattā na ca na sabbattha virattacitto; paññāya sabbadhammesu virattacitto, karuṇānugatattā na ca na sabbasattānuggahāya pavatto.
Furthermore, by compassion, He generates benevolence towards all beings, and by being imbued with wisdom, His mind is not dispassionate towards all. By wisdom, His mind is dispassionate towards all phenomena, and by being imbued with compassion, He does not refrain from acting for the benefit of all beings.
Cũng vậy, nhờ lòng bi mẫn, Ngài đã ban ân huệ cho tất cả chúng sinh; và vì được trí tuệ dẫn dắt, tâm Ngài không phải là không ly tham đối với tất cả. Nhờ trí tuệ, tâm Ngài ly tham đối với tất cả các pháp; và vì được lòng bi mẫn dẫn dắt, Ngài không phải là không hành động vì lợi ích của tất cả chúng sinh.
Yathā hi karuṇā tathāgatassa sinehasokavirahitā, evaṃ paññā ahaṃkāramamaṃkāravinimuttāti aññamaññaṃ visodhitā paramavisuddhāti daṭṭhabbā.
Indeed, just as the Tathāgata's compassion is free from attachment and sorrow, so too His wisdom is free from ego-conceit and possessiveness. Thus, they should be understood as mutually purified and supremely pure.
Thật vậy, lòng bi mẫn của Đức Như Lai không có ái luyến và sầu muộn, cũng như trí tuệ không có ngã mạn và ngã sở; như vậy, chúng được thanh lọc lẫn nhau và được xem là tối thượng thanh tịnh.
Tattha paññākhettaṃ balāni, karuṇākhettaṃ vesārajjāni.
Therein, the field of wisdom is the powers; the field of compassion is the fearlessnesses.
Trong đó, lĩnh vực của trí tuệ là các mười lực (balāni), lĩnh vực của lòng bi mẫn là các bốn vô úy (vesārajjāni).
Tesu balasamāyogena parehi na abhibhuyyati, vesārajjasamāyogena pare abhibhavati.
Among these, by being endowed with the powers, He is not overcome by others; by being endowed with the fearlessnesses, He overcomes others.
Trong hai điều này, nhờ sự kết hợp với các lực, Ngài không bị người khác khuất phục; nhờ sự kết hợp với các vô úy, Ngài khuất phục được người khác.
Balehi satthusampadāsiddhi, vesārajjehi sāsanasampadāsiddhi.
By the powers, there is the accomplishment of the Teacher's qualities; by the fearlessnesses, the accomplishment of the Dispensation's qualities.
Nhờ các lực, sự thành tựu của Tài sản Bậc Đạo Sư (Satthusampadā) được hoàn thành; nhờ các vô úy, sự thành tựu của Tài sản Giáo Pháp (Sāsanasampadā) được hoàn thành.
Tathā balehi buddharatanasiddhi, vesārajjehi dhammaratanasiddhīti ayamettha ‘‘bhagavatā arahatā’’ti padadvayassa atthayojanāya mukhamattadassanaṃ.
Furthermore, by the powers, there is the accomplishment of the Buddha-gem; by the fearlessnesses, the accomplishment of the Dhamma-gem. This is merely an indication of the method of explaining the meaning of the two terms, "Bhagavā" and "Arahatā," here.
Cũng vậy, nhờ các lực, sự thành tựu của Phật Bảo (Buddharatana) được hoàn thành; nhờ các vô úy, sự thành tựu của Pháp Bảo (Dhammaratana) được hoàn thành. Đây là lời trình bày sơ lược về ý nghĩa của hai từ “Đức Thế Tôn, bậc A-la-hán” trong ngữ cảnh này.
105
Kasmā panettha ‘‘vuttañhetaṃ bhagavatā’’ti vatvā puna ‘‘vutta’’nti vuttaṃ?
Why is it said "it was spoken by the Bhagavā" and then again "spoken"?
Vì sao ở đây, sau khi nói “Điều này đã được Đức Thế Tôn thuyết giảng”, lại nói lại “đã được thuyết giảng” một lần nữa?
Anussavapaṭikkhepena niyamadassanatthaṃ.
To show the certainty by precluding hearsay.
Để chỉ rõ sự chắc chắn bằng cách bác bỏ sự truyền miệng.
Yathā hi kenaci parato sutvā vuttaṃ yadipi ca jānantena vuttaṃ, na teneva vuttaṃ parenapi vuttattā.
Indeed, if something is spoken by someone after hearing it from another, even if the speaker knows it, it is not spoken by him alone because it was also spoken by another.
Thật vậy, lời nói của một người nào đó nghe từ người khác, dù người đó có biết, thì không phải là lời nói của chính người đó, vì nó cũng đã được người khác nói.
Na ca taṃ tena vuttameva, apica kho sutampi, na evamidha.
And it is not that it was spoken by him alone, but rather it was also heard. It is not so here.
Và điều đó không phải chỉ do người đó nói, mà còn là điều đã được nghe; nhưng ở đây thì không như vậy.
Bhagavatā hi parato asutvā sayambhuñāṇena attanā adhigatameva vuttanti imassa visesassa dassanatthaṃ dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
To show this distinction, that the Bhagavā spoke what He Himself had realized through His self-existent knowledge, without hearing it from another, the word "spoken" is said twice.
Để chỉ rõ sự đặc biệt này, rằng Đức Thế Tôn đã thuyết giảng điều mà Ngài tự mình chứng ngộ bằng trí tuệ tự sinh, không nghe từ người khác, nên từ “đã được thuyết giảng” được nói hai lần.
Idaṃ vuttaṃ hoti – ‘‘vuttañhetaṃ bhagavatā’’ tañca kho bhagavatāva vuttaṃ, na aññena, vuttameva ca, na sutanti.
This is what is meant: "This was spoken by the Bhagavā," and indeed, it was spoken by the Bhagavā Himself, not by another, and it was spoken, not heard.
Điều này có nghĩa là: “Điều này đã được Đức Thế Tôn thuyết giảng”, và điều đó chỉ do Đức Thế Tôn thuyết giảng, không phải do người khác, và đó là điều đã được thuyết giảng, không phải điều đã được nghe.
Adhikavacanañhi aññamatthaṃ bodhetīti na punaruttidoso.
For an additional word conveys a different meaning, so there is no fault of repetition.
Vì lời nói thêm sẽ làm sáng tỏ một ý nghĩa khác, nên không có lỗi trùng lặp.
Esa nayo ito paresupi.
This method applies to subsequent instances as well.
Nguyên tắc này cũng áp dụng cho các trường hợp sau.
106
Tathā pubbaracanābhāvadassanatthaṃ dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Thus, the word "spoken" is said twice to show the absence of prior composition.
Cũng vậy, từ “đã được thuyết giảng” được nói hai lần để chỉ rõ sự không có sự chuẩn bị trước.
Bhagavā hi sammāsambuddhatāya ṭhānuppattikappaṭibhānena sampattaparisāya ajjhāsayānurūpaṃ dhammaṃ deseti, na tassa kāraṇā dānādīnaṃ viya pubbaracanākiccaṃ atthi.
For the Bhagavā, by virtue of His being a Sammāsambuddha, teaches the Dhamma in accordance with the disposition of the assembled audience, with spontaneous insight, and has no need for prior composition, as in the case of giving or similar activities.
Đức Thế Tôn, vì là bậc Chánh Đẳng Giác, thuyết giảng giáo pháp phù hợp với khuynh hướng của hội chúng hiện tại bằng trí tuệ ứng biến ngay tại chỗ; Ngài không có việc chuẩn bị trước như việc bố thí, v.v.
Tenetaṃ dasseti – ‘‘vuttañhetaṃ bhagavatā, tañca kho na pubbaracanāvasena takkapariyāhataṃ vīmaṃsānucaritaṃ, apica kho veneyyajjhāsayānurūpaṃ ṭhānaso vuttamevā’’ti.
Thereby, it shows this: "This was spoken by the Bhagavā, and it was not uttered by mere reasoning or pondered over through investigation by way of prior composition, but rather it was spoken spontaneously, in accordance with the disposition of those to be trained."
Do đó, điều này chỉ rõ: “Điều này đã được Đức Thế Tôn thuyết giảng, và điều đó không phải là kết quả của sự suy luận hay nghiên cứu dựa trên sự chuẩn bị trước, mà là điều đã được thuyết giảng ngay tại chỗ, phù hợp với khuynh hướng của những người có khả năng được giáo hóa.”
107
Appaṭivattiyavacanabhāvadassanatthaṃ vā dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Or, the word "spoken" is said twice to show the unchangeable nature of the statement.
Hoặc từ “đã được thuyết giảng” được nói hai lần để chỉ rõ tính không thể bác bỏ của lời nói.
Yañhi bhagavatā vuttaṃ, vuttameva taṃ, na kenaci paṭikkhipituṃ sakkā akkharasampattiyā atthasampattiyā ca.
For what was spoken by the Bhagavā, that indeed was spoken, and it cannot be refuted by anyone, either in terms of its wording or its meaning.
Thật vậy, điều mà Đức Thế Tôn đã thuyết giảng, thì đó là điều đã được thuyết giảng, không ai có thể bác bỏ được, cả về mặt từ ngữ lẫn ý nghĩa.
Vuttaṃ hetaṃ –
For it has been said:
Điều này đã được thuyết giảng:
108
‘‘Etaṃ bhagavatā bārāṇasiyaṃ isipatane migadāye anuttaraṃ dhammacakkaṃ pavattitaṃ appaṭivattiyaṃ kenaci samaṇena vā brāhmaṇena vā’’tiādi (saṃ. ni. 5.1081; mahāva. 17).
"This unsurpassed Wheel of Dhamma was set in motion by the Bhagavā in Isipatana at Migadāya in Bārāṇasī, unassailable by any recluse or brāhmaṇa," and so forth.
“Tại Isipatana, trong vườn Lộc Uyển ở Bārāṇasī, Đức Thế Tôn đã chuyển bánh xe Pháp vô thượng này, không thể bị bất kỳ sa-môn hay bà-la-môn nào làm cho ngừng lại,” v.v.
109
Aparampi vuttaṃ –
It was also said:
Một điều khác cũng đã được thuyết giảng:
110
‘‘Idha, bhikkhave, āgaccheyya samaṇo vā brāhmaṇo vā ‘na yidaṃ dukkhaṃ ariyasaccaṃ, yaṃ samaṇena gotamena paññattaṃ, ahamidaṃ dukkhaṃ ariyasaccaṃ ṭhapetvā aññaṃ dukkhaṃ ariyasaccaṃ paññāpessāmī’ti, netaṃ ṭhānaṃ vijjatī’’tiādi–
"Here, bhikkhus, should any recluse or brāhmaṇa come and say: 'This is not the Noble Truth of Suffering which has been declared by the recluse Gotama, I shall declare another Noble Truth of Suffering apart from this' – such a possibility does not exist," and so forth.
“Này các Tỳ-kheo, nếu có sa-môn hay bà-la-môn nào đến và nói: ‘Đây không phải là Khổ Thánh Đế mà Sa-môn Gotama đã tuyên bố, ta sẽ tuyên bố một Khổ Thánh Đế khác ngoài Khổ Thánh Đế này’, thì điều đó là không thể có,” v.v.
111
Tasmā appaṭivattiyavacanabhāvadassanatthampi dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Therefore, the word "spoken" is said twice to show the unchangeable nature of the statement.
Vì vậy, từ “đã được thuyết giảng” cũng được nói hai lần để chỉ rõ tính không thể bác bỏ của lời nói.
112
Atha vā sotūnaṃ atthanipphādakabhāvadassanatthaṃ dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Or else, the word "spoken" is said twice to show its beneficial nature for the hearers.
Hoặc từ “đã được thuyết giảng” được nói hai lần để chỉ rõ khả năng mang lại lợi ích cho người nghe.
Yañhi paresaṃ āsayādiṃ ajānantena asabbaññunā adese akāle vā vuttaṃ, taṃ saccampi samānaṃ sotūnaṃ atthanipphādane asamatthatāya avuttaṃ nāma siyā, pageva asaccaṃ.
For what is spoken by one who does not know the disposition of others, who is not omniscient, or in an unsuitable place or time, even if true, might be considered as not spoken, due to its inability to bring about benefit for the hearers; how much more so if it is untrue.
Thật vậy, điều mà một người không biết ý định, v.v., của người khác, không phải là bậc Toàn Tri, đã nói ở một nơi không phù hợp hoặc vào một thời điểm không thích hợp, thì điều đó, dù có thật, cũng có thể được coi là chưa được nói vì không có khả năng mang lại lợi ích cho người nghe, huống chi là điều không thật.
Bhagavatā pana sammāsambuddhabhāvato sammadeva paresaṃ āsayādiṃ desakālaṃ atthasiddhiñca jānantena vuttaṃ ekantena sotūnaṃ yathādhippetatthanipphādanato vuttameva, natthi tassa avuttatāpariyāyo.
But by the Blessed One, who, owing to his being a Sammāsambuddha, perfectly knows the dispositions of others, along with the place and time, and the achievement of benefit, it was spoken. It was indeed spoken, because it brought about the intended benefit for the listeners in an absolute sense. There is no possibility of it being unspoken for him.
Nhưng điều mà Đức Thế Tôn, vì là bậc Chánh Đẳng Giác, đã nói khi Ngài hoàn toàn biết ý định, v.v., của người khác, thời gian và địa điểm thích hợp, và sự thành tựu lợi ích, thì điều đó chắc chắn là đã được nói, vì nó hoàn toàn mang lại lợi ích mong muốn cho người nghe, không có trường hợp nào là chưa được nói.
Tasmā sotūnaṃ atthanipphādakabhāvadassanatthampi dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Therefore, to show that it brings about benefit for the listeners, it was said "vuttaṃ" twice.
Vì vậy, từ “đã được thuyết giảng” cũng được nói hai lần để chỉ rõ khả năng mang lại lợi ích cho người nghe.
Apica yathā na taṃ sutaṃ nāma, yaṃ na viññātatthaṃ yañca na tathattāya paṭipannaṃ, evaṃ na taṃ vuttaṃ nāma, yaṃ na sammā paṭiggahitaṃ.
Moreover, just as that which is not understood in its meaning and not practiced for that purpose is not called 'heard,' so too that which is not well received is not called 'spoken.'
Hơn nữa, cũng như điều chưa được hiểu ý nghĩa và chưa được thực hành đúng như vậy thì không được gọi là đã được nghe, thì điều chưa được tiếp nhận đúng đắn cũng không được gọi là đã được thuyết giảng.
Bhagavato pana vacanaṃ catassopi parisā sammadeva paṭiggahetvā tathattāya paṭipajjanti.
But the four assemblies, having thoroughly received the words of the Blessed One, practice for that purpose.
Nhưng lời nói của Đức Thế Tôn thì cả bốn chúng hội đều tiếp nhận đúng đắn và thực hành đúng như vậy.
Tasmā sammadeva paṭiggahitabhāvadassanatthampi dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Therefore, to show that it was thoroughly received, it was said "vuttaṃ" twice.
Vì vậy, từ “đã được thuyết giảng” cũng được nói hai lần để chỉ rõ rằng lời nói đó đã được tiếp nhận đúng đắn.
113
Atha vā ariyehi aviruddhavacanabhāvadassanatthaṃ dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Or, to show that the utterance is not contradictory to the Noble Ones, it was said "vuttaṃ" twice.
Hoặc từ “đã được thuyết giảng” được nói hai lần để chỉ rõ lời nói không mâu thuẫn với các bậc Thánh.
Yathā hi bhagavā kusalākusalasāvajjānavajjabhede dhamme pavattinivattiyo sammutiparamatthe ca avisaṃvādento vadati, evaṃ dhammasenāpatippabhutayo ariyāpi bhagavati dharamāne parinibbute ca tasseva desanaṃ anugantvā vadanti, na tattha nānāvādatā.
For just as the Blessed One speaks without contradiction regarding wholesome and unwholesome, blameable and blameless qualities, and conventional and ultimate truths, so too the Noble Ones, such as the Dhamma-senāpati, follow his teaching and speak likewise, whether the Blessed One is alive or has attained final Nibbāna; there is no diversity of views there.
Thật vậy, Đức Thế Tôn thuyết giảng các pháp thiện và bất thiện, có lỗi và không lỗi, sự khởi lên và chấm dứt, các pháp tục đế và chân đế mà không sai lệch; cũng vậy, các bậc Thánh như Đại Tướng Pháp, v.v., cũng thuyết giảng theo giáo pháp của Đức Thế Tôn, cả khi Ngài còn tại thế và sau khi Ngài nhập Niết-bàn, không có sự khác biệt trong lời nói.
Tasmā vuttamarahatā tato parabhāge arahatā ariyasaṅghenāpīti evaṃ ariyehi aviruddhavacanabhāvadassanatthampi evaṃ vuttaṃ.
Therefore, by "vuttamarahatā" it is said that after him, it was also spoken by the Arahats, the Noble Saṅgha; thus, to show that the utterance is not contradictory to the Noble Ones, it was said thus.
Vì vậy, điều này đã được bậc A-la-hán thuyết giảng, sau đó cũng được các bậc A-la-hán, tức là Thánh Tăng, thuyết giảng. Từ “đã được thuyết giảng” cũng được nói như vậy để chỉ rõ lời nói không mâu thuẫn với các bậc Thánh.
114
Atha vā purimehi sammāsambuddhehi vuttanayabhāvadassanatthaṃ dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Or, to show that it is in the manner spoken by the former Sammāsambuddhas, it was said "vuttaṃ" twice.
Hoặc từ “đã được thuyết giảng” được nói hai lần để chỉ rõ rằng đây là cách thuyết giảng của các bậc Chánh Đẳng Giác trước đây.
Satipi hi jātigottāyuppamāṇādivisese dasabalādiguṇehi viya dhammadesanāya buddhānaṃ viseso natthi, aññamaññaṃ attanā ca te pubbenāparaṃ aviruddhameva vadanti.
Indeed, even if there are differences in birth, lineage, lifespan, measure, etc., there is no difference in the Dhamma-teaching of the Buddhas, just as there is no difference in their ten powers (dasabala) and other qualities; they speak amongst themselves and by themselves without contradiction, both in the past and in the future.
Thật vậy, dù có sự khác biệt về chủng tộc, dòng dõi, tuổi thọ, v.v., nhưng các vị Phật không có sự khác biệt trong việc thuyết giảng giáo pháp, cũng như trong các mười lực, v.v. Các Ngài thuyết giảng những điều không mâu thuẫn với nhau, cả trong quá khứ và hiện tại.
Tasmā vuttañhetaṃ yathā buddhehi attanā ca pubbe, idānipi amhākaṃ bhagavatā tatheva vuttaṃ arahatāti evaṃ purimabuddhehi attanā ca suttantaresu vuttanayabhāvadassanatthampi dvikkhattuṃ ‘‘vutta’’nti vuttaṃ.
Therefore, by "vuttañhetaṃ" it is said, "Just as it was spoken by the Buddhas themselves in the past, so too it is now spoken by our Blessed One, the Arahat," thus, to show that it is in the manner spoken by the former Buddhas and by himself in other suttas, it was said "vuttaṃ" twice.
Vì vậy, điều này đã được thuyết giảng – điều mà các vị Phật trước đây và chính các Ngài đã thuyết giảng trong các kinh điển khác, thì bây giờ Đức Thế Tôn của chúng ta cũng thuyết giảng như vậy, và điều đó đã được bậc A-la-hán thuyết giảng. Từ “đã được thuyết giảng” cũng được nói hai lần để chỉ rõ cách thuyết giảng của các vị Phật trước đây và của chính các Ngài trong các kinh điển khác.
Tena buddhānaṃ desanāya sabbattha avirodho dīpito hoti.
Thereby, the non-contradiction of the Buddhas' teaching everywhere is demonstrated.
Do đó, điều này cho thấy sự không mâu thuẫn trong giáo pháp của các vị Phật ở khắp mọi nơi.
115
Atha vā ‘‘vutta’’nti yadetaṃ dutiyaṃ padaṃ, taṃ arahantavuttabhāvavacanaṃ daṭṭhabbaṃ.
Or, this second word "vuttaṃ" should be understood as an utterance of the state of being an Arahat.
Hoặc từ “đã được thuyết giảng” thứ hai phải được hiểu là lời nói về địa vị A-la-hán.
Idaṃ vuttaṃ hoti – vuttañhetaṃ bhagavatā arahatāpi vuttaṃ – ‘‘ekadhammaṃ, bhikkhave’’tiādikaṃ idāni vuccamānaṃ vacananti.
This means: "This has been spoken by the Blessed One, and also spoken by the Arahat—the statement beginning with 'Monks, one quality' (ekadhammaṃ, bhikkhave) is what is now being spoken."
Điều này có nghĩa là: Điều này đã được Đức Thế Tôn thuyết giảng, và cũng đã được bậc A-la-hán thuyết giảng – lời nói đang được nói bây giờ, bắt đầu bằng “Này các Tỳ-kheo, một pháp”, v.v.
Atha vā ‘‘vutta’’nti yadetaṃ dutiyaṃ padaṃ, taṃ na vacanatthaṃ, atha kho vapanatthaṃ daṭṭhabbaṃ.
Or, this second word "vuttaṃ" should not be understood in the sense of 'speaking,' but rather in the sense of 'sowing.'
Hoặc từ “đã được thuyết giảng” thứ hai không phải là ý nghĩa của lời nói, mà phải được hiểu là ý nghĩa của việc gieo trồng.
Tenetaṃ dasseti – ‘‘vuttañhetaṃ bhagavatā, tañca kho na vuttamattaṃ, na kathitamattaṃ; atha kho veneyyānaṃ kusalamūlaṃ vapita’’nti attho.
Thereby it shows this: "This was spoken by the Blessed One; however, it was not merely spoken, not merely said, but rather, the root of wholesome qualities was sown in the mind-streams of those who are amenable to instruction"—this is the meaning.
Điều này chỉ rõ: “Điều này đã được Đức Thế Tôn thuyết giảng, và điều đó không chỉ là lời nói suông, không chỉ là sự kể lại; mà còn là sự gieo trồng căn lành cho những người có khả năng được giáo hóa,” đó là ý nghĩa.
Atha vā yadetaṃ vuttanti dutiyaṃ padaṃ, taṃ vattanatthaṃ.
Or, this second word "vuttaṃ" is in the sense of 'practicing.'
Hoặc từ “đã được thuyết giảng” thứ hai có nghĩa là sự thực hành.
Ayaṃ hissa attho – vuttañhetaṃ bhagavatā arahatā, tañca kho na vuttamattaṃ, apica tadatthajātaṃ vuttaṃ caritanti.
Its meaning is this: "This was spoken by the Blessed One, the Arahat; however, it was not merely spoken, but rather, that meaning was practiced."
Ý nghĩa của nó là: Điều này đã được Đức Thế Tôn, bậc A-la-hán, thuyết giảng, và điều đó không chỉ là lời nói suông, mà là sự thực hành những gì được nói.
Tena ‘‘yathā vādī bhagavā tathā kārī’’ti dasseti.
Thereby it shows: "Just as the Blessed One speaks, so he acts."
Do đó, điều này chỉ rõ rằng “Đức Thế Tôn nói như thế nào thì làm như thế ấy”.
Atha vā vuttaṃ bhagavatā, vuttavacanaṃ arahatā vattuṃ yuttenāti attho.
Or, "It was spoken by the Blessed One, by the Arahat, by one fit to speak"—this is the meaning.
Hoặc ý nghĩa là: Đức Thế Tôn đã thuyết giảng, và lời nói đó là điều xứng đáng được bậc A-la-hán thuyết giảng.
116
Atha vā ‘‘vutta’’nti saṅkhepakathāuddisanaṃ sandhāyāha, puna ‘‘vutta’’nti vitthārakathānidassanaṃ.
Or, by "vuttaṃ" is meant the designation of the summary discourse, and by the repeated "vuttaṃ" is meant the illustration of the detailed discourse.
Hoặc từ “đã được thuyết giảng” thứ nhất đề cập đến việc trình bày tóm tắt, và từ “đã được thuyết giảng” thứ hai đề cập đến việc trình bày chi tiết.
Bhagavā hi saṅkhepato vitthārato ca dhammaṃ deseti.
For the Blessed One teaches the Dhamma both concisely and extensively.
Thật vậy, Đức Thế Tôn thuyết giảng giáo pháp cả tóm tắt lẫn chi tiết.
Atha vā bhagavato duruttavacanābhāvadassanatthaṃ ‘‘vuttañhetaṃ bhagavatā’’ti vatvā puna ‘‘vutta’’nti vuttaṃ.
Or, to show that the Blessed One's words are never ill-spoken, having said "This has been spoken by the Blessed One," it is said "vuttaṃ" again.
Hoặc từ “đã được thuyết giảng” được nói hai lần, sau khi nói “Điều này đã được Đức Thế Tôn thuyết giảng”, để chỉ rõ rằng Đức Thế Tôn không có lời nói sai lầm.
Sabbadā ñāṇānugatavacīkammatāya hi bhagavato savāsanapahīnasabbadosassa akkhalitabyappathassa kadācipi duruttaṃ nāma natthi.
Indeed, the Blessed One, whose verbal actions are always guided by wisdom, whose every defilement, including its latent tendencies, has been abandoned, and whose expression is never flawed, never utters anything ill-spoken.
Thật vậy, Đức Thế Tôn, vì đã đoạn trừ tất cả phiền não cùng với khuynh hướng tiềm ẩn, và có lời nói không sai sót, nên không bao giờ có lời nói sai lầm, vì hành động ngôn ngữ của Ngài luôn được trí tuệ dẫn dắt.
Yathā keci loke satisammosena vā davā vā ravā vā kiñci vatvā atha paṭiladdhasaññā pubbe vuttaṃ avuttaṃ vā karonti paṭisaṅkharonti vā, na evaṃ bhagavā.
Unlike some in the world who, due to forgetfulness, or unintentionally, or in a rush, say something and then, regaining their awareness, either deem what was said to be unsaid or revise it, the Blessed One is not like that.
Như một số người trên thế gian, vì quên lãng hay vì lỗi lầm trong lời nói, sau khi đã nói điều gì đó, rồi lại nhận ra ý nghĩa, họ sửa lại hoặc không sửa lại những gì đã nói hoặc chưa nói trước đó. Đức Thế Tôn không như vậy.
Bhagavā pana niccakālaṃ samāhito.
The Blessed One is always composed.
Đức Thế Tôn thì luôn luôn định tĩnh.
Asammosadhammo asammohadhammo ca sabbaññutaññāṇasamupabyūḷhāya paṭibhānapaṭisambhidāya upanītamatthaṃ aparimitakālaṃ sambhatapuññasambhārasamudāgatehi anaññasādhāraṇehi visadavisuddhehi karaṇavisesehi sotāyatanarasāyanabhūtaṃ suṇantānaṃ amatavassaṃ vassanto viya sotabbasāraṃ savanānuttariyaṃ catusaccaṃ pakāsento karavīkarutamañjunā sarena sabhāvaniruttiyā veneyyajjhāsayānurūpaṃ vacanaṃ vadati, natthi tattha vālaggamattampi avakkhalitaṃ, kuto pana duruttāvakāso.
Being free from delusion and bewilderment, endowed with the omniscient knowledge and the penetrative analytical insights (paṭisambhidā), the Blessed One, through unique, pure, and stainless instruments derived from an immeasurable accumulation of merits over innumerable aeons, like raining nectar upon the listeners whose ear-faculty is refined, reveals the Four Noble Truths—the essence to be heard, the supreme hearing—speaking words appropriate to the dispositions of those to be trained, with a sweet voice like that of the karavīka bird. There is not even a hair's breadth of fault in it; how then could there be room for ill-spoken words?
Ngài là bậc có pháp không lầm lẫn, không mê mờ, với trí tuệ Toàn tri (Sabbaññutaññāṇa) được phát triển đầy đủ bởi Paṭibhāna-paṭisambhidā (vô ngại giải về biện tài), Ngài thuyết giảng những điều đã được đưa đến gần, những điều được tích lũy công đức vô lượng kiếp, những điều phi thường không ai sánh bằng, trong sáng và thanh tịnh; như mưa cam lộ cho những ai đang lắng nghe, là tinh túy đáng nghe, là điều tối thượng để lắng nghe, là Tứ Thánh Đế (Catusacca) được tuyên bố bằng giọng nói du dương như chim Karavīka, bằng Sabhāvanirutti (diễn đạt đúng bản chất) phù hợp với ý nguyện của những người có thể được giáo hóa. Trong đó không có một chút sai sót nào dù chỉ bằng đầu sợi lông, huống chi là có chỗ cho lời nói sai lạc.
Tasmā ‘‘yaṃ bhagavatā vuttaṃ, taṃ vuttameva, na avuttaṃ duruttaṃ vā kadāci hotī’’ti dassanatthaṃ – ‘‘vuttañhetaṃ bhagavatā’’ti vatvā puna – ‘‘vuttamarahatā’’ti vuttanti na ettha punaruttidosoti.
Therefore, to show that "what was spoken by the Blessed One is indeed spoken, and never becomes unspoken or ill-spoken," it is said "This has been spoken by the Blessed One," and then again, "spoken by the Arahat." Thus, there is no fault of repetition here.
Vì vậy, để chỉ ra rằng: "Những gì Đức Thế Tôn đã nói là đã nói rồi, không bao giờ có chuyện chưa nói hoặc nói sai", nên sau khi nói "Điều này đã được Đức Thế Tôn nói", rồi lại nói "Điều này đã được bậc A-la-hán nói" thì không có lỗi trùng lặp ở đây.
Evamettha punaruttasaddassa sātthakatā veditabbā.
In this way, the meaningfulness of the repeated word "vuttaṃ" should be understood here.
Như vậy, ý nghĩa hữu ích của từ "punarutta" (trùng lặp) ở đây cần được hiểu rõ.
117
Iti me sutanti ettha itīti ayaṃ itisaddo hetuparisamāpanādipadatthavipariyāyapakāranidassanāvadhāraṇādianekatthappabhedo.
In "Iti me sutaṃ" (Thus have I heard), this word "iti" has many meanings, such as cause, completion, beginning, reversal of word-meaning, manner, illustration, and ascertainment.
Trong cụm từ Iti me sutaṃ (Như vầy tôi nghe), từ iti này có nhiều nghĩa khác nhau như nguyên nhân, kết thúc, ý nghĩa của từ, cách thức, sự minh họa, sự xác định.
Tathā hesa – ‘‘ruppatīti kho, bhikkhave, tasmā rūpanti vuccatī’’tiādīsu (saṃ. ni. 3.79) hetuatthe dissati.
For example, it is seen in the sense of cause in passages like, "It is broken up, monks, therefore it is called rūpa" and so on.
Thật vậy, từ này được thấy trong nghĩa nguyên nhân ở các đoạn như: "Này các Tỳ-khưu, vì nó bị hoại diệt (ruppati), nên nó được gọi là sắc (rūpa)" và các đoạn tương tự.
‘‘Tasmātiha me, bhikkhave, dhammadāyādā bhavatha, mā āmisadāyādā.
In passages like, "Therefore, monks, be heirs of Dhamma, not heirs of material things.
Trong các đoạn như: "Này các Tỳ-khưu, do đó, hãy là những người thừa kế Pháp của Ta, đừng là những người thừa kế vật chất.
Atthi me tumhesu anukampā – kinti me sāvakā dhammadāyādā bhaveyyuṃ, no āmisadāyādā’’tiādīsu (ma. ni. 1.30) parisamāpane.
I have compassion for you: 'How might my disciples be heirs of Dhamma, not heirs of material things?'" and so on, it indicates completion.
Ta có lòng thương xót đối với các con, mong rằng các đệ tử của Ta sẽ là những người thừa kế Pháp, chứ không phải là những người thừa kế vật chất", từ này được thấy trong nghĩa kết thúc.
‘‘Iti vā iti evarūpā visūkadassanā paṭivirato’’tiādīsu (dī. ni. 1.10) ādiatthe.
In passages like, "He has abstained from such frivolous talk as 'iti vā iti evarūpā visūkadassanā paṭivirato'" and so on, it indicates beginning.
Trong các đoạn như: "Đã từ bỏ những trò giải trí như vậy, hoặc như vậy", từ này được thấy trong nghĩa bắt đầu.
‘‘Māgaṇḍiyoti vā tassa brāhmaṇassa saṅkhā samaññā paññatti vohāro nāmaṃ nāmakammaṃ nāmadheyyaṃ nirutti byañjanaṃ abhilāpo’’tiādīsu (mahāni. 75) padatthavipariyāye.
In passages like, "Māgaṇḍiya is the name, designation, appellation, expression, nomenclature, naming, appellation, etymology, explanation, utterance of that brahmin" and so on, it indicates reversal of word-meaning.
Trong các đoạn như: "Māgaṇḍiya là tên gọi, danh hiệu, sự chỉ định, cách nói, tên, việc đặt tên, danh xưng, ngữ nguyên, biểu tượng, cách diễn đạt của vị Bà-la-môn đó", từ này được thấy trong nghĩa thay đổi ý nghĩa của từ.
‘‘Iti kho, bhikkhave, sappaṭibhayo bālo, appaṭibhayo paṇḍito; saupaddavo bālo, anupaddavo paṇḍito; saupasaggo bālo, anupasaggo paṇḍito’’tiādīsu (a. ni. 3.1) pakāre.
In passages like, "Thus, monks, the fool is fearful, the wise is fearless; the fool is troubled, the wise is untroubled; the fool is assailed, the wise is unassailed" and so on, it indicates manner.
Trong các đoạn như: "Này các Tỳ-khưu, như vậy, kẻ ngu si thì đáng sợ, người trí thì không đáng sợ; kẻ ngu si thì đầy chướng ngại, người trí thì không chướng ngại; kẻ ngu si thì đầy tai họa, người trí thì không tai họa", từ này được thấy trong nghĩa cách thức.
‘‘Sabbamatthīti kho, kaccāna, ayameko anto, sabbaṃ natthīti kho, kaccāna, ayaṃ dutiyo anto’’tiādīsu (saṃ. ni. 2.15) nidassane.
In passages like, "'All exists,' Kaccāna, this is one extreme; 'All does not exist,' Kaccāna, this is the second extreme" and so on, it indicates illustration.
Trong các đoạn như: "Này Kaccāna, nói rằng 'Tất cả đều có' là một cực đoan; nói rằng 'Tất cả đều không có' là cực đoan thứ hai", từ này được thấy trong nghĩa minh họa.
‘‘Atthi idappaccayā jarāmaraṇanti iti puṭṭhena satā, ānanda, atthītissa vacanīyaṃ.
In passages like, "When asked, 'Is there aging and death dependent on this?' one should say, Ānanda, 'There is.'
Trong các đoạn như: "Này Ānanda, khi được hỏi 'Có phải già chết do duyên này không?', thì phải nói 'Có'.
Kiṃpaccayā jarāmaraṇanti iti ce vadeyya, jātipaccayā jarāmaraṇanti iccassa vacanīya’’ntiādīsu (dī. ni. 2.96) avadhāraṇe, sanniṭṭhāneti attho.
And if one should say, 'Dependent on what is there aging and death?' one should say, 'Aging and death are dependent on birth'" and so on, it indicates ascertainment, meaning determination.
Nếu hỏi 'Già chết do duyên gì?', thì phải nói 'Già chết do duyên sinh'", từ này được thấy trong nghĩa xác định, tức là kết luận.
Svāyamidha pakāranidassanāvadhāraṇesu daṭṭhabbo.
Here, it should be understood in the senses of manner, illustration, and ascertainment.
Từ này ở đây cần được hiểu trong nghĩa cách thức, minh họa và xác định.
118
Tattha pakāratthena itisaddena etamatthaṃ dīpeti – nānānayanipuṇamanekajjhāsayasamuṭṭhānaṃ atthabyañjanasampannaṃ vividhapāṭihāriyaṃ dhammatthadesanāpaṭivedhagambhīraṃ sabbasattānaṃ sakasakabhāsānurūpato sotapathamāgacchantaṃ tassa bhagavato vacanaṃ sabbappakārena ko samattho viññātuṃ, sabbathāmena pana sotukāmataṃ janetvāpi iti me sutaṃ, mayāpi ekena pakārena sutanti.
Among those, by the word ‘iti’, which has the meaning of 'manner', it reveals this meaning: "Who, in all ways, is capable of understanding that discourse of the Blessed One which is subtle with various methods, originating from many intentions, endowed with meaning and expression, possessing various marvels, profound in the Dhamma's meaning, its teaching, and its penetration, and which reaches the range of hearing of all beings according to their respective languages, even if one generates the desire to hear with all one's might?" Thus it reveals: "It was heard by me in one way; it was heard by me also in one way."
Ở đây, với từ "iti" mang nghĩa cách thức, Ngài chỉ rõ ý này: Lời dạy của Đức Thế Tôn, tinh tế với nhiều phương pháp, phát sinh từ nhiều ý nguyện, đầy đủ ý nghĩa và biểu đạt, có nhiều phép lạ (pāṭihāriya), sâu xa về Pháp, ý nghĩa, lời dạy và sự thể nhập, đến tai tất cả chúng sinh theo ngôn ngữ riêng của họ, thì ai có thể hiểu được trọn vẹn mọi phương diện? Nhưng ngay cả khi đã phát sinh ý muốn lắng nghe bằng tất cả sức lực, thì "Như vầy tôi nghe", tức là "Tôi cũng đã nghe theo một cách thức".
119
Ettha ca ekattanānattaabyāpāraevaṃdhammatāsaṅkhātā nandiyāvattatipukkhalasīhavikkīḷitadisālocanaaṅkusasaṅkhātā ca visayādibhedena nānāvidhā nayā nānānayā.
Here, the various methods are manifold methods, such as the method of oneness, manifoldness, non-operation, suchness (evaṃdhammatā), and the method of compilation (saṅkhātā) like the nandiyāvajja, tipukkala, sīhavikkīḷita, disālocana, and aṅkusa in terms of their objects, and so forth.
Ở đây, các phương pháp đa dạng (nānānaya) là những phương pháp khác nhau theo các phân loại như nhất tính, dị tính, vô hành, như vậy tính, hữu vi tính, và các phương pháp như Nandiyāvatta, Tipukkala, Sīhavikkīḷita, Disālocana, Aṅkusa, v.v., theo các phân loại như đối tượng, v.v.
Nayā vā pāḷigatiyo, tā ca paññattianupaññattiādivasena saṃkilesabhāgiyādilokiyāditadubhayavomissatādivasena, kusalādivasena, khandhādivasena, saṅgahādivasena, samayavimuttādivasena, ṭhapanādivasena, kusalamūlādivasena, tikapaṭṭhānādivasena ca nānappakārāti nānānayā.
Or nayā (methods) are the ways of the Pāḷi, and these are of various kinds according to such categories as paññatti and anupaññatti, according to saṃkilesabhāgiya (leading to defilement), lokiya (mundane), or a mixture of both; according to kusala (wholesome) and so forth; according to khandhā (aggregates) and so forth; according to saṅgahā (compendiums) and so forth; according to samayavimuttā (freed from all conditions) and so forth; according to ṭhapanā (laying down) and so forth; according to kusalamūlā (roots of wholesome states) and so forth; and according to tikapaṭṭhānā (triple-arrangement) and so forth, thus being nānānayā (various methods).
Hoặc, các phương pháp (naya) là các cách thức trong Pāḷi, và chúng có nhiều loại khác nhau theo sự phân biệt như paññatti (chế định) và anupaññatti (tiểu chế định), v.v.; theo sự phân biệt như saṃkilesabhāgiya (thuộc về phiền não), lokiya (thế gian), tadubhayavomissatā (hỗn hợp cả hai), v.v.; theo sự phân biệt như kusala (thiện), v.v.; theo sự phân biệt như khandha (uẩn), v.v.; theo sự phân biệt như saṅgaha (tập yếu), v.v.; theo sự phân biệt như samayavimutta (giải thoát theo thời), v.v.; theo sự phân biệt như ṭhapanā (thiết lập), v.v.; theo sự phân biệt như kusalamūla (căn lành), v.v.; và theo sự phân biệt như Tikapaṭṭhāna (Tam đề duyên hệ), v.v., nên chúng được gọi là nānānaya (nhiều phương pháp).
Tehi nipuṇaṃ saṇhaṃ sukhumanti nānānayanipuṇaṃ.
It is nānānayanipuṇaṃ (subtle with various methods) because it is refined, delicate, and subtle through these various methods.
Tinh tế (nipuṇa), dịu dàng (saṇha), vi tế (sukhuma) bởi những điều đó, nên gọi là nānānayanipuṇaṃ (tinh tế với nhiều phương pháp).
120
Āsayova ajjhāsayo, so ca sassatādibhedena apparajakkhatādibhedena ca anekavidho.
An āsayā (disposition) is an ajjhāsaya (intention), and this is of many kinds, divided by eternalism and so forth, and by having little dust (of defilement) and so forth.
Āsaya chính là ajjhāsaya (ý nguyện), và ý nguyện này có nhiều loại khác nhau theo sự phân biệt như thường kiến, v.v., và theo sự phân biệt như ít bụi trần, v.v.
Attajjhāsayādiko eva vā aneko ajjhāsayo anekajjhāsayo.
Or, many intentions are anekajjhāsaya (many intentions), such as one's own intention, and so forth.
Hoặc, chỉ riêng ý nguyện của bản thân và các ý nguyện khác là nhiều ý nguyện (aneka ajjhāsaya).
So samuṭṭhānaṃ uppattihetu etassāti anekajjhāsayasamuṭṭhānaṃ.
That is the origin, the cause of arising for this, thus it is anekajjhāsayasamuṭṭhānaṃ (having many intentions as its origin).
Vì ý nguyện đó là nguồn gốc (samuṭṭhānaṃ), là nguyên nhân phát sinh (uppattihetu) của lời dạy này, nên gọi là anekajjhāsayasamuṭṭhānaṃ (phát sinh từ nhiều ý nguyện).
121
Kusalādiatthasampattiyā tabbibhāvanabyañjanasampattiyā saṅkāsanapakāsanavivaraṇavibhajanauttānīkaraṇapaññattivasena chahi atthapadehi akkharapadabyañjanākāraniruttiniddesavasena chahi byañjanapadehi ca samannāgatattā atthabyañjanasampannaṃ.
It is atthabyañjanasampannaṃ (endowed with meaning and expression) because it is endowed with the perfection of meaning, such as wholesome states, and the perfection of expression that illuminates them, by means of six terms of meaning for clarifying, explaining, opening up, analyzing, making clear, and defining; and by means of six terms of expression for letters, words, expression, manner, etymology, and exposition.
Vì lời dạy được đầy đủ với sự thành tựu của ý nghĩa thiện lành, v.v., và sự thành tựu của biểu đạt làm rõ ý nghĩa đó, thông qua sáu khía cạnh ý nghĩa là saṅkāsana (làm sáng tỏ), pakāsana (tuyên bố), vivaraṇa (giải thích), vibhajana (phân tích), uttānīkaraṇa (làm rõ) và paññatti (chế định); và thông qua sáu khía cạnh biểu đạt là akkhara (chữ), pada (từ), byañjana (biểu tượng), ākāra (hình thức), nirutti (ngữ nguyên) và niddesa (chỉ định), nên gọi là atthabyañjanasampannaṃ (đầy đủ ý nghĩa và biểu đạt).
122
Iddhiādesanānusāsanībhedena tesu ca ekekassa visayādibhedena vividhaṃ bahuvidhaṃ vā pāṭihāriyaṃ etassāti vividhapāṭihāriyaṃ.
It is vividhapāṭihāriyaṃ (having various marvels) because it has various or many kinds of marvels, divided into iddhi (supernormal power), ādesanā (mind-reading), and anusāsanī (instruction), and each of these is divided by its object, and so forth.
Phép lạ (pāṭihāriya) này có nhiều loại (vividhaṃ) hoặc đa dạng (bahuvidhaṃ) theo sự phân biệt như thần thông (iddhi), thuyết giáo (ādesanā), giáo giới (anusāsanī), và trong mỗi loại đó lại có sự phân biệt theo đối tượng, v.v., nên gọi là vividhapāṭihāriyaṃ (có nhiều phép lạ).
Tattha paṭipakkhaharaṇato rāgādikilesāpanayanato paṭihāriyanti atthe sati bhagavato paṭipakkhā rāgādayo na santi ye haritabbā, puthujjanānampi vigatūpakkilese aṭṭhaguṇasamannāgate citte hatapaṭipakkhe iddhividhaṃ pavattati.
When the meaning is "it is paṭihāriyaṃ (a marvel) because it removes opponents, it removes defilements such as passion," then there are no opponents such as passion in the Blessed One to be removed; and for ordinary people, the performance of supernormal power occurs in a mind free from defilements, endowed with eight qualities, with opponents vanquished.
Ở đây, nếu nói pāṭihāriya là sự loại bỏ đối phương hoặc sự loại bỏ các phiền não như tham ái, thì Đức Thế Tôn không có đối phương là tham ái, v.v., để phải loại bỏ. Ngay cả đối với phàm nhân, thần thông cũng chỉ xảy ra trong tâm đã loại bỏ các cấu uế, đầy đủ tám phẩm chất, đã loại bỏ đối phương.
Tasmā tattha pavattavohārena ca na sakkā idha pāṭihāriyanti vattuṃ.
Therefore, it is not possible to say "marvel" here by the conventional usage that applies there.
Do đó, không thể nói pāṭihāriya ở đây theo cách nói thông thường đó.
Yasmā pana mahākāruṇikassa bhagavato veneyyagatā ca kilesā paṭipakkhā, tasmā tesaṃ haraṇato pāṭihāriyaṃ.
However, since the defilements present in those capable of being trained by the Greatly Compassionate Blessed One are opponents, it is a pāṭihāriyaṃ because it removes them.
Tuy nhiên, vì các phiền não của những người có thể được giáo hóa là đối phương của Đức Thế Tôn, bậc Đại Bi, nên sự loại bỏ chúng là pāṭihāriya.
Atha vā bhagavato sāsanassa ca paṭipakkhā titthiyā, tesaṃ haraṇato pāṭihāriyaṃ.
Or, the sectarians (titthiyā) are opponents to the Blessed One and his teaching; therefore, it is a pāṭihāriyaṃ because it removes them.
Hoặc, những người ngoại đạo (titthiya) là đối phương của Đức Thế Tôn và Giáo Pháp của Ngài, nên sự loại bỏ họ là pāṭihāriya.
Te hi diṭṭhiharaṇavasena diṭṭhippakāsane asamatthabhāvena ca iddhiādesanānusāsanīhi haritā apanītā honti.
Indeed, they are removed by iddhi, ādesanā, and anusāsanī, by means of removing their wrong views, and by their inability to propagate their own views.
Thật vậy, họ bị loại bỏ và xua tan bởi thần thông (iddhi), thuyết giáo (ādesanā) và giáo giới (anusāsanī), hoặc bởi sự loại bỏ tà kiến, hoặc bởi sự bất lực trong việc tuyên bố tà kiến.
Paṭīti vā pacchāti attho.
Or, paṭi means 'after'.
Hoặc, "paṭi" có nghĩa là "sau".
Tasmā samāhite citte vigatūpakkilese katakiccena pacchā haritabbaṃ pavattetabbanti paṭihāriyaṃ.
Therefore, that which should be performed later by one who has accomplished what needs to be done, when the mind is concentrated and free from defilements, is paṭihāriyaṃ.
Do đó, khi tâm đã định tĩnh, đã loại bỏ các cấu uế, và đã hoàn thành nhiệm vụ, thì điều cần được thực hiện sau đó là pāṭihāriya.
Attano vā upakkilesesu catutthajjhānamaggehi haritesu pacchā haraṇaṃ paṭihāriyaṃ.
Or, after one's own defilements have been removed by the paths of the fourth jhāna, the removal that occurs afterwards is paṭihāriyaṃ.
Hoặc, sau khi các cấu uế của bản thân đã được loại bỏ bằng Tứ Thiền và Đạo, thì sự loại bỏ sau đó là pāṭihāriya.
Iddhiādesanānusāsaniyo ca vigatūpakkilesena katakiccena sattahitatthaṃ puna pavattetabbā, haritesu ca attano upakkilesesu parasantāne upakkilesaharaṇāni hontīti paṭihāriyāni bhavanti.
And iddhi, ādesanā, and anusāsanī should be performed again by one who is free from defilements and has accomplished what needs to be done, for the welfare of beings; and when one's own defilements are removed, they become the removal of defilements in the minds of others, thus they are paṭihāriyāni.
Và các thần thông (iddhi), thuyết giáo (ādesanā), giáo giới (anusāsanī) cần được thực hiện lại vì lợi ích của chúng sinh bởi người đã loại bỏ cấu uế và đã hoàn thành nhiệm vụ; và khi các cấu uế của bản thân đã được loại bỏ, thì việc loại bỏ cấu uế trong dòng tâm thức của người khác trở thành pāṭihāriya.
Paṭihāriyameva pāṭihāriyaṃ, paṭihāriye vā iddhiādesanānusāsanisamudāye bhavaṃ ekekaṃ pāṭihāriyanti vuccati.
Paṭihāriyaṃ itself is pāṭihāriyaṃ, or each single one existing in the collection of paṭihāriyaṃ (marvels) such as iddhi, ādesanā, and anusāsanī, is called pāṭihāriyaṃ.
Pāṭihāriya chính là pāṭihāriya, hoặc mỗi một trong tập hợp thần thông, thuyết giáo, giáo giới có trong pāṭihāriya được gọi là pāṭihāriya.
Paṭihāriyaṃ vā catutthajjhānaṃ maggo ca paṭipakkhaharaṇato, tattha jātaṃ, tasmiṃ vā nimittabhūte, tato vā āgatanti pāṭihāriyaṃ.
Or, the fourth jhāna and the Path are paṭihāriyaṃ due to the removal of opponents; that which is born therein, or exists as a sign therein, or comes from there, is pāṭihāriyaṃ.
Hoặc, Tứ Thiền và Đạo là pāṭihāriya vì chúng loại bỏ đối phương; điều phát sinh trong đó, hoặc trong đó là dấu hiệu, hoặc đến từ đó, thì là pāṭihāriya.
123
Yasmā pana tantiatthadesanātabbohārābhisamayasaṅkhātā hetuhetuphalatadubhayapaññattipaṭivedhasaṅkhātā vā dhammatthadesanāpaṭivedhā gambhīrā, anupacitasambhārehi sasādīhi viya mahāsamuddo dukkhogāḷhā alabbhaneyyappatiṭṭhā ca.
However, since the penetrations of the meaning of Dhamma and the teaching of Dhamma, which are called the sequence of Pāḷi, the sequence of meaning, the teaching, and the comprehension thereof—or which are called the penetrations of paññatti (conceptual designation) of cause, effect, and both—are profound, they are difficult to fathom like a great ocean for those with insufficient accumulations, like hares and so forth, and they are difficult to find a footing in.
Tuy nhiên, bởi vì sự thể nhập Pháp, ý nghĩa, lời dạy sâu xa, được gọi là sự thể nhập Tanti (kinh điển), ý nghĩa và lời dạy của Tanti, hoặc sự thể nhập paññatti (chế định) về nguyên nhân, kết quả và cả hai, thì sâu xa, khó tiếp cận như đại dương đối với những người không tích lũy đầy đủ tư lương như thỏ rừng, và không thể tìm thấy chỗ đứng.
Tasmā tehi catūhi gambhīrabhāvehi yuttanti dhammatthadesanāpaṭivedhagambhīraṃ.
Therefore, it is dhammatthadesanāpaṭivedhagambhīraṃ (profound in the Dhamma's meaning, its teaching, and its penetration) because it is endowed with these four profundities.
Do đó, lời dạy này phù hợp với bốn khía cạnh sâu xa đó, nên gọi là dhammatthadesanāpaṭivedhagambhīraṃ (sâu xa về Pháp, ý nghĩa, lời dạy và sự thể nhập).
124
Eko eva bhagavato dhammadesanāghoso ekasmiṃ khaṇe pavattamāno nānābhāsānaṃ sattānaṃ attano attano bhāsāvasena apubbaṃ acarimaṃ gahaṇūpago hutvā atthādhigamāya hoti.
The single voice of the Blessed One's Dhamma discourse, arising at one moment, becomes a means for the attainment of meaning for beings of diverse languages, by making itself comprehensible, not earlier nor later, in their own respective languages.
Chỉ một tiếng Pháp âm của Đức Thế Tôn, khi được phát ra trong một khoảnh khắc, sẽ được các chúng sinh với ngôn ngữ khác nhau tiếp nhận đồng thời, không trước không sau, theo ngôn ngữ riêng của mỗi người, và dẫn đến sự thấu hiểu ý nghĩa.
Acinteyyo hi buddhānaṃ buddhānubhāvoti sabbasattānaṃ sakasakabhāsānurūpato sotapathamāgacchatīti veditabbaṃ.
For the Buddha's power is inconceivable, thus it should be understood that it reaches the range of hearing of all beings according to their respective languages.
Thật vậy, năng lực của chư Phật là không thể nghĩ bàn, nên cần hiểu rằng tiếng Pháp âm đến tai tất cả chúng sinh theo ngôn ngữ riêng của mỗi người.
125
Nidassanatthena – ‘‘nāhaṃ sayambhū, na mayā idaṃ sacchikata’’nti attānaṃ parimocento – ‘‘iti me sutaṃ, mayāpi evaṃ suta’’nti idāni vattabbaṃ sakalaṃ suttaṃ nidasseti.
In the sense of pointing out: distancing himself from the notion "I am not self-existent, this has not been realized by me," he points out the entire Sutta to be stated now with "It was heard by me; it was heard by me thus."
Với ý nghĩa minh họa, Ngài tự giải thoát khỏi ý nghĩ "Ta không phải là bậc Tự sinh, Ta không tự chứng điều này", và Ngài minh họa toàn bộ bài kinh sắp được nói bằng cách nói: "Như vầy tôi nghe, tôi cũng đã nghe như vậy".
126
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.219-223) evaṃ bhagavatā, ‘‘āyasmā ānando atthakusalo dhammakusalo byañjanakusalo niruttikusalo pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukamyataṃ janeti – ‘‘iti me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva, na aññathā, daṭṭhabba’’nti.
In the sense of emphasizing: the venerable Ānanda, wishing to demonstrate his power of retention in accordance with the praise given by the Blessed One — "Monks, among my disciples, the bhikkhus who are learned, Ānanda is foremost; among those who are fluent, mindful, resolute, and attendants, Ānanda is foremost" — and by the General of the Dhamma — "The venerable Ānanda is skilled in meaning, skilled in Dhamma, skilled in expression, skilled in etymology, skilled in what comes before and what comes after" — generates the desire to hear in beings, stating: "Thus it was heard by me, and that (which was heard) is to be regarded as exactly so, without deficiency or excess, whether in meaning or in expression, and not otherwise."
Với ý nghĩa xác định – bằng cách này, Đức Thế Tôn đã tán thán: “Này các Tỳ-khưu, trong số các Tỳ-khưu đệ tử của Ta, vị Ananda này là bậc tối thượng trong những vị đa văn, trong những vị có trí tuệ, trong những vị có chánh niệm, trong những vị có nghị lực, trong những vị thị giả.” Và Dhammasenāpati (Đại tướng Pháp) đã tán thán: “Tôn giả Ananda thiện xảo về ý nghĩa, thiện xảo về giáo pháp, thiện xảo về văn tự, thiện xảo về ngữ nguyên, thiện xảo về trước sau.” Do đó, để thể hiện sức mạnh ghi nhớ của mình phù hợp với sự tán thán ấy, Tôn giả Ananda đã khơi dậy lòng muốn nghe của chúng sanh rằng: “Như vầy tôi đã nghe, và điều đó không thiếu không thừa, y như vậy, không khác, cả về ý nghĩa lẫn văn tự, nên được hiểu.”
Aññathāti bhagavato sammukhā sutākārato aññathā, na pana bhagavatā desitākārato.
" Aññathā" (otherwise) means otherwise than the manner heard directly from the Blessed One, but not otherwise than the manner taught by the Blessed One.
Khác ở đây có nghĩa là khác với cách đã nghe từ Đức Thế Tôn, chứ không phải khác với cách Đức Thế Tôn đã thuyết giảng.
Acinteyyānubhāvā hi bhagavato desanā, sā na sabbākārena sakkā viññātunti vuttovāyamattho.
For the Blessed One's teaching has inconceivable power, and it cannot be fully understood in all its aspects, as this meaning has been stated.
Thật vậy, giáo pháp của Đức Thế Tôn có thần lực không thể nghĩ bàn, không thể hiểu biết trọn vẹn bằng mọi cách, ý nghĩa này đã được nói đến.
Sutākārāvirujjhanameva hi dhāraṇabalaṃ.
Indeed, not contradicting the manner in which it was heard is the power of retention.
Thật vậy, sức mạnh ghi nhớ chính là không sai lệch với cách đã nghe.
Na hettha atthantaratāparihāro dvinnampi atthānaṃ ekavisayattā.
Here, there is no abandoning of the difference in meaning, because both meanings pertain to the same object.
Ở đây, không có sự khác biệt về ý nghĩa vì cả hai ý nghĩa đều có cùng đối tượng.
Itarathā hi thero bhagavato desanāya sabbathā paṭiggahaṇe samattho asamatthoti vā āpajjeyyāti.
Otherwise, it would imply that the Elder (Ānanda) was either capable or incapable of grasping the Blessed One's teaching in all its aspects.
Nếu không như vậy, thì vị Trưởng lão sẽ trở thành người có khả năng hoặc không có khả năng thấu hiểu toàn bộ giáo pháp của Đức Thế Tôn.
127
Me-saddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me được thấy trong ba ý nghĩa.
Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (saṃ. ni. 1.194; su. ni. 81) mayāti attho.
Indeed, in phrases such as "That which is sung by a verse is not suitable food for me (me = mayā)" it has the meaning of 'by me'.
Chẳng hạn, trong các câu như “ Gāthābhigītaṃ me abhojaneyyaṃ” (Bài kệ đã được hát, tôi không nên thọ dụng), ý nghĩa là tôi.
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88; 5.381; a. ni. 4.257) mayhanti attho.
In phrases such as "It would be good, venerable sir, if the Blessed One would teach me (me = mayhaṃ) the Dhamma in brief," it has the meaning of 'to me'.
Trong các câu như “ Sādhu me, Bhante, Bhagavā saṃkhittena dhammaṃ desetū” (Lành thay, Bạch Thế Tôn, Đức Thế Tôn hãy thuyết pháp tóm tắt cho con), ý nghĩa là cho tôi.
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases such as "Be heirs of the Dhamma, monks, not heirs of material things for me (me = mama)," it has the meaning of 'my'.
Trong các câu như “ Dhammadāyādā me, bhikkhave, bhavathā” (Này các Tỳ-khưu, hãy là những người thừa kế giáo pháp của Ta), ý nghĩa là của tôi.
Idha pana ‘‘mayā suta’’nti ca ‘‘mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in both meanings: "it was heard by me (mayā sutaṃ)" and "it is my (mama sutaṃ) hearing."
Ở đây, từ me được dùng với hai ý nghĩa: “tôi đã nghe” và “của tôi đã nghe”.
128
Ettha ca yo paro na hoti, so attāti evaṃ vattabbe niyakajjhattasaṅkhāte sakasantāne vattanato tividhopi me-saddo yadipi ekasmiṃyeva atthe dissati, karaṇasampadānādivisesasaṅkhāto panassa vijjatevāyaṃ atthabhedoti āha – ‘‘me-saddo tīsu atthesu dissatī’’ti.
Here, although all three forms of the word me are seen in only one meaning—that which is not another is oneself, thus occurring in one's own continuity, referred to as niyakajjhatta (one's own self)—there is indeed a distinction in its meaning as the instrumental, dative, and other cases. Therefore, it says: "the word me is seen in three meanings."
Ở đây, người không phải là người khác thì là tự ngã. Dù từ me trong cả ba trường hợp đều có cùng một ý nghĩa khi được dùng trong bản thể của chính mình, tức là tự ngã nội tại, nhưng vẫn có sự khác biệt về ý nghĩa như cách dùng trong trường hợp công cụ (karaṇa) hoặc đối tượng tiếp nhận (sampadāna). Vì vậy, đã nói: “Từ me được thấy trong ba ý nghĩa.”
129
Sutanti ayaṃ suta-saddo saupasaggo anupasaggo ca gamanavissutakilinnūpacitānuyogasotaviññeyyasotadvārānusāraviññātādianekatthappabhedo.
The word suta has many distinctions of meaning, such as going, being renowned, being moistened, being accumulated, being engaged in, being knowable by ear-consciousness, and being known by following the ear-door, whether it is with a prefix or without a prefix.
Từ suta này – từ suta này, có tiền tố và không có tiền tố, có nhiều phân loại ý nghĩa khác nhau như đi, nổi tiếng, ẩm ướt, tích lũy, chuyên chú, có thể nhận biết bằng tai, được biết đến theo dòng chảy của cửa tai, v.v.
Kiñcāpi hi kiriyāvisesako upasaggo, jotakabhāvato pana satipi tasmiṃ suta-saddo eva taṃ taṃ atthaṃ vadatīti anupasaggassa sutasaddassa atthuddhāre saupasaggopi udāharīyati.
Although a prefix specializes the verb, and indeed, it exists, yet due to its illuminating nature, even with that prefix present, it is the word suta itself that expresses those various meanings; thus, in explicating the meaning of the word suta without a prefix, even the word with a prefix is cited.
Mặc dù tiền tố là yếu tố đặc trưng của hành động, nhưng ngay cả khi có tiền tố, chính từ suta vẫn nói lên ý nghĩa đó, vì nó có tính chất làm sáng tỏ. Do đó, khi giải thích ý nghĩa của từ suta không có tiền tố, từ có tiền tố cũng được dùng làm ví dụ.
130
Tattha ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
Among these, in phrases like “_pasuto_ in the army,” the meaning is 'going'.
Trong đó, trong các câu như “ Senāya pasuto” (Đi cùng quân đội), ý nghĩa là đang đi.
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like “_passato_ of one who has heard the Dhamma,” the meaning is 'of one whose Dhamma is renowned'.
Trong các câu như “ Sutadhammassa passato” (Người đã nghe pháp và thấy pháp), ý nghĩa là người có giáo pháp nổi tiếng.
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnā kilinnassāti attho.
In phrases like “_avassutā avassutassa_,” the meaning is 'moistened, for the moistened one'.
Trong các câu như “ Avassutā avassutassā” (Người bị thấm ướt cho người bị thấm ướt), ý nghĩa là ẩm ướt cho người ẩm ướt.
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like “_Tumhehi puññaṃ pasutaṃ anappaka_,” the meaning is 'accumulated'.
Trong các câu như “ Tumhehi puññaṃ pasutaṃ anappakaṃ” (Các ngươi đã tích lũy công đức không ít), ý nghĩa là đã tích lũy.
‘‘Ye jhānappasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like “_Ye jhānappasutā dhīrā_,” the meaning is 'those engaged in jhāna'.
Trong các câu như “ Ye jhānappasutā dhīrā” (Những bậc trí tuệ chuyên chú thiền định), ý nghĩa là những người chuyên chú thiền định.
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like “_diṭṭhaṃ sutaṃ mutaṃ_,” the meaning is 'knowable by ear-consciousness'.
Trong các câu như “ Diṭṭhaṃ sutaṃ mutaṃ” (Đã thấy, đã nghe, đã ngửi), ý nghĩa là có thể nhận biết bằng tai.
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like “_sutadharo sutasannicayo_,” the meaning is 'one who holds what is known through the ear-door, recalling it continuously'.
Trong các câu như “ Sutadharo sutasannicayo” (Người thọ trì những điều đã nghe, người tích lũy những điều đã nghe), ý nghĩa là người thọ trì những điều đã biết theo dòng chảy của cửa tai.
Idha panassa ‘‘sotadvārānusārena upadhārita’’nti vā ‘‘upadhāraṇa’’nti vā attho.
Here, however, its meaning is “grasped through the ear-door” or “grasping.”
Ở đây, ý nghĩa của nó là “đã ghi nhớ theo dòng chảy của cửa tai” hoặc “sự ghi nhớ”.
Me-saddassa hi mayāti atthe sati ‘‘iti me sutaṃ, mayā sotadvārānusārena upadhārita’’nti attho.
For when the word ‘me’ has the meaning of ‘mayā’, the sense is “thus it has been heard by me, it has been grasped by me through the ear-door.”
Khi từ me có nghĩa là tôi, thì “ iti me sutaṃ” có nghĩa là “như vầy tôi đã nghe, tôi đã ghi nhớ theo dòng chảy của cửa tai”.
Mamāti atthe sati ‘‘iti mama sutaṃ sotadvārānusārena upadhāraṇa’’nti attho.
When it has the meaning of ‘mama’, the sense is “thus it is my hearing, my grasping through the ear-door.”
Khi có nghĩa là của tôi, thì “ iti mama sutaṃ” có nghĩa là “như vầy sự nghe của tôi là sự ghi nhớ theo dòng chảy của cửa tai”.
131
Evametesu tīsu padesu yasmā sutasaddasannidhāne payuttena itisaddena savanakiriyājotakena bhavitabbaṃ.
Thus, in these three terms, since the word iti, used in conjunction with the word suta, must illuminate the act of hearing.
Trong ba từ này, vì từ iti được dùng gần từ suta phải là từ làm sáng tỏ hành động nghe.
Tasmā itīti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Therefore, iti indicates the function of consciousness, such as ear-consciousness.
Do đó, iti là sự biểu thị hoạt động của thức như nhĩ thức, v.v.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me indicates the individual endowed with the aforementioned consciousness.
Me là sự biểu thị người có đầy đủ thức đã nói.
Sabbānipi vākyāni evakāratthasahitāniyeva avadhāraṇaphalattā.
All sentences are indeed accompanied by the meaning of 'eva' because they have the result of ascertainment.
Tất cả các câu đều kèm theo ý nghĩa của từ “eva” (chính là), vì đó là kết quả của sự xác định.
Tena sutanti assavanabhāvappaṭikkhepato anūnāviparītaggahaṇanidassanaṃ.
Therefore, sutaṃ indicates a complete and undistorted apprehension, by refuting the state of not having heard.
Do đó, suta là sự biểu thị sự nắm giữ không thiếu không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Yathā hi sutaṃ sutamevāti vattabbataṃ arahati, taṃ sammā sutaṃ anūnaggahaṇaṃ aviparītaggahaṇañca hotīti.
For just as what has been heard deserves to be called "heard and nothing else," so too, that which is well heard is an apprehension that is neither incomplete nor distorted.
Thật vậy, điều đã nghe xứng đáng được gọi là chỉ là điều đã nghe, điều đó được nghe đúng đắn, là sự nắm giữ không thiếu và không sai lệch.
Atha vā saddantaratthāpohanavasena saddo atthaṃ vadatīti, yasmā sutanti etassa asutaṃ na hotīti ayamattho, tasmā sutanti assavanabhāvappaṭikkhepato anūnāviparītaggahaṇanidassanaṃ.
Alternatively, a word expresses meaning by eliminating the meaning of other words; since for "sutaṃ" the meaning is "not unheard," therefore "sutaṃ" indicates an undistorted and complete apprehension by refuting the state of not having heard.
Hoặc, một từ nói lên ý nghĩa bằng cách loại bỏ ý nghĩa của các từ khác. Vì ý nghĩa của suta là “không phải là điều chưa nghe”, do đó, suta là sự biểu thị sự nắm giữ không thiếu không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Idaṃ vuttaṃ hoti – iti me sutaṃ, na diṭṭhaṃ, na sayambhuñāṇena sacchikataṃ, na aññathā vā upaladdhaṃ, apica sutaṃva, tañca kho sammadevāti.
This means: "Thus it has been heard by me; not seen, not realized by self-existent knowledge, nor otherwise attained, but truly heard, and that too, perfectly."
Điều này có nghĩa là: “Như vầy tôi đã nghe, không phải đã thấy, không phải đã chứng ngộ bằng tự thân trí tuệ, cũng không phải đã đạt được bằng cách khác, mà chính là đã nghe, và điều đó là đúng đắn.”
Avadhāraṇatthe vā itisadde ayamatthayojanāti tadapekkhassa suta-saddassa niyamattho sambhavatīti assavanabhāvappaṭikkhepo, anūnāviparītaggahaṇanidassanatā ca veditabbā.
Alternatively, if the word 'iti' has the meaning of ascertainment, then this is the connection of meaning, and therefore, for the word suta, which is dependent on it, a specific meaning, that is, the refutation of the state of not having heard, and the indication of an undistorted and complete apprehension, should be understood.
Hoặc, khi từ iti có ý nghĩa xác định, thì sự kết hợp ý nghĩa này. Khi đó, ý nghĩa xác định của từ suta, phụ thuộc vào từ iti, có thể xảy ra. Do đó, cần hiểu là sự phủ nhận trạng thái không nghe, và sự biểu thị sự nắm giữ không thiếu không sai lệch.
Evaṃ savanahetusavanavisesavasena padattayassa atthayojanā katāti daṭṭhabbaṃ.
Thus, it should be seen that the connection of meaning for the three terms has been made in terms of the cause of hearing and the specific mode of hearing.
Như vậy, cần hiểu rằng sự kết hợp ý nghĩa của ba từ đã được thực hiện theo cách nguyên nhân của sự nghe và sự đặc biệt của sự nghe.
132
Tathā itīti sotadvārānusārena pavattāya viññāṇavīthiyā nānatthabyañjanaggahaṇato nānappakārena ārammaṇe pavattibhāvappakāsanaṃ ākārattho itisaddoti katvā.
Likewise, iti indicates the manifestation of the mode of occurrence in the object in various ways, due to the apprehension of diverse meanings and expressions by the stream of consciousness that arises through the ear-door, taking the word 'iti' to mean 'mode'.
Tương tự, iti là sự biểu thị trạng thái xảy ra trên đối tượng theo nhiều cách khác nhau, do sự nắm giữ các ý nghĩa và văn tự khác nhau của dòng thức đã xảy ra theo dòng chảy của cửa tai, với việc xem từ iti có ý nghĩa là cách thức.
Meti attappakāsanaṃ.
Me is an indication of oneself.
Me là sự biểu thị bản thân.
Sutanti dhammappakāsanaṃ yathāvuttāya viññāṇavīthiyā pariyattidhammārammaṇattā.
Sutaṃ is an indication of Dhamma, because the aforementioned stream of consciousness has the _Pariyatti Dhamma_ as its object.
Suta là sự biểu thị giáo pháp, vì dòng thức đã nói là đối tượng của giáo pháp (pariyatti dhamma).
Ayañhettha saṅkhepo – nānappakārena ārammaṇe pavattāya viññāṇavīthiyā kāraṇabhūtāya mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo sutoti.
And this is the summary here: "Nothing else was done by me, for whom the stream of consciousness, acting as the cause, arose in the object in diverse ways; but this was done, this Dhamma was heard."
Đây là tóm tắt ở đây: “Bởi dòng thức xảy ra trên đối tượng theo nhiều cách khác nhau, là nguyên nhân, tôi đã không làm điều gì khác, nhưng điều này đã được làm, giáo pháp này đã được nghe.”
133
Tathā itīti nidassitabbappakāsanaṃ nidassanattho iti-saddoti katvā nidassetabbassa nidassitabbattābhāvābhāvato.
Likewise, iti signifies the exposition of what is to be shown, taking the word 'iti' to mean 'demonstration', because that which is to be shown cannot be absent.
Tương tự, iti là sự biểu thị điều cần được chỉ ra, với việc xem từ iti có ý nghĩa là sự chỉ ra, vì điều cần được chỉ ra là không thể không được chỉ ra.
Tasmā itisaddena sakalampi sutaṃ paccāmaṭṭhanti veditabbaṃ.
Therefore, it should be understood that the entire discourse that has been heard is referred to by the word 'iti'.
Do đó, cần hiểu rằng toàn bộ điều đã nghe được từ iti đề cập lại.
Meti puggalappakāsanaṃ.
Me signifies the exposition of the individual.
Me là sự biểu thị cá nhân.
Sutanti puggalakiccappakāsanaṃ.
Sutaṃ signifies the exposition of the individual's function.
Suta là sự biểu thị hành động của cá nhân.
Suta-saddena hi labbhamānā savanakiriyā savanaviññāṇappabandhappaṭibaddhā, tattha ca puggalavohāro.
For the act of hearing, which is obtained through the word suta, is connected to the continuum of ear-consciousness, and in that, there is the designation of an individual.
Thật vậy, hành động nghe được từ từ suta là liên quan đến chuỗi thức nghe, và trong đó có sự gọi tên cá nhân.
Na hi puggalavohārarahite dhammappabandhe savanakiriyā labbhati.
Indeed, the act of hearing is not obtained in a continuum of Dhamma devoid of individual designation.
Thật vậy, hành động nghe không thể có được trong một chuỗi pháp không có sự gọi tên cá nhân.
Tassāyaṃ saṅkhepattho – yaṃ suttaṃ niddisissāmi, taṃ mayā iti sutanti.
Its summary meaning is: "The discourse I will point out, thus it was heard by me."
Ý nghĩa tóm tắt của điều này là: “Bài kinh mà tôi sẽ chỉ ra, tôi đã nghe như vầy.”
134
Tathā itīti yassa cittasantānassa nānārammaṇappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso ākārattho itisaddoti katvā.
Likewise, iti is a designation of various modes for that stream of consciousness in which the apprehension of diverse meanings and expressions occurs due to its engagement with various objects, taking the word 'iti' to mean 'mode'.
Tương tự, iti là sự chỉ rõ các cách thức khác nhau của dòng tâm thức mà trong đó có sự nắm giữ các ý nghĩa và văn tự khác nhau do sự xảy ra của các đối tượng khác nhau, với việc xem từ iti có ý nghĩa là cách thức.
Itīti hi ayaṃ ākārapaññatti dhammānaṃ taṃ taṃ pavattiākāraṃ upādāya paññāpetabbasabhāvattā.
For this designation iti is a conceptualization of mode, because phenomena are such that they must be conceptualized according to their respective modes of occurrence.
Thật vậy, iti này là sự đặt tên về cách thức, vì các pháp có bản chất cần được đặt tên dựa trên các cách thức xảy ra khác nhau của chúng.
Meti kattuniddeso.
Me is the designation of the agent.
Me là sự chỉ rõ người hành động.
Sutanti visayaniddeso.
Sutaṃ is the designation of the object.
Suta là sự chỉ rõ đối tượng.
Sotabbo hi dhammo savanakiriyākattupuggalassa savanakiriyāvasena pavattiṭṭhānaṃ hoti.
For the Dhamma to be heard becomes the locus of occurrence for the individual who is the agent of the act of hearing, by way of the act of hearing.
Thật vậy, giáo pháp cần được nghe là nơi xảy ra đối với người hành động của hành động nghe, theo cách của hành động nghe.
Ettāvatā nānappakārappavattena cittasantānena taṃsamaṅgino kattu visaye gahaṇasanniṭṭhānaṃ dassitaṃ hoti.
By this much, the complete apprehension of the object by the agent, who is endowed with that stream of consciousness that arises in diverse ways, has been shown.
Đến đây, đã chỉ ra sự xác định về sự nắm giữ trong đối tượng của người hành động, người có đầy đủ dòng tâm thức xảy ra theo nhiều cách khác nhau.
135
Atha vā itīti puggalakiccaniddeso.
Alternatively, iti is the designation of the individual's function.
Hoặc, iti là sự chỉ rõ hành động của cá nhân.
Sutānañhi dhammānaṃ gahitākārassa nidassanassa avadhāraṇassa vā pakāsanabhāvena itisaddena tadākārādidhāraṇassa puggalavohārūpādānadhammabyāpārabhāvato puggalakiccaṃ nāma niddiṭṭhaṃ hotīti.
For the word 'iti', by expressing the apprehended mode, or the demonstration, or the ascertainment of the Dhamma that has been heard, implies the individual's function, due to the activity of the Dhamma-continuum which takes up the individual's designation as the basis for holding that mode and so forth.
Thật vậy, vì từ iti biểu thị trạng thái công bố cách thức đã nắm giữ, hoặc sự chỉ ra, hoặc sự xác định của các pháp đã nghe, và vì đó là hoạt động của pháp dựa trên sự gọi tên cá nhân trong việc thọ trì các cách thức đó, nên hành động của cá nhân đã được chỉ rõ.
Sutanti viññāṇakiccaniddeso.
Sutaṃ is the designation of the consciousness function.
Suta là sự chỉ rõ hành động của thức.
Puggalavādinopi hi savanakiriyā viññāṇanirapekkhā na hotīti.
For even for those who assert an individual, the act of hearing is not independent of consciousness.
Thật vậy, ngay cả đối với những người theo thuyết cá nhân (puggalavādin), hành động nghe cũng không thể thiếu thức.
Meti ubhayakiccayuttapuggalaniddeso.
Me is the designation of the individual associated with both functions.
Me là sự chỉ rõ cá nhân có cả hai hành động.
Meti hi saddappavatti ekanteneva sattavisesavisayā, viññāṇakiccañca tattheva samodahitabbanti.
For the utterance of the word 'me' invariably pertains to a specific sentient being, and the function of consciousness must also be included therein.
Thật vậy, sự xuất hiện của từ me hoàn toàn liên quan đến một loại chúng sanh đặc biệt, và hành động của thức cũng phải được bao hàm trong đó.
Ayaṃ panettha saṅkhepo – mayā savanakiccaviññāṇasamaṅginā puggalena viññāṇavasena laddhassavanakiccavohārena sutanti.
This is the summary here: "It was heard by me, an individual endowed with the consciousness of the act of hearing, through the designation of the act of hearing obtained by way of consciousness."
Đây là tóm tắt trong trường hợp này: ‘Tôi’, một người có đầy đủ thức giác của việc nghe, đã nghe được thông qua cách gọi là việc nghe nhờ thức giác.
136
Tathā itīti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
Likewise, both iti and me are conceptualizations of non-existent entities in terms of ultimate reality.
Cũng vậy, ‘itī’ và ‘me’ là những paññatti (chế định) không hiện hữu theo nghĩa paramattha (chân đế).
Sabbassa hi saddādhigamanīyassa atthassa paññattimukheneva paṭipajjitabbattā sabbapaññattīnañca vijjamānādīsu chasveva paññattīsu avarodho, tasmā yo māyāmarīciādayo viya abhūtattho, anussavādīhi gahetabbo viya anuttamattho ca na hoti.
For since all meaning accessible by words must be apprehended through conceptualization, and all conceptualizations fall into the six types of conceptualizations such as existent, therefore, that ultimate reality which is not a false meaning like illusion or mirage, nor an inferior meaning to be grasped by hearsay and so forth,
Quả thật, vì tất cả ý nghĩa có thể hiểu được bằng lời nói đều phải được thực hành thông qua paññatti, và vì tất cả paññatti đều nằm trong sáu loại paññatti, bao gồm cả loại hiện hữu, do đó, điều gì không phải là ý nghĩa không có thật như ảo ảnh hay ảo giác, và cũng không phải là ý nghĩa không tối thượng như điều được nghe qua truyền khẩu, thì đó là paramattha (chân đế).
So rūpasaddādiko ruppanānubhavanādiko ca paramatthasabhāvo saccikaṭṭhaparamatthavasena vijjati.
that ultimate nature of rūpa and sound, suffering and experiencing, exists in terms of ultimate reality.
Bản chất tối hậu của sắc, âm thanh, v.v., tức là bản chất tối hậu của sự biến hoại, sự cảm thọ, v.v., là hiện hữu theo nghĩa paramattha (chân đế) chân thật.
Yo pana itīti ca meti ca vuccamāno ākārādiaparamatthasabhāvo saccikaṭṭhaparamatthavasena anupalabbhamāno avijjamānapaññatti nāma, kimettha taṃ paramatthato atthi, yaṃ itīti vā meti vā niddesaṃ labhetha.
But that which is called 'iti' and 'me', a non-ultimate nature such as a mode, not being found in terms of ultimate reality, is called a conceptualization of a non-existent entity. What exists there in ultimate reality that could be designated as 'iti' or 'me'?
Còn cái gì được gọi là ‘itī’ và ‘me’, tức là bản chất không tối hậu của hình thái, v.v., không thể nhận thức được theo nghĩa paramattha (chân đế) chân thật, thì đó gọi là avijjamānapaññatti (chế định không hiện hữu). Vậy thì, trong trường hợp này, cái gì hiện hữu theo nghĩa paramattha mà có thể được gọi là ‘itī’ hay ‘me’?
Sutanti vijjamānapaññatti.
Sutaṃ is an existent conceptualization.
‘Sutaṃ’ (đã nghe) là vijjamānapaññatti (chế định hiện hữu).
Yañhi taṃ sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For that which is apprehended by the ear is truly existent in terms of ultimate reality.
Quả thật, điều gì được nhận thức bằng tai, điều đó là hiện hữu theo nghĩa paramattha.
137
Tathā itīti sotapathamāgate dhamme upādāya tesaṃ upadhāritākārādīnaṃ paccāmasanavasena.
Likewise, iti is a conceptualization based on what is grasped, due to re-examining the modes and other aspects of Dhamma that have come into the ear's range, by taking them as a basis.
Cũng vậy, ‘itī’ là upādāpaññatti (chế định nương tựa), do nương vào các pháp đã đến với đường tai và do hồi tưởng các hình thái, v.v., đã được xác định của chúng.
Meti sasantatipariyāpanne khandhe karaṇādivisesavisiṭṭhe upādāya vattabbato upādāpaññatti.
Me is a dependent conceptualization, as it is spoken with reference to the khandhas included within one's own continuum, which are distinguished by modes of action and so forth.
‘Me’ là upādāpaññatti (chế định nương tựa), do được nói dựa trên các uẩn thuộc dòng tương tục của tự thân, được đặc trưng bởi các đặc tính như tác động.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a comparative conceptualization, as it is spoken by comparing it to what is seen and so forth.
‘Sutaṃ’ là upanidhāpaññatti (chế định so sánh), do được nói dựa trên những gì đã thấy, v.v.
Diṭṭhādisabhāvarahite saddāyatane pavattamānopi sutavohāro dutiyaṃ, tatiyanti ādiko viya paṭhamādiṃ nissāya ‘‘yaṃ na diṭṭhamutaviññātanirapekkhaṃ, taṃ suta’’nti viññeyyattā diṭṭhādīni upanidhāya vattabbo hoti.
Even though the designation ‘heard’ (suta) occurs in the sound-base, which is devoid of the nature of the seen, etc., just as ‘second’, ‘third’, and so on* on ‘first’, and so on, it must be stated by referring to the seen, etc., because it is to be understood that “that which is independent of what is seen, heard (directly), or cognized (by other senses) is ‘suta’ (heard).”
Mặc dù cách gọi ‘suta’ (đã nghe) diễn ra đối với sắc xứ là không có bản chất của những gì đã thấy, v.v., nhưng nó phải được nói dựa trên những gì đã thấy, v.v., vì nó được hiểu là “điều không độc lập với những gì đã thấy, đã nghe, đã biết”, giống như thứ hai, thứ ba, v.v., nương vào thứ nhất, v.v.
Asutaṃ na hotīti hi sutanti pakāsitoyamatthoti.
For this is the meaning that has been proclaimed: that which is not unheard is heard.
Quả thật, ý nghĩa này được tuyên bố là ‘suta’ (đã nghe) vì nó không phải là ‘asuta’ (chưa nghe).
138
Ettha ca itīti vacanena asammohaṃ dīpeti.
Here, by the word iti (thus), non-bewilderment is indicated.
Ở đây, với lời nói ‘itī’, ngài Ānanda biểu thị sự không lầm lẫn.
Paṭividdhā hi atthassa pakāravisesā itīti idha āyasmatā ānandena paccāmaṭṭhā, tenassa asammoho dīpito.
For the specific modes of meaning, which are to be penetrated, were re-examined here by Venerable Ānanda with the word iti; therefore, his non-bewilderment is indicated.
Quả thật, các loại ý nghĩa đặc biệt đã được ngài Ānanda hồi tưởng ở đây bằng ‘itī’, do đó sự không lầm lẫn của ngài được biểu thị.
Na hi sammūḷho nānappakārappaṭivedhasamattho hoti, lobhappahānādivasena nānappakārā duppaṭividdhā ca suttatthā niddisīyanti.
For one who is bewildered is not capable of penetrating various modes, and Sutta meanings, which are of various modes and difficult to penetrate, are expounded by way of abandoning greed, etc.
Quả thật, người mê muội không thể thấu hiểu các loại ý nghĩa khác nhau; và các ý nghĩa của kinh điển, vốn khó thấu hiểu theo nhiều cách khác nhau như sự từ bỏ tham ái, v.v., được chỉ rõ.
Sutanti vacanena asammosaṃ dīpeti sutākārassa yāthāvato dassiyamānattā yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantare mayā sutanti paṭijānāti.
By the word sutaṃ (heard), non-forgetfulness is indicated, because the true nature of what was heard is shown. For one whose hearing (suta) is forgotten, he does not later acknowledge that “I heard this.”
Với lời nói ‘sutaṃ’, ngài biểu thị sự không quên, vì hình thái đã nghe được trình bày đúng như thật. Quả thật, người nào đã quên điều mình đã nghe, người đó về sau không thể xác nhận rằng ‘tôi đã nghe điều này’.
Iccassa asammohena sammohābhāvena paññāya eva vā savanakālasambhūtāya taduttarikālapaññāsiddhi, tathā asammosena satisiddhi.
Thus, by his non-bewilderment, the absence of bewilderment, or by the wisdom arisen at the time of hearing, the attainment of subsequent wisdom, and likewise by non-forgetfulness, the attainment of mindfulness.
Như vậy, nhờ sự không lầm lẫn, tức là không mê muội, trí tuệ của ngài thành tựu trong thời gian sau đó, cũng như trí tuệ phát sinh trong thời gian nghe; và nhờ sự không quên, chánh niệm của ngài thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā.
Among these, the ability to grasp the syllables (byañjana) belongs to mindfulness, which is preceded by wisdom.
Trong đó, chánh niệm do trí tuệ dẫn đầu có khả năng nắm giữ các từ ngữ.
Byañjanānañhi paṭivijjhitabbo ākāro nātigambhīro, yathāsutadhāraṇameva tattha karaṇīyanti satiyā byāpāro adhiko, paññā tattha guṇībhūtā hoti paññāya pubbaṅgamāti katvā.
For the aspect of syllables to be penetrated is not too profound; what needs to be done there is simply remembering what was heard. Therefore, the activity of mindfulness is greater, and wisdom is secondary, having been preceded by wisdom.
Vì hình thái của các từ ngữ cần được thấu hiểu không quá sâu sắc, và việc ghi nhớ đúng như đã nghe là điều cần làm ở đó, nên sự hoạt động của chánh niệm là chủ yếu, còn trí tuệ ở đó trở thành phụ thuộc, vì được nói là ‘do trí tuệ dẫn đầu’.
Satipubbaṅgamāya paññāya atthappaṭivedhasamatthatā.
The ability to penetrate the meaning belongs to wisdom, which is preceded by mindfulness.
Trí tuệ do chánh niệm dẫn đầu có khả năng thấu hiểu ý nghĩa.
Atthassa hi paṭivijjhitabbo ākāro gambhīroti paññāya byāpāro adhiko, sati tattha guṇībhūtā hoti satiyā pubbaṅgamāti katvā.
For the aspect of meaning to be penetrated is profound. Therefore, the activity of wisdom is greater, and mindfulness is secondary, having been preceded by mindfulness.
Vì hình thái của ý nghĩa cần được thấu hiểu là sâu sắc, nên sự hoạt động của trí tuệ là chủ yếu, còn chánh niệm ở đó trở thành phụ thuộc, vì được nói là ‘do chánh niệm dẫn đầu’.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthatāya dhammabhaṇḍāgārikattasiddhi.
By the combination of capability in both, the attainment of being a Dhamma treasurer (dhammabhaṇḍāgārika) is achieved through the ability to uphold the treasury of Dhamma, which is complete in both meaning and syllables.
Nhờ sự kết hợp của khả năng kép này, tức là khả năng nắm giữ cả từ ngữ và ý nghĩa, ngài đã thành tựu vai trò của một thủ kho Pháp bảo, có khả năng bảo vệ kho tàng Pháp bảo đầy đủ cả ý nghĩa và từ ngữ.
139
Aparo nayo – itīti vacanena yonisomanasikāraṃ dīpeti.
Another way: By the word iti, right attention (yonisomanasikāra) is indicated.
Một cách giải thích khác: Với lời nói ‘itī’, ngài biểu thị sự tác ý đúng đắn (yonisomanasikāra).
Tena vuccamānānaṃ ākāranidassanāvadhāraṇatthānaṃ upari vakkhamānānaṃ nānappakārappaṭivedhajotakānaṃ aviparītasaddhammavisayattā.
This is because the indications of modes, and the meanings of determination, which will be spoken of above, and which manifest the penetration of various modes, have the undistorted Dhamma as their object.
Điều này là do các ý nghĩa của sự chỉ dẫn hình thái và sự xác định được nói đến ở đây, cũng như những điều sẽ được nói đến sau, vốn biểu thị sự thấu hiểu các loại khác nhau, đều liên quan đến Chánh Pháp không sai lệch.
Na hi ayoniso manasikaroto nānappakārappaṭivedho sambhavati.
For the penetration of various modes does not occur for one who attends unwisely.
Quả thật, sự thấu hiểu các loại khác nhau không thể phát sinh ở người tác ý không đúng đắn.
Sutanti vacanena avikkhepaṃ dīpeti, nidānapucchāvasena pakaraṇappattassa vakkhamānassa suttassa savanaṃ na samādhānamantarena sambhavati vikkhittacittassa savanābhāvato.
By the word sutaṃ, non-distraction is indicated, as the hearing of the Sutta that will be spoken of, which has arrived at its context by way of cause and question, cannot occur without concentration, due to the absence of hearing for a distracted mind.
Với lời nói ‘sutaṃ’, ngài biểu thị sự không tán loạn, vì việc lắng nghe kinh điển sẽ được nói đến, vốn liên quan đến nguyên nhân và câu hỏi, không thể xảy ra nếu không có định tâm, bởi vì người có tâm tán loạn không thể lắng nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti vadati.
Thus, a distracted person, even when addressed with all that is complete, says, “I did not hear it; please repeat it.”
Quả thật, một người có tâm tán loạn, dù được nói tất cả những điều tốt đẹp, vẫn nói: “Tôi chưa nghe, xin hãy nói lại.”
Yonisomanasikārena cettha attasammāpaṇidhiṃ pubbekatapuññatañca sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by right attention (yonisomanasikāra), he accomplishes his proper aspiration and past meritorious deeds, for these are absent in one whose self is not properly directed or who has not performed meritorious deeds in the past.
Ở đây, nhờ tác ý đúng đắn, ngài thành tựu sự tự đặt mình đúng đắn và công đức đã tạo trong quá khứ, bởi vì người không tự đặt mình đúng đắn hoặc người chưa tạo công đức trong quá khứ thì không có những điều đó.
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti, assutavato sappurisūpanissayarahitassa ca tadabhāvato.
By non-distraction, he accomplishes the hearing of the Saddhamma and reliance on good people, for these are absent in one who has not heard or who is devoid of reliance on good people.
Nhờ sự không tán loạn, ngài thành tựu việc lắng nghe Chánh Pháp và sự nương tựa bậc thiện hữu, bởi vì người chưa từng nghe hoặc người không có sự nương tựa bậc thiện hữu thì không có những điều đó.
Na hi vikkhittacitto saddhammaṃ sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthi.
For one with a distracted mind cannot hear the Saddhamma, nor is there hearing for one who does not rely on good people.
Quả thật, người có tâm tán loạn không thể lắng nghe Chánh Pháp, và người không nương tựa bậc thiện hữu thì không có sự lắng nghe.
140
Aparo nayo – ‘‘yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ.
Another way: It is said, “The explanation of various modes is for that mental continuum in which the grasping of various meanings and syllables occurs due to the occurrence of various modes.”
Một cách giải thích khác: “Đối với dòng tâm thức mà sự nắm bắt các ý nghĩa và từ ngữ khác nhau xảy ra do sự vận hành của nhiều hình thái khác nhau, thì đó là sự chỉ rõ các hình thái khác nhau.”
Yasmā ca so bhagavato vacanassa atthabyañjanappabhedaparicchedavasena sakalasāsanasampatiogāhanena niravasesaparahitapāripūrikāraṇabhūto evaṃbhaddako ākāro na sammā appaṇihitattano pubbe akatapuññassa vā hoti, tasmā itīti iminā bhaddakena ākārena pacchimacakkadvayasampattimattano dīpeti, sutanti savanayogena purimacakkadvayasampattiṃ.
And because such an excellent mode, which is the cause for the complete fulfillment of the welfare of others without remainder, through fully comprehending the entire Dispensation by discerning the distinctions of meaning and syllables in the Buddha’s words, does not arise for one whose self is not properly directed or who has not performed meritorious deeds in the past, therefore, by this excellent mode (iti), he indicates his attainment of the latter two wheels, and by the act of hearing (sutaṃ), the attainment of the former two wheels.
Và vì hình thái tốt đẹp như vậy, vốn là nguyên nhân hoàn thành lợi ích cho người khác một cách trọn vẹn bằng cách thâm nhập toàn bộ giáo pháp thông qua việc phân tích các loại ý nghĩa và từ ngữ trong lời dạy của Đức Thế Tôn, không thể có ở người không tự đặt mình đúng đắn hoặc người chưa tạo công đức trong quá khứ, do đó, với hình thái tốt đẹp này của ‘itī’, ngài biểu thị sự thành tựu của hai bánh xe cuối cùng của mình, và với ‘sutaṃ’ (đã nghe), ngài biểu thị sự thành tựu của hai bánh xe đầu tiên thông qua việc lắng nghe.
Na hi appatirūpe dese vasato sappurisūpanissayarahitassa vā savanaṃ atthi.
For there is no hearing for one who dwells in an unsuitable place or who is devoid of reliance on good people.
Quả thật, không có sự lắng nghe đối với người sống ở nơi không thích hợp hoặc người không nương tựa bậc thiện hữu.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti, sammā paṇihitatto pubbe ca katapuñño visuddhāsayo hoti, tadavisuddhihetūnaṃ kilesānaṃ dūrībhāvato.
Thus, by the attainment of these latter two wheels, his purity of intention is established, for one whose self is properly directed and who has performed meritorious deeds in the past has a purified intention, due to the removal of the defilements that are causes of impurity.
Như vậy, với sự thành tựu của hai bánh xe cuối cùng, sự thanh tịnh của ý định đã thành tựu, vì người tự đặt mình đúng đắn và đã tạo công đức trong quá khứ có ý định thanh tịnh, do các phiền não là nguyên nhân của sự không thanh tịnh đó đã được loại bỏ.
Tathā hi vuttaṃ – ‘‘sammā paṇihitaṃ cittaṃ, seyyaso naṃ tato kare’’ti (dha. pa. 43) ‘‘katapuññosi tvaṃ, ānanda, padhānamanuyuñja, khippaṃ hohisi anāsavo’’ti (dī. ni. 2.207) ca.
Thus it is said: “A well-directed mind makes one superior to that” and “You, Ānanda, are one who has done merit; strive diligently, you will quickly become taintless.”
Quả thật, đã nói: “Tâm được đặt đúng đắn, sẽ làm cho người ấy tốt đẹp hơn” và “Này Ānanda, con đã tạo công đức, hãy chuyên tâm tinh tấn, con sẽ nhanh chóng trở thành người không lậu hoặc.”
Purimacakkadvayasiddhiyā payogasuddhi.
By the attainment of the former two wheels, purity of practice is established.
Với sự thành tựu của hai bánh xe đầu tiên, sự thanh tịnh trong thực hành đã thành tựu.
Patirūpadesavāsena hi sappurisūpanissayena ca sādhūnaṃ diṭṭhānugatiāpajjanenapi visuddhappayogo hoti.
For by dwelling in a suitable place, and by reliance on good people, and by following the example of the virtuous, one's practice becomes purified.
Quả thật, nhờ sống ở nơi thích hợp, nhờ nương tựa bậc thiện hữu, và nhờ noi theo gương của các bậc hiền thiện, sự thực hành trở nên thanh tịnh.
Tāya ca āsayasuddhiyā adhigamabyattisiddhi, pubbe eva taṇhādiṭṭhisaṃkilesānaṃ visodhitattā payogasuddhiyā āgamabyattisiddhi.
By that purity of intention, the attainment of proficiency in realization is achieved, due to the prior purification of the defilements of craving and views; by the purity of practice, the attainment of proficiency in textual learning is achieved.
Và nhờ sự thanh tịnh của ý định đó, sự thành tựu của sự thông hiểu (adhigamabyatti) đã thành tựu, vì các ô nhiễm tham ái và tà kiến đã được làm sạch từ trước; nhờ sự thanh tịnh trong thực hành, sự thành tựu của sự thông thạo giáo lý (āgamabyatti) đã thành tựu.
Suparisuddhakāyavacīpayogo hi vippaṭisārābhāvato avikkhittacitto pariyattiyaṃ visārado hoti.
For one whose bodily and verbal practice is perfectly pure, being free from remorse and having an undistracted mind, becomes confident in the recitation (pariyatti).
Quả thật, người có sự thực hành thân và khẩu hoàn toàn thanh tịnh, do không có sự hối tiếc, có tâm không tán loạn và thông thạo trong việc học tập.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggamanaṃ viya sūriyassa udayato, yonisomanasikāro viya ca kusaladhammassa, arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento iti me sutantiādimāha.
Thus, the statement of one who is pure in practice and intention, and accomplished in both textual learning and realization, is worthy of being the preface to the Buddha’s words, like the rising of the sun at dawn, and like right attention for wholesome states. Therefore, setting the introduction in its proper place, he says, “Evam me sutaṃ” and so on.
Như vậy, lời nói của người có ý định và thực hành thanh tịnh, đầy đủ cả giáo lý và sự thông hiểu, xứng đáng trở thành lời mở đầu cho lời dạy của Đức Thế Tôn, giống như mặt trời mọc khi bình minh ló dạng, và giống như sự tác ý đúng đắn là khởi đầu của các thiện pháp. Do đó, ngài đã nói “Iti me sutaṃ” (Như vầy tôi nghe) và những lời tương tự, đặt nền tảng cho sự khởi đầu đúng chỗ.
141
Aparo nayo – itīti iminā pubbe vuttanayena nānappakārappaṭivedhadīpakena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another way: By this (iti), which indicates the penetration of various modes in the manner stated previously, he indicates his possession of the attainment of the paṭisambhida-ñāṇas of meaning (attha) and ready wit (paṭibhāna).
Một cách giải thích khác: Với ‘itī’, vốn biểu thị sự thấu hiểu các loại khác nhau theo cách đã nói ở trên, ngài biểu thị sự hiện hữu của sự thành tựu các tuệ phân tích (paṭisambhidā) về ý nghĩa (attha) và biện tài (paṭibhāna) của chính mình.
Sutanti iminā itisaddasannidhānato vakkhamānāpekkhāya vā sotabbabhedappaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ dīpeti.
By this (sutaṃ), which indicates the penetration of various types of things to be heard—either by its proximity to the word iti or by reference to what is to be stated—he indicates his possession of the attainment of the paṭisambhida-ñāṇas of Dhamma and language (nirutti).
Với ‘sutaṃ’, do sự gần gũi của từ ‘iti’ hoặc do mong đợi những điều sẽ được nói đến, vốn biểu thị sự thấu hiểu các loại điều cần nghe, ngài biểu thị sự hiện hữu của sự thành tựu các tuệ phân tích về Pháp (dhamma) và ngôn ngữ (nirutti).
Itīti ca idaṃ vuttanayeneva yonisomanasikāradīpakaṃ vacanaṃ bhāsamāno ‘‘ete mayā dhammā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And by uttering the word iti, which indicates right attention (yonisomanasikāra) in the manner stated, he indicates, “These Dhamma-s have been repeatedly contemplated by me with the mind, and thoroughly penetrated with insight.”
Và khi nói lời ‘itī’ này, vốn biểu thị sự tác ý đúng đắn theo cách đã nói, ngài biểu thị rằng: “Những pháp này đã được tôi quán sát bằng tâm, đã được thấu hiểu rõ ràng bằng tuệ.”
Pariyattidhammā hi ‘‘idha sīlaṃ kathitaṃ, idha samādhi, idha paññā, ettakā ettha anusandhiyo’’tiādinā nayena manasā anupekkhitā anussavākāraparivitakkasahitāya dhammanijjhānakkhantibhūtāya ñātapariññāsaṅkhātāya vā diṭṭhiyā tattha tattha vuttarūpārūpadhamme ‘‘iti rūpaṃ, ettakaṃ rūpa’’ntiādinā nayena suṭṭhu vavatthapetvā paṭividdhā attano paresañca hitasukhāvahā hontīti.
For the Dhamma-s of learning (pariyatti), when contemplated repeatedly by the mind in such a way as: “Here sīla (virtue) is taught, here samādhi (concentration), here paññā (wisdom); such and such are the connections here,” and so on; and when thoroughly delineated and penetrated by insight (diṭṭhi)—which is endowed with the manner of having heard repeatedly and with discursive thought, and which amounts to the patience of Dhamma-observation, or which is called 'known discernment' (ñātā pariññā)—regarding the form and formless Dhamma-s taught in various places, in such a way as: “This is form, such is the extent of form,” and so on, they become conducive to the welfare and happiness of oneself and others.
Quả thật, các pháp thuộc Pariyatti (giáo lý), khi được quán sát bằng tâm theo cách như “ở đây nói về giới, ở đây nói về định, ở đây nói về tuệ, có bấy nhiêu sự liên kết ở đây”, và khi được thấu hiểu rõ ràng bằng tuệ, tức là sự chấp nhận của trí quán pháp (dhammanijjhānakkhanti) đi kèm với sự suy tư về cách nghe truyền khẩu, hay là trí tuệ được gọi là tri biến tri (ñātāpariññā), bằng cách phân định rõ ràng các pháp sắc và vô sắc đã được nói đến ở từng chỗ theo cách như “đây là sắc, sắc có bấy nhiêu”, thì chúng sẽ mang lại lợi ích và hạnh phúc cho chính mình và cho người khác.
Suttanti idaṃ savanayogaparidīpakavacanaṃ bhāsamāno ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering this word sutaṃ (heard), which indicates the engagement in hearing, he indicates, “Many Dhamma-s have been heard by me, retained, and well-acquainted verbally.”
Khi nói lời này, Sutta (những điều đã nghe), một lời chỉ rõ sự tinh tấn lắng nghe, ngài Ānanda muốn cho thấy rằng: “Tôi đã nghe nhiều pháp, đã thọ trì và đã quen thuộc bằng lời nói.”
Sotāvadhānappaṭibaddhā hi pariyattidhammassa savanadhāraṇaparicayā.
For the hearing, retention, and acquaintance of the Dhamma of learning (pariyatti) are bound up with attentiveness to listening.
Quả thật, việc nghe, thọ trì và quen thuộc với pháp học (pariyattidhamma) đều gắn liền với sự chú tâm lắng nghe.
Tadubhayenapi dhammassa svākkhātabhāvena atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both these (aspects), indicating the completeness of meaning and syllables due to the well-expounded nature of the Dhamma, he engenders reverence in listening.
Với cả hai điều đó (nghe và thọ trì), ngài chỉ rõ sự viên mãn về ý nghĩa (attha) và văn tự (byañjana) của Pháp là được thuyết giảng hoàn hảo (svākkhāta), từ đó khơi dậy sự tôn kính trong việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabbo.
For one who does not listen respectfully to the Dhamma, which is complete in meaning and syllables, remains far removed from great benefit. Therefore, generating reverence, the Dhamma should be listened to with care.
Quả thật, người nào không lắng nghe Pháp đầy đủ ý nghĩa và văn tự với sự tôn kính thì sẽ bị bỏ rơi khỏi lợi ích lớn lao. Vì vậy, cần phải lắng nghe Pháp một cách cẩn trọng, với sự tôn kính.
142
Iti me sutanti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammavinayaṃ attano adahanto asappurisabhūmiṃ atikkamati, sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
With this entire phrase, "Thus have I heard," Venerable Ānanda, by not attributing the Dhamma and Vinaya proclaimed by the Tathāgata to himself, transcends the stage of ignoble persons. By acknowledging his disciple-status, he enters the stage of noble persons.
Tuy nhiên, với toàn bộ câu nói Iti me sutaṃ (Như vầy tôi nghe), Tôn giả Ānanda không nhận Pháp và Luật do Đức Như Lai thuyết giảng là của mình, nhờ đó vượt qua địa vị của kẻ bất thiện, và khi tuyên bố mình là đệ tử, ngài bước vào địa vị của bậc thiện nhân.
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
In this way, he makes the mind rise up from ignoble states and establishes the mind in noble states.
Như vậy, ngài đưa tâm thoát khỏi tà pháp và thiết lập tâm vào chánh pháp.
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva pana bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By declaring, "This was merely heard by me; indeed, it is the word of the Blessed One," he frees himself, points to the Teacher, completes the word of the Buddha, and establishes the guideline of the Dhamma.
Ngài nói: “Đây chỉ là điều tôi đã nghe, nhưng đó là lời của chính Đức Thế Tôn,” nhờ đó giải thoát chính mình, chỉ rõ Đức Bổn Sư, xác nhận lời của Đức Phật, và thiết lập đường lối của Pháp.
143
Apica iti me sutanti attanā uppāditabhāvaṃ appaṭijānanto purimassavanaṃ vivaranto sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa.
Furthermore, by the phrase "Thus have I heard," Venerable Ānanda, not claiming it as his own creation, but revealing a previous hearing, says, "This was received by me directly from the presence of that Blessed One, who is fearless through the four fearlessnesses, possessing the ten powers, standing in the supreme position, roaring a lion's roar, supreme among all beings, lord of the Dhamma, king of the Dhamma, master of the Dhamma, lamp of the Dhamma, refuge of the Dhamma, a Universal Monarch of the sublime Dhamma, a Perfectly Self-Enlightened One.
Hơn nữa, khi nói Iti me sutaṃ (Như vầy tôi nghe), Tôn giả Ānanda không nhận rằng mình đã tự tạo ra lời này, mà tiết lộ rằng đây là điều ngài đã trực tiếp tiếp nhận từ Đức Thế Tôn, bậc đã thành tựu bốn sự tự tin (catuvesārajja), nắm giữ mười lực (dasabala), đứng vững ở vị trí tối thượng (āsabhaṭṭhāna), rống tiếng sư tử hống, là tối thượng trong tất cả chúng sinh, là Pháp Chủ, Pháp Vương, Pháp Tôn, Pháp Đăng, Pháp Quy, Chuyển Luân Thánh Vương của Chánh Pháp tối thượng, là bậc Chánh Đẳng Giác (Sammāsambuddha).
Na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kātabbāti sabbadevamanussānaṃ imasmiṃ dhammavinaye assaddhiyaṃ vināseti, saddhāsampadaṃ uppādeti.
No doubt or perplexity should be entertained here concerning the meaning, the Dhamma, the words, or the phrases," thus destroying the lack of faith in this Dhamma-Vinaya among all devas and humans, and generating the accomplishment of faith.
Ngài tuyên bố rằng: "Không nên có bất kỳ sự nghi ngờ hay phân vân nào về ý nghĩa, pháp, từ ngữ hay văn tự trong Pháp và Luật này," nhờ đó tiêu diệt sự bất tín (asaddhiya) của tất cả chư thiên và loài người đối với Pháp và Luật này, và phát sinh sự thành tựu về đức tin (saddhāsampadā).
Tenetaṃ vuccati –
Thus it is said:
Vì vậy, có câu nói:
144
‘‘Vināsayati assaddhaṃ, saddhaṃ vaḍḍheti sāsane;
"He destroys the faithless, and increases faith in the Dispensation;
“Đệ tử của Đức Gotama, khi nói ‘Như vầy tôi nghe,’
145
Iti me sutamiccevaṃ, vadaṃ gotamasāvako’’ti.
Saying 'Thus have I heard,' this disciple of Gotama."
Tiêu diệt sự bất tín, tăng trưởng đức tin trong Giáo Pháp.”
146
Etthāha – ‘‘kasmā panettha yathā aññesu suttesu ‘evaṃ me sutaṃ, ekaṃ samayaṃ bhagavā’tiādinā kāladese apadisitvāva nidānaṃ bhāsitaṃ, evaṃ na bhāsita’’nti?
Here it is asked: "Why, in this case, was the introduction not spoken by referring to the time and place, as it is in other suttas, with phrases such as 'Thus have I heard, at one time the Blessed One,' etc.?"
Ở đây có câu hỏi: “Tại sao ở đây không nói về thời gian và địa điểm của sự việc khởi nguyên như trong các kinh khác, chẳng hạn như ‘Như vầy tôi nghe, một thời Đức Thế Tôn’?”
Apare tāva āhu – na pana therena bhāsitattā.
Some indeed say: "Because it was not spoken by the Elder."
Một số vị khác nói: “Vì đây không phải do Trưởng lão (Ānanda) thuyết giảng.”
Idañhi nidānaṃ na āyasmatā ānandena paṭhamaṃ bhāsitaṃ khujjuttarāya pana bhagavatā upāsikāsu bahussutabhāvena etadagge ṭhapitāya sekkhappaṭisambhidāppattāya ariyasāvikāya sāmāvatippamukhānaṃ pañcannaṃ itthisatānaṃ paṭhamaṃ bhāsitaṃ.
This introduction was not spoken first by Venerable Ānanda, but by Khujjuttarā, a noble female disciple who had attained the sekkhapaṭisambhidā, placed by the Blessed One as foremost among female lay disciples for her great learning, who spoke it first to five hundred women led by Sāmāvatī.
Quả thật, sự việc khởi nguyên này không phải do Tôn giả Ānanda thuyết giảng đầu tiên, mà do Khujjuttarā, một nữ cư sĩ được Đức Thế Tôn xếp vào hàng tối thượng trong số các nữ cư sĩ đa văn, đã đạt được các tuệ phân tích của bậc Hữu học (sekkhappaṭisambhidā), thuyết giảng lần đầu tiên cho năm trăm nữ nhân do Sāmāvatī đứng đầu.
147
Tatrāyaṃ anupubbīkathā – ito kira kappasatasahassamatthake padumuttaro nāma sammāsambuddho loke uppajjitvā pavattitavaradhammacakko haṃsavatiyaṃ viharati.
Here is a successive narrative: It is said that one hundred thousand aeons ago, a Perfectly Self-Enlightened Buddha named Padumuttara arose in the world and, having set rolling the supreme Wheel of Dhamma, resided in Haṃsavatī.
Ở đây, có một câu chuyện tuần tự như sau: Cách đây một trăm ngàn đại kiếp, một vị Chánh Đẳng Giác tên là Padumuttara đã xuất hiện trên thế gian, chuyển bánh xe Pháp tối thượng và trú tại Haṃsavatī.
Athekadivasaṃ haṃsavatiyaṃ ekā kuladhītā satthu dhammadesanaṃ sotuṃ gacchantīhi upāsikāhi saddhiṃ ārāmaṃ gatā.
Then, one day in Haṃsavatī, a noble daughter went to the monastery with other female lay disciples to listen to the Teacher's Dhamma discourse.
Một ngày nọ, một thiếu nữ dòng dõi quý tộc ở Haṃsavatī đã cùng với các nữ cư sĩ đi đến tịnh xá để nghe Đức Bổn Sư thuyết pháp.
Satthāraṃ ekaṃ upāsikaṃ bahussutānaṃ etadagge ṭhapentaṃ disvā adhikāraṃ katvā taṃ ṭhānantaraṃ patthesi.
Seeing the Teacher place a certain female lay disciple as foremost among the greatly learned, she made a resolution and aspired to that position.
Khi thấy Đức Bổn Sư đặt một nữ cư sĩ vào hàng tối thượng trong số những người đa văn, cô đã phát nguyện và cầu mong đạt được địa vị đó.
Satthāpi naṃ byākāsi ‘‘anāgate gotamassa nāma sammāsambuddhassa sāvikānaṃ upāsikānaṃ bahussutānaṃ aggā bhavissatī’’ti.
The Teacher also prophesied about her: "In the future, she will be the foremost among the greatly learned female lay disciples of the Perfectly Self-Enlightened Buddha named Gotama."
Đức Bổn Sư cũng đã thọ ký cho cô rằng: “Trong tương lai, cô sẽ là bậc tối thượng trong số các nữ cư sĩ đa văn, đệ tử của Đức Chánh Đẳng Giác Gotama.”
Tassā yāvajīvaṃ kusalaṃ katvā devaloke nibbattitvā puna manussesūti evaṃ devamanussesu saṃsarantiyā kappasatasahassaṃ atikkantaṃ.
Having performed wholesome deeds throughout her life, and after being reborn in the deva realm and then among humans, thus wandering through deva and human existences, one hundred thousand aeons passed for her.
Sau khi tạo các thiện nghiệp suốt đời, cô tái sinh vào cõi trời, rồi lại vào cõi người. Cứ thế, cô luân hồi trong cõi trời và cõi người, trải qua một trăm ngàn đại kiếp.
Atha imasmiṃ bhaddakappe amhākaṃ bhagavato kāle sā devalokato cavitvā ghosakaseṭṭhissa gehe dāsiyā kucchismiṃ paṭisandhiṃ gaṇhi, uttarātissā nāmaṃ akaṃsu.
Then, in this auspicious aeon, during the time of our Blessed One, she passed away from the deva realm and was reborn in the womb of a slave woman in the house of the wealthy Ghosaka; they named her Uttarā.
Sau đó, trong kiếp hiền này, vào thời Đức Thế Tôn của chúng ta, cô đã chuyển sinh từ cõi trời và tái sinh vào bụng của một nữ tỳ trong nhà trưởng giả Ghosaka, và họ đặt tên cho cô là Uttarā.
Sā jātakāle khujjā ahosīti khujjuttarātveva paññāyittha.
Since she was hunchbacked at birth, she became known as Khujjuttarā.
Vì cô bị gù lưng khi sinh ra, nên cô được biết đến với tên Khujjuttarā (Uttarā gù).
Sā aparabhāge ghosakaseṭṭhinā rañño utenassa sāmāvatiyā dinnakāle tassā paricārikabhāvena dinnā rañño utenassa antepure vasati.
Later, when Ghosaka the wealthy man gave Sāmāvatī to King Utena, Khujjuttarā was given as her attendant and lived in King Utena's inner palace.
Sau này, khi trưởng giả Ghosaka gả Sāmāvatī cho vua Utena, Khujjuttarā được trao cho Sāmāvatī làm thị nữ và sống trong nội cung của vua Utena.
148
Tena ca samayena kosambiyaṃ ghosakaseṭṭhikukkuṭaseṭṭhipāvārikaseṭṭhino bhagavantaṃ uddissa tayo vihāre kāretvā janapadacārikaṃ carante tathāgate kosambinagaraṃ sampatte buddhappamukhassa bhikkhusaṅghassa vihāre niyyādetvā mahādānāni pavattesuṃ, māsamattaṃ atikkami.
At that time, the wealthy Ghosaka, Kukkuṭa, and Pāvārika in Kosambī, having built three monasteries for the Blessed One, and with the Tathāgata having arrived in the city of Kosambī while on his tour of the countryside, dedicated the monasteries to the Saṅgha led by the Buddha and offered great alms, which continued for a month.
Vào thời đó, tại Kosambī, ba vị trưởng giả Ghosaka, Kukkuṭa và Pāvārika đã xây ba tịnh xá dâng lên Đức Thế Tôn. Khi Đức Như Lai đang du hành các vùng quê đến thành Kosambī, họ đã dâng các tịnh xá cho Tăng đoàn do Đức Phật đứng đầu và tổ chức các lễ cúng dường lớn, kéo dài hơn một tháng.
Atha nesaṃ etadahosi – ‘‘buddhā nāma sabbalokānukampakā, aññesampi okāsaṃ dassāmā’’ti kosambinagaravāsinopi janassa okāsaṃ akaṃsu.
Then it occurred to them: "Buddhas are compassionate towards all beings; we should give others an opportunity as well," and so they gave an opportunity to the people dwelling in the city of Kosambī.
Sau đó, họ nghĩ: “Các Đức Phật là bậc từ bi đối với tất cả chúng sinh, chúng ta hãy tạo cơ hội cho những người khác nữa.” Vì vậy, họ đã tạo cơ hội cho người dân thành Kosambī.
Tato paṭṭhāya nāgarā vīthisabhāgena gaṇasabhāgena mahādānaṃ denti.
From that time onwards, the citizens offered great alms, either by street sections or by groups.
Từ đó về sau, cư dân thành phố đã cúng dường đại lễ theo từng con đường và từng nhóm.
Athekadivasaṃ satthā bhikkhusaṅghaparivuto mālākārajeṭṭhakassa gehe nisīdi.
Then, one day, the Teacher, surrounded by the assembly of bhikkhus, sat in the house of the chief garland-maker.
Một ngày nọ, Đức Bổn Sư cùng với Tăng đoàn đã ngồi tại nhà của vị trưởng lão thợ làm vòng hoa.
Tasmiṃ khaṇe khujjuttarā sāmāvatiyā pupphāni gahetuṃ aṭṭha kahāpaṇe ādāya taṃ gehaṃ agamāsi.
At that moment, Khujjuttarā, taking eight kahāpaṇas to fetch flowers for Sāmāvatī, went to that house.
Vào lúc đó, Khujjuttarā mang theo tám đồng tiền (kahāpaṇa) để mua hoa cho Sāmāvatī và đi đến nhà đó.
Mālākārajeṭṭhako taṃ disvā ‘‘amma uttare, ajja tuyhaṃ pupphāni dātuṃ khaṇo natthi, ahaṃ buddhappamukhaṃ bhikkhusaṅghaṃ parivisāmi, tvampi parivesanāya sahāyikā hohi, evaṃ ito paresaṃ veyyāvaccakaraṇato muccissasī’’ti āha.
The chief garland-maker, seeing her, said, "My dear Uttarā, today there is no time to give you flowers. I am serving the assembly of bhikkhus led by the Buddha; you should also assist in the serving. In this way, you will be freed from performing service for others."
Vị trưởng lão thợ làm vòng hoa thấy cô liền nói: “Này con Uttarā, hôm nay con không có thời gian để hái hoa, ta đang cúng dường Tăng đoàn do Đức Phật đứng đầu, con hãy giúp ta phục vụ. Như vậy, con sẽ thoát khỏi việc phải làm công việc cho người khác.”
Tato khujjuttarā buddhānaṃ bhattagge veyyāvaccaṃ akāsi.
Then Khujjuttarā performed service at the Buddha's meal hall.
Sau đó, Khujjuttarā đã làm công việc phục vụ tại phòng ăn của Đức Phật.
Sā satthārā upanisinnakathāvasena kathitaṃ sabbameva dhammaṃ uggaṇhi, anumodanaṃ pana sutvā sotāpattiphale patiṭṭhāsi.
She understood all the Dhamma taught by the Teacher in the context of the conversation held nearby and, having listened to the anumodanā, she became established in the fruit of Stream-entry.
Cô đã học thuộc tất cả các pháp mà Đức Bổn Sư đã thuyết giảng trong cuộc trò chuyện thân mật, và sau khi nghe lời tùy hỷ, cô đã an trú vào quả vị Nhập Lưu (Sotāpattiphala).
149
Sā aññesu divasesu cattārova kahāpaṇe datvā pupphāni gahetvā gacchati, tasmiṃ pana divase diṭṭhasaccabhāvena parasantake cittaṃ anuppādetvā aṭṭhapi kahāpaṇe datvā pacchiṃ pūretvā pupphāni gahetvā sāmāvatiyā santikaṃ agamāsi.
On other days, she would take four kahāpaṇas, get flowers, and go. But on that day, due to having realized the truth, she did not allow her mind to be on another's property, and having given all eight kahāpaṇas, she filled her basket with flowers and went to Sāmāvatī.
Những ngày khác, cô chỉ trả bốn đồng tiền để lấy hoa rồi đi, nhưng vào ngày hôm đó, vì đã chứng ngộ chân lý, cô không khởi tâm tham lam đối với tài sản của người khác, nên đã trả đủ tám đồng tiền, làm đầy giỏ hoa và mang đến cho Sāmāvatī.
Atha naṃ sā pucchi ‘‘amma uttare, tvaṃ aññesu divasesu na bahūni pupphāni āharasi, ajja pana bahukāni, kiṃ no rājā uttaritaraṃ pasanno’’ti?
Then Sāmāvatī asked her, "My dear Uttarā, on other days you don't bring many flowers, but today there are many. Is the king perhaps exceedingly pleased with us?"
Lúc đó, Sāmāvatī hỏi cô: “Này Uttarā, những ngày khác con không mang nhiều hoa về, nhưng hôm nay lại rất nhiều. Có phải vua đã hài lòng với chúng ta hơn không?”
Sā musā vattuṃ abhabbatāya atīte attanā kataṃ anigūhitvā sabbaṃ kathesi.
Being incapable of telling a lie, she related everything that she had done in the past, without concealing it.
Vì không thể nói dối, cô đã kể lại tất cả những gì mình đã làm trong quá khứ mà không giấu giếm.
Atha ‘‘kasmā ajja bahūni āharasī’’ti ca vuttā ‘‘ajjāhaṃ sammāsambuddhassa dhammaṃ sutvā amataṃ sacchākāsiṃ, tasmā tumhe na vañcemī’’ti āha.
Then, when asked, "Why did you bring so many today?" she said, "Today I heard the Dhamma of the Perfectly Self-Enlightened One and realized the Deathless; therefore, I will not deceive you."
Khi được hỏi: “Tại sao hôm nay con mang nhiều như vậy?”, cô trả lời: “Hôm nay tôi đã nghe pháp của Đức Chánh Đẳng Giác và đã chứng ngộ bất tử (amataṃ). Vì vậy, tôi không lừa dối các cô.”
Taṃ sutvā ‘‘are duṭṭhadāsi, ettakaṃ kālaṃ tayā gahite kahāpaṇe dehī’’ti atajjetvā pubbahetunā codiyamānā ‘‘amma, tayā pītaṃ amataṃ, amhepi pāyehī’’ti vatvā ‘‘tena hi maṃ nhāpehī’’ti vutte soḷasahi gandhodakaghaṭehi nhāpetvā dve maṭṭhasāṭake dāpesi.
Hearing that, Sāmāvatī, instead of scolding her by saying, "Hey, wicked slave, give back the kahāpaṇas you have taken all this time!", but being urged by a previous cause, said, "Mother, you have drunk the Deathless, let us also drink it." When Khujjuttarā said, "Then bathe me," Sāmāvatī had her bathed with sixteen jars of scented water and gave her two clean garments.
Nghe vậy, Sāmāvatī không mắng rằng: “Này con tỳ nữ hư đốn, hãy trả lại những đồng tiền mà con đã lấy bấy lâu nay!” mà thay vào đó, như bị thúc đẩy bởi nhân duyên quá khứ, Sāmāvatī nói: “Này mẹ, mẹ đã uống cam lồ, xin hãy cho chúng con uống nữa.” Khi Khujjuttarā nói: “Vậy thì hãy tắm rửa cho tôi,” Sāmāvatī đã cho người tắm rửa cho cô bằng mười sáu bình nước thơm và ban cho cô hai bộ y phục sạch sẽ.
Sā ekaṃ nivāsetvā ekaṃ pārupitvā āsanaṃ paññāpetvā āsane nisīditvā vicitrabījaniṃ ādāya nīcāsanesu nisinnāni pañca mātugāmasatāni āmantetvā sekhappaṭisambhidāsu ṭhatvā satthārā desitaniyāmeneva tāsaṃ dhammaṃ desesi.
Having put on one and wrapped herself in the other, she arranged a seat, sat on it, took an ornate fan, called the five hundred women who were seated on lower seats, and, established in the sekkhappaṭisambhidā, taught them the Dhamma just as it had been taught by the Teacher.
Khujjuttarā mặc một bộ, khoác một bộ, rồi sắp đặt chỗ ngồi, ngồi xuống đó, cầm quạt trang trí, gọi năm trăm nữ nhân đang ngồi ở những chỗ thấp hơn, và đứng trên địa vị của bậc Hữu học với các tuệ phân tích (sekkhappaṭisambhidā), cô đã thuyết pháp cho họ theo đúng cách mà Đức Bổn Sư đã thuyết giảng.
Desanāvasāne tā sabbā sotāpattiphale patiṭṭhahiṃsu.
At the end of the discourse, all of them became established in the fruit of Stream-entry.
Khi bài thuyết pháp kết thúc, tất cả họ đều an trú vào quả vị Nhập Lưu (Sotāpattiphala).
Tā sabbāpi khujjuttaraṃ vanditvā ‘‘amma, ajja paṭṭhāya tvaṃ kiliṭṭhakammaṃ mā kari, amhākaṃ mātuṭṭhāne ācariyaṭṭhāne ca patiṭṭhāhī’’ti garuṭṭhāne ṭhapayiṃsu.
All of them paid homage to Khujjuttarā and placed her in a position of respect, saying, "Mother, from today onwards, do not perform defiling work; be established in the position of our mother and teacher."
Tất cả họ đều đảnh lễ Khujjuttarā và nói: “Này mẹ, từ hôm nay trở đi, mẹ đừng làm những công việc thấp hèn nữa, xin mẹ hãy an trú ở địa vị của mẹ chúng con và địa vị của bậc thầy chúng con.” Họ đã đặt cô vào địa vị cao quý.
150
Kasmā panesā dāsī hutvā nibbattāti?
Why was she reborn as a slave woman?
Tại sao cô ấy lại tái sinh làm một nữ tỳ?
Sā kira kassapasammāsambuddhakāle bārāṇasiyaṃ seṭṭhidhītā hutvā nibbattā.
It is said that in the time of Kassapa the Perfectly Self-Enlightened One, she was reborn as the daughter of a wealthy man in Bārāṇasī.
Được biết, vào thời Đức Chánh Đẳng Giác Kassapa, cô đã tái sinh làm con gái của một vị trưởng giả ở Bārāṇasī.
Ekāya khīṇāsavattheriyā upaṭṭhākakulaṃ gatāya ‘‘etaṃ me ayye, pasādhanapeḷikaṃ dethā’’ti veyyāvaccaṃ kāresi.
When she went to the house of a female arahant for service, she asked, "Venerable Lady, please give me this ornament box."
Khi một vị Tỳ khưu ni A-la-hán (khīṇāsavattherī) đến nhà của một gia đình hộ độ, cô đã sai bảo: “Này sư bà, xin hãy đưa cái hộp trang sức này cho con.”
Therīpi ‘‘adentiyā mayi āghātaṃ uppādetvā niraye nibbattissati, dentiyā paresaṃ dāsī hutvā nibbattissati, nirayasantāpato dāsibhāvo seyyo’’ti anuddayaṃ paṭicca tassā vacanaṃ akāsi.
The Therī, out of compassion for her, thought: "If I do not give, she will generate ill-will towards me and be reborn in hell. If I give, she will be reborn as a slave to others. Slavery is better than the suffering of hell." So, she acted according to the householder's word.
Vị Trưởng lão Ni cũng vì lòng thương xót cô gái ấy mà nói rằng: “Nếu ta không cho, cô ấy sẽ sanh lòng oán hận ta mà đọa vào địa ngục. Nếu ta cho, cô ấy sẽ làm nô tỳ cho người khác. Làm nô tỳ vẫn tốt hơn là chịu khổ địa ngục.”
Sā tena kammena pañca jātisatāni paresaṃ dāsīyeva hutvā nibbatti.
Because of that action, she was reborn as a slave to others for five hundred existences.
Nàng Khujjuttarā ấy, do nghiệp ấy, đã sinh làm người hầu gái của người khác trong suốt năm trăm kiếp.
151
Kasmā pana khujjā ahosi?
Why was she hunchbacked?
Vì sao nàng lại bị gù lưng?
Anuppanne kira buddhe ayaṃ bārāṇasirañño gehe vasantī ekaṃ rājakulūpakaṃ paccekabuddhaṃ thokaṃ khujjadhātukaṃ disvā attanā sahavāsīnaṃ mātugāmānaṃ purato parihāsaṃ karontī yathāvajjaṃ keḷivasena khujjākāraṃ dassesi, tasmā khujjā hutvā nibbatti.
It is said that before the Buddha appeared, while living in the palace of the King of Bārāṇasī, she saw a Paccekabuddha who frequented the royal household and was slightly hunchbacked. She then, in jest, mimicked the hunchbacked posture before her female companions, as if finding fault. Therefore, she was reborn hunchbacked.
Kể rằng, khi Đức Phật chưa xuất hiện, nàng này sống trong cung vua Bārāṇasī, thấy một vị Độc Giác Phật thường đến cung vua, thân hình hơi gù lưng, nàng đã trêu chọc trước mặt các nữ nhân cùng sống với mình, giả vờ làm dáng gù lưng một cách đáng trách, vì vậy nàng đã sinh ra với thân hình gù lưng.
152
Kiṃ pana katvā paññavantī jātāti?
What did she do to become wise?
Nàng đã làm gì mà trở nên có trí tuệ?
Anuppanne kira buddhe ayaṃ bārāṇasirañño gehe vasantī aṭṭha paccekabuddhe rājagehato uṇhapāyāsassa pūrite patte parivattitvā parivattitvā gaṇhante disvā attano santakāni aṭṭha dantavalayāni ‘‘idha ṭhapetvā gaṇhathā’’ti adāsi.
It is said that before the Buddha appeared, while living in the palace of the King of Bārāṇasī, she saw eight Paccekabuddhas taking bowls filled with warm milk-rice from the palace, turning them over and over. Seeing this, she gave them her own eight ivory bracelets, saying, "Please place them here and take the bowls."
Kể rằng, khi Đức Phật chưa xuất hiện, nàng này sống trong cung vua Bārāṇasī, thấy tám vị Độc Giác Phật đang nhận những bát cháo nóng được đổ đầy từ cung vua, xoay đi xoay lại, nàng đã dâng tám chiếc vòng ngà của mình và nói: “Xin quý Ngài hãy đặt (bát) ở đây rồi nhận lấy.”
Te tathā katvā olokesuṃ.
They did so and looked at her.
Các vị ấy đã làm như vậy và nhìn nàng.
‘‘Tumhākaññeva tāni pariccattāni, gahetvā gacchathā’’ti āha.
She said, "They are offered to you; please take them and go."
Nàng nói: “Chúng đã được dâng cúng cho quý Ngài rồi, xin quý Ngài hãy nhận lấy và ra đi.”
Te nandamūlakapabbhāraṃ agamaṃsu.
They went to the Nandamūlaka Cave.
Các vị ấy đã đi đến hang Nandamūlaka.
Ajjāpi tāni valayāni arogāneva.
Even today, those bracelets remain undamaged.
Cho đến ngày nay, những chiếc vòng ấy vẫn còn nguyên vẹn.
Sā tassa nissandena paññavantī jātā.
Due to the result of that action, she became wise.
Do kết quả của việc làm ấy, nàng đã trở thành người có trí tuệ.
153
Atha naṃ sāmāvatippamukhāni pañca itthisatāni ‘‘amma, tvaṃ divase divase satthu santikaṃ gantvā bhagavatā desitaṃ dhammaṃ sutvā amhākaṃ desehī’’ti vadiṃsu.
Then five hundred women, with Sāmāvatī at their head, said to her, "Mother, go to the Teacher every day, listen to the Dhamma taught by the Blessed One, and teach it to us."
Sau đó, năm trăm nữ nhân do Sāmāvatī dẫn đầu đã nói với nàng: “Mẹ ơi, mỗi ngày mẹ hãy đến chỗ Đức Bổn Sư, nghe Pháp do Thế Tôn thuyết giảng, rồi thuyết giảng lại cho chúng con.”
Sā tathā karontī aparabhāge tipiṭakadharā jātā.
As she did so, she later became proficient in the Tipiṭaka.
Nàng đã làm như vậy và sau này trở thành người thông thạo Tam Tạng.
Tasmā naṃ satthā – ‘‘etadaggaṃ, bhikkhave, mama sāvikānaṃ bahussutānaṃ upāsikānaṃ yadidaṃ khujjuttarā’’ti etadagge ṭhapesi.
Therefore, the Teacher placed her foremost among his female lay disciples, saying, "Among my female lay disciples who are most learned, Bhikkhus, Khujjuttarā is the foremost."
Vì vậy, Đức Bổn Sư đã đặt nàng vào hàng đệ nhất với lời dạy: “Này các Tỳ-khưu, trong số các nữ cư sĩ đệ tử của Ta, Khujjuttarā là bậc đệ nhất về đa văn (hiểu biết rộng).”
Iti upāsikāsu bahussutabhāvena satthārā etadagge ṭhapitā paṭisambhidāppattā khujjuttarā ariyasāvikā satthari kosambiyaṃ viharante kālena kālaṃ satthu santikaṃ gantvā dhammaṃ sutvā antepuraṃ gantvā sāmāvatippamukhānaṃ pañcannaṃ itthisatānaṃ ariyasāvikānaṃ satthārā desitaniyāmena yathāsutaṃ dhammaṃ kathentī attānaṃ parimocetvā satthu santike sutabhāvaṃ pakāsentī ‘‘vuttañhetaṃ bhagavatā vuttamarahatāti me suta’’nti nidānaṃ āropesi.
Thus, the noble female disciple Khujjuttarā, who was placed foremost by the Teacher among female lay disciples for her great learning and had attained the analytical knowledges (Paṭisambhidā), would go to the Teacher from time to time when he was residing in Kosambī, listen to the Dhamma, return to the inner palace, and teach the Dhamma as she had heard it to the five hundred noble female lay disciples, with Sāmāvatī at their head, according to the method taught by the Teacher. To free herself (from self-assertion) and to declare that she had heard it from the Teacher, she used the introduction: "Thus has it been said by the Blessed One, thus has it been said by the Arahant, so I have heard."
Như vậy, nữ đệ tử thánh Khujjuttarā, người được Đức Bổn Sư đặt vào hàng đệ nhất về đa văn trong số các nữ cư sĩ, và đã chứng đắc Tứ Tuệ Phân Tích (Paṭisambhidā), khi Đức Bổn Sư đang trú tại Kosambī, thỉnh thoảng đến chỗ Đức Bổn Sư, nghe Pháp, rồi trở về cung điện, thuyết giảng Pháp đã nghe theo phương pháp mà Đức Bổn Sư đã giảng cho năm trăm nữ đệ tử thánh do Sāmāvatī dẫn đầu, tự giải thoát mình và bày tỏ rằng mình đã nghe Pháp từ Đức Bổn Sư, đã đưa ra lời dẫn nhập: “Điều này đã được Thế Tôn nói, đã được bậc A-la-hán nói, tôi đã nghe như vậy.”
154
Yasmā pana tasmiṃyeva nagare bhagavato sammukhā sutvā tadaheva tāya tāsaṃ bhāsitaṃ, tasmā ‘‘ekaṃ samayaṃ bhagavā kosambiyaṃ viharatī’’ti kāladesaṃ apadisituṃ payojanasambhavova natthi supākaṭabhāvato.
Since it was spoken by her to them on that very day after she had heard it directly from the Blessed One in that same city, there is no need to indicate the time and place by saying, "At one time the Blessed One was dwelling in Kosambī," because it is so well known.
Tuy nhiên, vì việc thuyết giảng của nàng cho các nữ nhân ấy đã được nghe trực tiếp từ Thế Tôn tại chính thành phố ấy và ngay trong ngày ấy, nên không cần thiết phải chỉ định thời gian và địa điểm như “Một thời Thế Tôn trú tại Kosambī” vì điều đó đã quá rõ ràng.
Bhikkhuniyo cassā santike imāni suttāni gaṇhiṃsu.
And the bhikkhunīs learned these Suttas from her.
Các Tỳ-khưu-ni cũng đã học những bài kinh này từ nàng.
Evaṃ paramparāya bhikkhūsupi tāya āropitaṃ nidānaṃ pākaṭaṃ ahosi.
Thus, through successive transmission, the introduction she inserted became known even among the bhikkhus.
Như vậy, lời dẫn nhập do nàng đưa ra cũng đã trở nên rõ ràng trong hàng các Tỳ-khưu qua truyền thống.
Atha āyasmā ānando tathāgatassa parinibbānato aparabhāge sattapaṇṇiguhāyaṃ ajātasattunā kārāpite saddhammamaṇḍape mahākassapappamukhassa vasīgaṇassa majjhe nisīditvā dhammaṃ saṅgāyanto imesaṃ suttānaṃ nidānassa dveḷhakaṃ pariharanto tāya āropitaniyāmeneva nidānaṃ āropesīti.
Then, after the Tathāgata's Parinibbāna, Venerable Ānanda, seated in the Saddhamma Maṇḍapa built by Ajātasattu in the Sattapaṇṇī Cave, amidst the assembly of those who had mastered (the Dhamma), led by Mahākassapa, recited the Dhamma. He avoided any doubt regarding the introduction of these Suttas and stated the introduction in the very manner she had inserted it.
Sau đó, Tôn giả Ānanda, sau khi Đức Như Lai nhập Niết-bàn, khi đang ngồi giữa hội chúng các bậc A-la-hán do Đại Ca-diếp dẫn đầu tại giảng đường Pháp bảo do vua Ajātasattu xây dựng trong hang Saptaparṇī, và đang kiết tập Pháp, đã tránh sự phân vân về lời dẫn nhập của những bài kinh này, và đã đưa ra lời dẫn nhập theo đúng phương pháp mà nàng đã đưa ra.
155
Keci panettha bahuppakāre papañcenti.
Some here elaborate on many kinds of distinctions.
Một số người ở đây đã trình bày nhiều cách khác nhau.
Kiṃ tehi?
What is the use of them?
Chúng có ích gì?
Apica nānānayehi saṅgītikārā dhammavinayaṃ saṅgāyiṃsu.
Moreover, the compilers of the Councils recited the Dhamma and Vinaya in various ways.
Hơn nữa, các bậc kiết tập đã kiết tập Pháp và Luật theo nhiều phương pháp khác nhau.
Anubuddhā hi dhammasaṅgāhakamahātherā, te sammadeva dhammavinayassa saṅgāyanākāraṃ jānantā katthaci ‘‘evaṃ me suta’’ntiādinā, katthaci ‘‘tena samayenā’’tiādinā, katthaci gāthābandhavasena nidānaṃ ṭhapentā, katthaci sabbena sabbaṃ nidānaṃ aṭṭhapentā vaggasaṅgahādivasena dhammavinayaṃ saṅgāyiṃsu.
Indeed, the Mahātheras who compiled the Dhamma, being fully enlightened, knew the proper way to compile the Dhamma and Vinaya. They sometimes placed the introduction with "Thus have I heard," sometimes with "At one time," sometimes in verse form, and sometimes without any introduction at all, compiling the Dhamma and Vinaya by grouping them into sections (vagga) and so on.
Các vị Đại Trưởng lão kiết tập Pháp là những bậc đã giác ngộ, các vị ấy biết rõ cách thức kiết tập Pháp và Luật một cách đúng đắn, đôi khi đặt lời dẫn nhập bằng cách nói “Tôi đã nghe như vầy” (Evaṃ me sutaṃ) hoặc “Một thời” (Tena samayena), đôi khi bằng hình thức kệ tụng, và đôi khi hoàn toàn không đặt lời dẫn nhập, mà kiết tập Pháp và Luật theo cách tập hợp thành các phẩm (vagga) và các loại khác.
Tattha idha vuttañhetantiādinā nidānaṃ ṭhapetvā saṅgāyiṃsu, kiñci suttageyyādivasena navaṅgamidaṃ buddhavacanaṃ.
Here, they compiled these Suttas by placing the introduction with "Thus has it been said" and so on, for this Buddha-word is ninefold, classified as Sutta, Geyya, etc.
Ở đây, các vị đã đặt lời dẫn nhập bằng cách nói “Điều này đã được nói” (Vuttañhetaṃ) và kiết tập, và lời Phật dạy này có chín chi phần như kinh, kệ tụng, v.v.
Yathā cetaṃ, evaṃ sabbesampi sammāsambuddhānaṃ.
And as it is for this (Buddha), so it is for all Perfectly Self-Enlightened Ones.
Và như thế này, thì cũng là của tất cả các bậc Chánh Đẳng Giác.
Vuttañhetaṃ ‘‘appakañca nesaṃ ahosi suttaṃ geyya’’ntiādi.
It has been said, "For them, the Sutta and Geyya were few," and so on.
Điều này đã được nói: “Kinh và kệ tụng của các Ngài thì ít.”
Tattha itivuttakaṅgassa aññaṃ kiñci na paññāyati tabbhāvanimittaṃ ṭhapetvā ‘‘vuttañhetaṃ…pe… me suta’’nti idaṃ vacanaṃ.
In that, for the Itivuttaka section, nothing else is known as its distinctive mark except this statement, "Thus has it been said... so I have heard."
Trong đó, đối với chi phần Itivuttaka, không có điều gì khác được tìm thấy ngoài lời nói “Điều này đã được nói… tôi đã nghe như vầy” (vuttañhetaṃ…pe… me sutaṃ) làm dấu hiệu cho sự tồn tại của nó.
Tenāhu aṭṭhakathācariyā ‘‘vuttañhetaṃ bhagavatāti ādinayappavattā dvādasuttarasatasuttantā itivuttaka’’nti.
Therefore, the Aṭṭhakathā teachers have said, "The one hundred twelve Suttas beginning with 'Thus has it been said by the Blessed One' are the Itivuttaka."
Vì vậy, các vị chú giải sư đã nói: “Một trăm mười hai bài kinh bắt đầu bằng ‘Điều này đã được Thế Tôn nói’ (Vuttañhetaṃ Bhagavatā) là Itivuttaka.”
Tasmā satthu adhippāyaṃ jānantehi dhammasaṅgāhakehi ariyasāvikāya vā imesaṃ suttānaṃ itivuttakaṅgabhāvañāpanatthaṃ imināva nayena nidānaṃ ṭhapitanti veditabbaṃ.
Thus, it should be understood that the compilers of the Dhamma, knowing the Teacher's intention, or the noble female disciple, placed the introduction in this very manner to indicate that these Suttas belong to the Itivuttaka section.
Do đó, cần phải hiểu rằng các vị kiết tập Pháp, những người hiểu ý Đức Bổn Sư, hoặc nữ đệ tử thánh, đã đặt lời dẫn nhập theo phương pháp này để chỉ rõ rằng những bài kinh này thuộc chi phần Itivuttaka.
156
Kimatthaṃ pana dhammavinayasaṅgahe kayiramāne nidānavacanaṃ?
For what purpose is the introductory statement made when compiling the Dhamma and Vinaya?
Tuy nhiên, khi kiết tập Pháp và Luật, tại sao lại có lời dẫn nhập?
Nanu bhagavatā bhāsitavacanasseva saṅgaho kātabboti?
Should not only the words spoken by the Blessed One be compiled?
Há chẳng phải chỉ nên kiết tập những lời do Đức Thế Tôn thuyết giảng sao?
Vuccate – desanāya ṭhitiasammosasaddheyyabhāvasampādanatthaṃ.
It is said: to ensure the stability, infallibility, and credibility of the teaching.
Xin được nói rằng – để đảm bảo sự trường tồn, không sai lạc và đáng tin cậy của giáo pháp.
Kāladesadesakaparisāpadesehi upanibandhitvā ṭhapitā hi desanā ciraṭṭhitikā hoti asammosadhammā saddheyyā ca desakālakattuhetunimittehi upanibaddho viya vohāravinicchayo.
Indeed, a teaching established by indicating the time, place, speaker, and audience remains long-lasting, infallible, and credible, just like a judicial decision established by specifying the speaker, time, agent, cause, and motive.
Thật vậy, giáo pháp được trình bày và lưu giữ bằng cách gắn liền với thời gian, địa điểm, người thuyết giảng và hội chúng sẽ trường tồn lâu dài, không bị sai lạc và đáng tin cậy, giống như một phán quyết pháp lý được gắn liền với người thuyết giảng, thời gian, người hành động, nguyên nhân và dấu hiệu.
Teneva ca āyasmatā mahākassapena brahmajālamūlapariyāyasuttādīnaṃ desādipucchāsu katāsu tāsaṃ vissajjanaṃ karontena dhammabhaṇḍāgārikena ‘‘evaṃ me suta’’ntiādinā nidānaṃ bhāsitaṃ.
It was for this reason that when Venerable Mahākassapa questioned the time and place of the Brahmajāla Sutta, Mūlapariyāya Sutta, etc., Venerable Ānanda, the Treasurer of the Dhamma, responded by stating the introduction with "Thus have I heard," and so on.
Chính vì lẽ đó, khi Tôn giả Mahākassapa hỏi về địa điểm, v.v., của kinh Brahmajāla và Mūlapariyāya, Tôn giả Ānanda, người giữ kho tàng Pháp, đã trả lời bằng cách thuyết giảng lời dẫn nhập “Tôi đã nghe như vầy” (Evaṃ me sutaṃ), v.v.
Idha pana desakālassa aggahaṇe kāraṇaṃ vuttameva.
But here, the reason for not mentioning the time and place has already been stated.
Tuy nhiên, ở đây, lý do không đề cập đến thời gian thuyết giảng đã được nói đến.
157
Apica satthu sampattippakāsanatthaṃ nidānavacanaṃ.
Furthermore, the introductory statement is for the manifestation of the Teacher's accomplishments.
Hơn nữa, lời dẫn nhập còn để bày tỏ sự viên mãn của Đức Bổn Sư.
Tathāgatassa hi bhagavato pubbaracanānumānāgamatakkābhāvato sammāsambuddhabhāvasiddhi.
For the Tathāgata, the Blessed One, attained perfect enlightenment (sammāsambuddhabhāva) due to the absence of prior arrangement, inference, tradition, or reasoning.
Thật vậy, sự thành tựu của Đức Thế Tôn là bậc Chánh Đẳng Giác là do Ngài không có sự sắp đặt trước, suy đoán, truyền thống hay suy luận.
Na hi sammāsambuddhassa pubbaracanādīhi attho atthi sabbattha appaṭihatañāṇācāratāya ekappamāṇattā ca ñeyyadhammesu.
Indeed, a Perfectly Self-Enlightened One has no need for prior arrangement and so forth, as his knowledge and conduct are unhindered in all respects, and his measure is one in all knowable phenomena.
Bởi vì đối với một bậc Chánh Đẳng Giác, không cần đến sự sắp đặt trước, v.v., vì Ngài có trí tuệ và hành vi không bị cản trở ở mọi nơi, và có cùng một thước đo đối với các pháp cần được biết.
Tathā ācariyamuṭṭhidhammamacchariyasāsanasāvakānurāgābhāvato khīṇāsavabhāvasiddhi.
Similarly, the attainment of being one whose defilements are destroyed (khīṇāsavabhāva) is due to the absence of the teacher's fist (ācariyamuṭṭhi), stinginess regarding the Dhamma, and attachment to disciples in the Dispensation.
Tương tự, sự thành tựu của bậc A-la-hán là do không có sự che giấu giáo pháp của thầy, không có sự keo kiệt đối với giáo pháp, và không có sự bất hòa với các đệ tử trong giáo pháp.
Na hi sabbaso khīṇāsavassa te sambhavantīti suvisuddhassa parānuggahapavatti.
Indeed, these do not arise in one whose defilements are completely destroyed, thus demonstrating the pure inclination to benefit others.
Thật vậy, những điều ấy không thể có ở một bậc A-la-hán đã đoạn tận hoàn toàn các lậu hoặc, do đó, sự hành động vì lợi ích người khác là hoàn toàn thanh tịnh.
Evaṃ desakasaṃkilesabhūtānaṃ diṭṭhisīlasampadādūsakānaṃ avijjātaṇhānaṃ accantābhāvasaṃsūcakehi ñāṇasampadāpahānasampadābhibyañjakehi ca sambuddhavisuddhabhāvehi purimavesārajjadvayasiddhi, tato ca antarāyikaniyyānikadhammesu asammohabhāvasiddhito pacchimavesārajjadvayasiddhīti bhagavato catuvesārajjasamannāgamo attahitaparahitapaṭipatti ca nidānavacanena pakāsitā hoti, tattha tattha sampattaparisāya ajjhāsayānurūpaṃ ṭhānuppattikappaṭibhānena dhammadesanādīpanato.
Thus, by the Buddha's pure state, which signifies the absolute absence of ignorance and craving—defilements of the speaker that corrupt right view and moral conduct—and which expresses the accomplishment of knowledge and the accomplishment of abandonment, the two former fearless states are attained. From that, through the attainment of the state of not being deluded regarding obstructive and emancipating dhammas, the two latter fearless states are attained. Thus, the Blessed One's possession of the four fearless states and his practice for his own welfare and the welfare of others are revealed by the introductory statement, through his skill in explaining the Dhamma with spontaneous wisdom (paṭibhāna) arising according to the disposition of the assembled audience in each place.
Như vậy, hai sự vô úy đầu tiên được thành tựu nhờ sự thanh tịnh của bậc Chánh Đẳng Giác, được biểu lộ qua sự viên mãn của trí tuệ và sự viên mãn của sự đoạn trừ, những điều này chỉ ra sự không có hoàn toàn của vô minh và ái dục, những thứ làm ô nhiễm người thuyết giảng và làm hư hoại sự viên mãn của kiến chấp và giới hạnh; và từ đó, hai sự vô úy sau cùng được thành tựu nhờ sự không mê lầm đối với các pháp gây chướng ngại và các pháp đưa đến giải thoát, do đó, sự thành tựu Tứ Vô Úy của Đức Thế Tôn và sự thực hành vì lợi ích của mình và lợi ích của người khác được bày tỏ qua lời dẫn nhập, bằng cách trình bày giáo pháp với trí tuệ ứng biến phù hợp với khuynh hướng của hội chúng hiện diện ở từng nơi.
Idha pana anavasesato kāmadosappahānaṃ vidhāya desanādīpanato cāti yojetabbaṃ.
But here, it should be connected by stating that it is also due to the exposition of the teaching by completely eliminating the faults of sensual pleasures.
Tuy nhiên, ở đây, cần phải kết hợp bằng cách trình bày giáo pháp bằng cách đoạn trừ hoàn toàn các lỗi lầm của dục vọng.
Tena vuttaṃ ‘‘satthu sampattippakāsanatthaṃ nidānavacana’’nti.
Therefore, it is said, "The introductory statement is for the manifestation of the Teacher's accomplishments."
Vì vậy, đã nói: “Lời dẫn nhập là để bày tỏ sự viên mãn của Đức Bổn Sư.”
Ettha ca ‘‘bhagavatā arahatā’’ti imehi padehi yathāvuttaatthavibhāvanatā heṭṭhā dassitā eva.
And here, the elucidation of the meaning, as already stated, by these terms "by the Blessed One, the Arahant," has already been shown below.
Và ở đây, sự giải thích ý nghĩa đã được nói đến ở dưới bằng các từ “Thế Tôn, bậc A-la-hán” đã được trình bày rõ ràng.
158
Tathā sāsanasampattippakāsanatthaṃ nidānavacanaṃ.
Likewise, the introductory statement is for the manifestation of the perfection of the Dispensation.
Tương tự, lời dẫn nhập còn để bày tỏ sự viên mãn của Giáo Pháp.
Ñāṇakaruṇāpariggahitasabbakiriyassa hi bhagavato natthi niratthakā paṭipatti attahitā vā.
Indeed, for the Blessed One, whose every action is encompassed by wisdom and compassion, there is no purposeless conduct, nor is it for his own benefit.
Thật vậy, đối với Đức Thế Tôn, người có tất cả các hành động được bao hàm bởi trí tuệ và lòng bi mẫn, không có hành vi nào là vô ích hay chỉ vì lợi ích của bản thân.
Tasmā paresaṃyevatthāya pavattasabbakiriyassa sammāsambuddhassa sakalampi kāyavacīmanokammaṃ yathāpavattaṃ vuccamānaṃ diṭṭhadhammikasamparāyikaparamatthehi yathārahaṃ sattānaṃ anusāsanatthena sāsanaṃ, na kabbaracanā.
Therefore, for the Perfectly Enlightened One, whose every action arises solely for the benefit of others, all his bodily, verbal, and mental actions, when spoken of as they occurred, constitute the Dispensation (sāsana)—a teaching for the guidance of beings in accordance with their suitability concerning benefits in this life, in the next, and ultimate reality—and not a mere literary composition.
Vì vậy, tất cả các hành động về thân, khẩu, ý của Đức Chánh Đẳng Giác, người có tất cả các hành động vì lợi ích của người khác, khi được nói ra đúng như đã xảy ra, thì đó chính là Giáo Pháp (Sāsana) theo ý nghĩa là sự giáo huấn chúng sinh một cách thích đáng về các lợi ích hiện tại, tương lai và tối thượng, chứ không phải là một sự sắp đặt văn chương.
Tayidaṃ satthu caritaṃ kāladesadesakaparisāpadesehi tattha tattha nidānavacanehi yathārahaṃ pakāsiyati.
This conduct of the Teacher is appropriately elucidated through introductory statements regarding time, place, speaker, and assembly in various instances.
Và hành vi ấy của Đức Bổn Sư được bày tỏ một cách thích đáng ở từng nơi bằng các lời dẫn nhập về thời gian, địa điểm, người thuyết giảng và hội chúng.
Idha pana desakaparisāpadesehīti yojetabbaṃ.
Here, however, it should be connected with the terms for speaker and assembly.
Tuy nhiên, ở đây, cần phải kết hợp bằng cách nói về người thuyết giảng và hội chúng.
Tena vuttaṃ ‘‘sāsanasampattippakāsanatthaṃ nidānavacana’’nti.
Hence it is said, "the introductory statement for the manifestation of the perfection of the Dispensation."
Vì vậy, đã nói: “Lời dẫn nhập là để bày tỏ sự viên mãn của Giáo Pháp.”
159
Apica satthuno pamāṇabhāvappakāsanena sāsanassa pamāṇabhāvadassanatthaṃ nidānavacanaṃ.
Furthermore, the introductory statement is for showing the authoritative nature of the Dispensation by manifesting the authoritative nature of the Teacher.
Hơn nữa, lời dẫn nhập còn để chỉ rõ tính chuẩn mực của Giáo Pháp bằng cách bày tỏ tính chuẩn mực của Đức Bổn Sư.
Tañcassa pamāṇabhāvadassanaṃ heṭṭhā vuttanayānusārena ‘‘bhagavatā arahatā’’ti imehi padehi vibhāvitanti veditabbaṃ.
And this manifestation of his authoritative nature is to be understood as having been elucidated by the terms "by the Blessed One, the Arahant," in accordance with the method stated earlier.
Và sự thể hiện trạng thái là tiêu chuẩn của Ngài được làm rõ bằng những từ ngữ “Bhagavatā Arahantā” này theo phương pháp đã nêu ở dưới. Điều này cần được hiểu.
Idamettha nidānavacanappayojanassa mukhamattanidassananti.
This is merely an indication of the main purpose of the introductory statement here.
Đây chỉ là sự trình bày sơ lược về mục đích của lời mở đầu trong trường hợp này.
160
Nidānavaṇṇanā niṭṭhitā.
The commentary on the Introduction is concluded.
Phần giải thích Nidāna đã hoàn tất.
161

1. Ekakanipāto

1. The Book of Ones (Ekakanipāto)

1. Ekakanipāta

Next Page →

Settings